Your browser is old and dusty. Try Google Chrome!

Details for sll1831

ORF sll1831
Accession NP_440465.1
Symbol
Category Glycolate pathway
Definition glycolate oxidase subunit, (Fe-S)protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_443032.1_3 Forward -211 -192 18.1907 0.212
NP_442151.1_6 Forward -155 -141 5.89945 0.256
NP_442975.1_10 Forward -249 -235 12.5853 0.0477
NP_441900.1_2 Reverse -259 -277 8.6715 0.114
NP_441859.1_5 Reverse -221 -240 1.0811 0.3
NP_441208.1_9 Reverse -257 -271 5.70279 0.262
NP_440856.1_4 Reverse -137 -156 -5.11376 0.278
NP_441738.1_4 Reverse -136 -155 5.11266 0.207
NP_440655.1_2 Forward -247 -228 1.76941 0.293
NP_441444.1_1 Reverse -377 -396 3.34271 0.295
NP_442675.1_4 Reverse -159 -177 -5.09406 0.271
NP_440053.1_9 Reverse -338 -357 15.7769 0.293
NP_440538.1_10 Reverse -119 -138 11.4058 0.253
NP_440644.1_3 Forward -175 -156 1.0811 0.278
NP_440747.1_10 Forward -312 -300 -12.2524 0.254
NP_440944.1_2 Forward -297 -278 2.65439 0.248
NP_440403.1_4 Forward -148 -129 -9.63698 0.279
NP_440842.1_6 Reverse -207 -226 12.9783 0.236
NP_441014.1_5 Reverse -295 -313 13.1955 0.218
NP_442848.1_5 Reverse -121 -139 -1.45582 0.276
NP_443018.1_3 Forward -66 -59 8.49558 0.141
NP_440376.1_1 Forward -155 -146 6.09625 0.111
NP_440376.1_1 Reverse -203 -212 2.94966 0.213
NP_440376.1_1 Forward -309 -300 0.688044 0.262
NP_442687.1_7 Reverse -299 -309 5.28991 0.211
NP_442485.1_3 Forward -214 -195 -4.72043 0.285
NP_441846.1_10 Forward -148 -129 -22.6167 0.264
NP_441422.1_7 Reverse -198 -215 0.235503 0.147
NP_442296.1_9 Reverse -294 -313 -0.4922 0.197
NP_440141.1_8 Reverse -230 -249 7.17762 0.246
NP_442782.1_2 Forward -211 -197 1.47456 0.281
NP_440184.1_5 Forward -319 -300 8.65258 0.193
NP_441487.1_9 Reverse -30 -49 -2.65548 0.293
NP_441478.1_5 Reverse -182 -201 16.2241 0.236
NP_439959.1_6 Forward -148 -129 5.80098 0.274
NP_442937.1_5 Forward -160 -141 12.4875 0.108
NP_442937.1_5 Forward -283 -264 7.17762 0.26
NP_442685.1_2 Forward -339 -329 17.0896 0.11
NP_440203.1_5 Reverse -220 -230 10.5993 0.218
NP_439905.1_1 Forward -247 -234 6.21414 0.295
NP_442876.1_6 Forward -386 -368 10.5061 0.298
NP_442064.1_1 Reverse -191 -210 -12.0953 0.268
NP_440993.1_3 Reverse -290 -309 2.9486 0.19
NP_440471.1_3 Forward -219 -205 15.5359 0.282
NP_442438.1_10 Forward -199 -185 8.25939 0.0795
NP_441398.1_9 Reverse -301 -320 11.3067 0.288
NP_440147.1_4 Reverse -144 -157 6.70579 0.0856
NP_441916.1_7 Reverse -58 -68 3.91327 0.198
NP_441916.1_7 Reverse -182 -192 1.16001 0.293
