Your browser is old and dusty. Try Google Chrome!

Details for sll1824

ORF sll1824
Accession NP_440637.1
Symbol rpl25
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L25
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -369 -383 6.78443 0.114
NP_441061.1_2 Forward -377 -363 -1.37704 0.258
NP_441061.1_2 Forward -226 -212 -2.36035 0.29
NP_440795.1_7 Forward -217 -210 7.80726 0.232
NP_441418.1_6 Forward -226 -207 -29.5982 0.23
NP_441480.1_2 Forward -200 -181 10.3242 0.299
NP_441453.1_4 Forward -153 -145 3.85433 0.284
NP_442151.1_6 Reverse -144 -158 5.99778 0.253
NP_442151.1_6 Forward -153 -139 5.1128 0.294
NP_441818.1_9 Forward -226 -207 10.5209 0.106
NP_441818.1_9 Forward -395 -376 -4.03212 0.234
NP_441818.1_9 Forward -220 -201 -6.68705 0.264
NP_441818.1_9 Forward -206 -187 -7.76869 0.273
NP_441818.1_9 Forward -389 -370 -8.45701 0.277
NP_442169.1_1 Forward -221 -202 -1.96717 0.271
NP_440150.1_2 Reverse -178 -197 8.06178 0.234
NP_440637.1_1 Forward -109 -90 29.3021 0.000511
NP_440637.1_2 Forward -44 -25 32.547 0.0000914
NP_440637.1_6 Forward -22 -3 29.1054 0.00103
NP_440637.1_7 Forward -74 -55 28.3188 0.000871
NP_440637.1_9 Forward -143 -124 21.5339 0.0933
NP_443002.1_5 Reverse -369 -387 16.9313 0.192
NP_442173.1_1 Forward -232 -224 5.42762 0.207
NP_442752.1_4 Reverse -144 -151 10.5605 0.1
NP_440784.1_7 Forward -152 -145 8.59391 0.129
NP_440784.1_7 Reverse -375 -382 6.43063 0.218
NP_440061.1_9 Forward -379 -365 5.70218 0.275
NP_440110.1_7 Forward -168 -149 12.0942 0.289
NP_440110.1_8 Reverse -43 -62 -3.3438 0.293
NP_441054.1_2 Forward -259 -240 13.2741 0.203
NP_439979.1_2 Forward -230 -211 9.63589 0.222
NP_439979.1_2 Forward -227 -208 8.25926 0.258
NP_439979.1_7 Reverse -308 -325 15.1818 0.267
NP_442062.1_8 Forward -153 -143 4.3066 0.221
NP_442062.1_8 Reverse -368 -378 2.92996 0.292
NP_442110.1_7 Forward -383 -369 3.44117 0.21
NP_441925.1_4 Reverse -379 -398 -15.3409 0.263
NP_441925.1_4 Reverse -375 -394 -16.2258 0.281
NP_441083.1_5 Forward -153 -143 7.94484 0.048
NP_441083.1_5 Reverse -144 -154 0.963343 0.218
NP_441558.1_5 Reverse -60 -79 5.11266 0.26
NP_441558.1_7 Reverse -350 -369 9.24257 0.276
NP_442889.1_1 Forward -383 -364 -15.7335 0.298
NP_442889.1_8 Forward -156 -142 7.57046 0.146
NP_440808.1_5 Forward -229 -210 16.9124 0.104
NP_441716.1_1 Reverse -144 -158 3.93283 0.259
NP_442111.1_4 Reverse -196 -210 1.96621 0.292
NP_440343.1_3 Reverse -370 -388 8.96649 0.195
NP_440747.1_10 Forward -156 -144 -4.68091 0.115
NP_440747.1_10 Reverse -141 -153 -4.68091 0.115
NP_440747.1_10 Forward -342 -330 -11.7607 0.142
NP_440747.1_10 Forward -380 -368 -12.1541 0.227
NP_441486.1_1 Forward -156 -142 2.85119 0.074
NP_441486.1_1 Reverse -141 -155 -4.4253 0.198
NP_442634.1_4 Forward -385 -371 2.35953 0.14
NP_440842.1_10 Reverse -365 -379 0.982901 0.296
NP_442848.1_5 Reverse -374 -392 -3.22577 0.29
NP_442848.1_9 Forward -338 -319 2.16274 0.255
NP_440376.1_1 Reverse -144 -153 6.5879 0.0915
NP_440376.1_1 Reverse -330 -339 5.89959 0.116
NP_440376.1_1 Forward -377 -368 4.62128 0.154
NP_440376.1_1 Forward -37 -28 3.83464 0.19
NP_440376.1_1 Forward -226 -217 2.35967 0.224
NP_440376.1_1 Forward -153 -144 -0.0986038 0.285
NP_441857.1_8 Reverse -272 -291 13.4708 0.288
NP_441588.1_4 Reverse -146 -156 5.09324 0.297
NP_443065.1_1 Forward -170 -151 13.7658 0.285
NP_442687.1_7 Reverse -367 -377 4.79825 0.234
NP_442687.1_7 Forward -199 -189 4.10993 0.266
NP_441013.1_7 Reverse -192 -211 13.175 0.298
NP_441763.1_10 Reverse -331 -350 6.88182 0.265
NP_440360.1_10 Forward -376 -362 3.8345 0.227
NP_442198.1_3 Forward -47 -28 3.04771 0.297
NP_442198.1_7 Reverse -81 -100 11.405 0.209
NP_440141.1_4 Forward -348 -329 -7.67036 0.298
NP_440662.1_2 Forward -56 -37 10.5209 0.0584
NP_442782.1_2 Forward -83 -69 1.57289 0.