NP_440465.1_3 Forward -48 -29 18.4857 0.299
NP_440465.1_7 Forward -111 -93 25.0927 0.013
NP_440465.1_10 Forward -194 -175 23.8939 0.0309
NP_441041.1_3 Reverse -264 -282 19.6263 0.111
NP_441041.1_4 Forward -211 -192 -1.08219 0.1
NP_442281.1_1 Reverse -271 -285 1.5723 0.296
NP_440437.1_1 Reverse -197 -216 2.16274 0.139
NP_442012.1_1 Forward -73 -54 -0.4922 0.259
NP_441556.1_10 Forward -217 -203 11.3899 0.227
NP_441644.1_6 Forward -205 -195 5.97777 0.172
NP_442215.1_2 Forward -157 -141 3.79511 0.0918
NP_442029.1_1 Forward -133 -114 -11.3086 0.229
NP_440780.1_1 Forward -395 -376 8.16414 0.274
NP_442075.1_1 Forward -330 -311 12.6841 0.173
NP_442142.1_4 Reverse -269 -282 9.65513 0.0903
NP_442142.1_4 Reverse -136 -149 5.32859 0.194
NP_442292.1_5 Forward -216 -197 17.7974 0.119
NP_442741.1_1 Forward -121 -102 3.24438 0.291
NP_442741.1_7 Reverse -146 -165 14.8474 0.196
NP_441448.1_1 Reverse -228 -247 11.1109 0.188
NP_440777.1_8 Forward -172 -153 17.8957 0.113
NP_441015.1_10 Forward -160 -141 -11.0136 0.29
NP_441764.1_8 Forward -269 -259 11.7892 0.284
NP_442808.1_1 Reverse -121 -131 4.69947 0.192
NP_441882.1_6 Reverse -281 -300 8.94757 0.111
NP_442050.1_1 Forward -212 -193 16.7157 0.171
NP_440334.1_2 Reverse -240 -253 14.0806 0.274
NP_440630.1_3 Forward -229 -210 12.0942 0.143
NP_441518.1_4 Forward -381 -362 -0.00131823 0.299
NP_440101.1_10 Reverse -176 -195 10.5209 0.148
NP_442183.1_9 Forward -278 -268 9.7148 0.296
NP_440356.1_10 Reverse -313 -331 11.5239 0.253
NP_442888.1_7 Forward -139 -120 15.3391 0.281
NP_440151.1_5 Reverse -305 -324 3.14605 0.289
NP_441633.1_3 Reverse -6 -19 -7.15888 0.294
NP_442590.1_10 Reverse -304 -323 8.75091 0.204
NP_442590.1_10 Forward -218 -199 5.30933 0.264
NP_442590.1_10 Forward -155 -136 4.916 0.27
NP_441435.1_4 Reverse -346 -365 7.27595 0.255
NP_441559.1_8 Reverse -305 -319 -3.04867 0.197
NP_441559.1_8 Reverse -306 -320 -5.90027 0.271
NP_441559.1_8 Reverse -135 -149 -7.57189 0.295
NP_441931.1_7 Forward -134 -116 15.5554 0.232
NP_440306.1_5 Forward -391 -372 1.57275 0.207
NP_441494.1_6 Reverse -234 -247 6.21414 0.289
NP_440677.1_6 Forward -329 -310 11.8975 0.211
NP_441750.1_1 Reverse -230 -249 -11.3086 0.3
NP_440168.1_9 Forward -139 -120 1.96607 0.235
NP_440586.1_1 Reverse -178 -197 -5.01543 0.28
NP_440586.1_9 Forward -216 -197 6.09597 0.288
NP_439937.1_8 Forward -202 -183 -1.7705 0.249
NP_439937.1_9 Reverse -111 -128 -10.4832 0.229
NP_441789.1_7 Reverse -114 -133 -5.01617 0.293
NP_440267.1_2 Reverse -212 -226 4.52221 0.3
NP_442384.1_10 Reverse -300 -313 2.57589 0.22
NP_440364.1_6 Reverse -175 -188 13.195 0.29
NP_442262.1_10 Forward -66 -59 8.59391 0.22
NP_442750.1_3 Forward -140 -121 -11.1119 0.236
NP_440937.1_5 Forward -73 -54 8.06259 0.287
NP_440999.1_9 Forward -375 -361 -1.27871 0.232
NP_441543.1_2 Forward -190 -181 4.52295 0.234
NP_440208.1_1 Reverse -193 -212 -10.817 0.266
NP_440208.1_8 Forward -283 -264 17.8957 0.213
NP_441918.1_4 Reverse -304 -323 18.7807 0.199
NP_441918.1_7 Reverse -4 -23 -3.73712 0.297
NP_441469.1_8 Forward -138 -129 5.99792 0.241
NP_443064.1_6 Forward -309 -299 10.046 0.181
NP_441621.1_7 Reverse -168 -182 -6.58858 0.298
NP_440544.1_5 Reverse -262 -269 14.5681 0.264
NP_441052.1_2 Reverse -146 -156 4.20827 0.163
NP_442219.1_9 Forward -154 -145 1.86802 0.295
NP_441004.1_5 Forward -152 -138 6.88276 0.296
NP_441437.1_1 Reverse -311 -330 6.88262 0.288
NP_442873.1_5 Reverse -268 -287 6.88182 0.294
NP_442206.1_1 Reverse -170 -189 -12.0953 0.226
NP_442308.1_4 Forward -161 -142 0.687771 0.275
NP_441851.1_10 Forward -320 -310 11.4848 0.0715
NP_442208.1_5 Forward -214 -195 -9.44032 0.295
NP_441396.1_5 Forward -217 -208 8.25953 0.224
NP_441982.1_6 Forward -344 -335 12.1034 0.288
NP_440389.1_3 Reverse -137 -156 12.9791 0.254
NP_442450.1_5 Reverse -350 -360 5.5849 0.237
NP_441570.1_1 Forward -155 -137 -1.65248 0.0583
NP_441078.1_4 Reverse -146 -155 -0.885252 0.209
NP_440707.1_9 Forward -178 -159 0.294447 0.293
NP_441432.1_8 Reverse -145 -154 3.04799 0.268
NP_440461.1_3 Forward -279 -260 14.2574 0.288
NP_442010.1_9 Reverse -144 -158 11.307 0.256
NP_442489.1_3 Forward -181 -163 20.2745 0.213
NP_440565.1_7 Forward -216 -197 -0.295539 0.256
NP_441452.1_1 Reverse -308 -327 13.2741 0.292
NP_442079.1_7 Reverse -59 -78 3.14605 0.212
NP_441022.1_1 Forward -340 -331 13.7524 0.188
NP_440708.1_6 Reverse -136 -155 -9.44032 0.266
NP_440545.1_3 Forward -204 -187 -6.94266 0.293
NP_441126.1_4 Forward -245 -226 17.7965 0.29
NP_440459.1_2 Forward -311 -294 7.512 0.288
NP_442754.1_5 Forward -216 -197 21.5331 0.0356
NP_441973.1_1 Forward -304 -289 -7.78825 0.293
NP_441915.1_2 Forward -140 -121 18.4857 0.152
NP_442199.1_5 Forward -187 -168 -6.49039 0.275
NP_442723.1_8 Forward -74 -60 16.7159 0.269
NP_441813.1_7 Reverse -266 -280 14.0603 0.197
NP_440594.1_6 Reverse -203 -222 5.60352 0.281
NP_442089.1_1 Reverse -143 -162 1.27776 0.241
NP_440665.1_1 Reverse -311 -330 -14.8485 0.264
NP_440665.1_2 Forward -327 -308 -7.08038 0.298
NP_442270.1_9 Reverse -135 -154 -6.29373 0.207
NP_441526.1_6 Forward -187 -168 2.85105 0.271
NP_442041.1_5 Forward -211 -192 3.24438 0.244
NP_441230.1_5 Forward -211 -192 0.0977854 0.275
NP_441848.1_4 Forward -33 -17 11.1794 0.232
NP_441848.1_7 Forward -340 -321 -1.8696 0.257
NP_442039.1_7 Reverse -142 -152 6.76487 0.299
NP_442380.1_10 Reverse -187 -205 11.6222 0.224
NP_440505.1_3 Reverse -84 -94 7.05986 0.165
NP_442532.1_7 Forward -121 -107 2.45787 0.24
NP_441408.2_7 Forward -69 -50 -0.197208 0.23
NP_441011.1_8 Reverse -366 -375 5.3096 0.271
NP_442533.1_6 Reverse -182 -191 1.96635 0.28
NP_442269.1_10 Forward -160 -141 5.40766 0.238
NP_441602.1_3 Reverse -177 -196 -4.91709 0.277
NP_441972.1_5 Forward -308 -289 -2.55715 0.186
NP_441815.1_6 Reverse -259 -278 5.11187 0.187
NP_440646.1_1 Forward -39 -20 -1.57384 0.299
NP_442306.1_10 Forward -116 -97 -21.1417 0.247
NP_440083.1_2 Forward -281 -262 1.96607 0.208
NP_440404.1_9 Forward -394 -375 24.2068 0.0192
NP_441808.1_8 Reverse -170 -189 6.19431 0.291
NP_441021.1_1 Reverse -129 -148 -12.8819 0.299
NP_441463.1_3 Forward -165 -146 4.916 0.081
NP_442842.1_9 Forward -336 -317 12.3892 0.203
NP_442238.1_7 Reverse -40 -59 7.27514 0.248
NP_442615.1_1 Forward -164 -146 -7.35568 0.287
NP_442324.1_3 Reverse -250 -269 13.2741 0.194
NP_441510.2_6 Forward -319 -300 15.5349 0.154
NP_440293.1_10 Forward -140 -121 0.392778 0.219
NP_440766.1_5 Forward -345 -333 8.99268 0.277
NP_441237.1_6 Forward -308 -291 9.08529 0.128
NP_442743.1_1 Reverse -112 -131 10.3234 0.241
NP_440502.1_7 Forward -181 -162 14.6508 0.268
NP_442867.1_8 Reverse -285 -304 5.11266 0.277
NP_440942.1_10 Reverse -178 -197 16.9124 0.291
NP_442509.1_9 Forward -211 -201 9.321 0.192
NP_442936.1_10 Forward -341 -327 9.16816 0.269
NP_441885.1_3 Reverse -368 -387 19.7838 0.0522
NP_441885.1_5 Reverse -146 -156 0.766681 0.123
NP_441885.1_5 Reverse -311 -321 -1.69159 0.277
NP_440628.1_1 Forward -30 -20 13.1012 0.29
NP_441173.1_9 Forward -305 -297 10.9338 0.242
NP_440275.1_3 Reverse -194 -204 3.71661 0.215
NP_441207.1_5 Forward -202 -183 22.7139 0.0318
NP_439962.1_4 Reverse -192 -211 -4.91709 0.272
NP_439962.1_6 Forward -282 -264 10.1472 0.217
NP_440175.1_4 Forward -157 -138 -11.8003 0.21
NP_442373.1_2 Forward -218 -199 -8.85033 0.253
NP_440216.1_1 Forward -320 -306 -12.0951 0.24
NP_440216.1_9 Reverse -82 -91 7.37455 0.286
NP_440172.1_1 Reverse -182 -192 4.60159 0.178
NP_442015.1_10 Forward -110 -97 -0.767364 0.281
NP_442015.1_10 Reverse -4 -17 -0.964025 0.289
NP_443052.1_8 Reverse -102 -121 -9.63698 0.193
NP_442154.1_1 Forward -226 -208 -17.1888 0.249
NP_442154.1_1 Forward -139 -121 -17.1888 0.249
NP_442154.1_1 Forward -286 -268 -19.3521 0.298
NP_440261.1_5 Forward -204 -191 -6.47056 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACGGTCAGGGAAGCTAAACAAAATCAAGCCTTAACCTCCTTGGATGAAGCAGTTAGTGCGCAAAAATTTGTTTCCACCGTGGGGGAAGCCTGGCGTTTAGCCCAGGAAGGTCGAGGTAAATTGCTGGTGGTGGAGAAAAGCTACCATGAGCCTGCCATTATCTCCACTAACGGAGGCATTGAATTGGTGGCGGAACCCGGTGGCACGGAAGTCATCGACGACGCAGTGGACGAAATCATCGAAGTGGTGTTAGCCAATGGTGGGGAAGTGGCTTTAGTCGAAGATGGCACCCTCTCTCAACATCAACGTATTGCCTTGGTTTTACGCTACTGAGGCCATTGATTAAGTTAAGGGTAAGTTGACGGTTTCAGACTAGAAAAAAGTGTGATCATAGGGGACA

CDS

GTGTTTTTCCCCATGGTCCCTATGTCGGCTCCTCCCTCCTTCACCGCCTTGGCCCAGGCCGTCAACCAGCCCAAAATCGGCTTTGATTCCCAAAATCCCCCTCCCCAGGCCGTGTTGGATAGCTGTGTCCATTGCGGTTTTTGTTTGAATACCTGCCCGAGCTACCGGGTCATTGGCAAGGAAACCGATTCCCCCCGGGGCCGCATCTATCTAATGAATGGCATTAACCAAGGCCAAGCCAGTTTAGATGCCACCACCATCCAGCATTTTGACAGTTGTTTAGGTTGCTTAGCCTGTGTCAGTGCCTGTCCTTCGGGGGTGCAGTATGACCAGTTGATCTCCGCCACCAGGCCCCAGGTGGAACGAAATCATGACCGTCCCTTTGGCGATCGCCTCTTGCGGGGGATCATTTTTAACTTATTTCCCTATCCCTGGCGGTTGCGGTTATTGTTGCCCCTGCTCTGGGTCTACCAAAATTGTGGTTTGCAAAAATTAGTGCAAGCAACGGGCTTATTGAGCAGATTTTTTCCCCGTTTAGCGGCCATGGAAAGTATTTTGCCCAGGGTGACCGCCGCTTCTTTTCGGGATAATTATCCAACGGAAATTTCTGCCCAGGGGGAAAAGCGTTACCGAGTGGGGATAATTCTTGGGTGTGTACAAAGATTATTTTTCTCCCCCGTCAATGAAGCCACTGTCCGGGTTTTAACTGCCAATGGTTGCGAAGTAGTGATTCCCCAATCCCAAGGTTGTTGCGCCGCCCTCCCCGCCCACCAAGGCCAAACAGATCAAGCCGAGGCGATCGCCAGACAAATGATCGACAGTTTTGCTAATACGGAGGTGGACTACATCATTATTAATGCCGCCGGTTGCGGTCACACACTGAAGGAATATCATCATATCTTGGCCGACGATGCTGAATATTTACCCAAAGCCCAAGCCTTTGTTAGTAAAGTACGAGACATTAATGAGTTTCTGATGGAGATAGGGTTAAATCAAACCCTCCACCCCGTCACTGAGGAATTAACCCCTGTGGTTTATCAAGATGCTTGCCATCTGATCCATGGTCAAAAAATTAGTCTCCAACCCCGACAGTTGATTGCCCAAATTCCCCATTTACAGTTGCGGGAGCCCTTGGATGCGGCCCTCTGTTGTGGCAGTGCCGGGGTCTATAACATGCTCCAACCAGCCGTAGCAGAGGAACTGGGGCAGCAAAAAGTTAACAATCTCTGTCAAACCGGTGCCCAATTAATCATTTCCGCCAACCCTGGCTGCTCTTTGCAAATCCAAAAACATCTGGGAAAACAAGGCCAGAATCTAGGGGTTATTCATCCCATCCAATTGCTTGATCTGTCCCTGCGGGGGGAAAAGTTAACTGGTCTTTAG

Protein

MFFPMVPMSAPPSFTALAQAVNQPKIGFDSQNPPPQAVLDSCVHCGFCLNTCPSYRVIGKETDSPRGRIYLMNGINQGQASLDATTIQHFDSCLGCLACVSACPSGVQYDQLISATRPQVERNHDRPFGDRLLRGIIFNLFPYPWRLRLLLPLLWVYQNCGLQKLVQATGLLSRFFPRLAAMESILPRVTAASFRDNYPTEISAQGEKRYRVGIILGCVQRLFFSPVNEATVRVLTANGCEVVIPQSQGCCAALPAHQGQTDQAEAIARQMIDSFANTEVDYIIINAAGCGHTLKEYHHILADDAEYLPKAQAFVSKVRDINEFLMEIGLNQTLHPVTEELTPVVYQDACHLIHGQKISLQPRQLIAQIPHLQLREPLDAALCCGSAGVYNMLQPAVAEELGQQKVNNLCQTGAQLIISANPGCSLQIQKHLGKQGQNLGVIHPIQLLDLSLRGEKLTGL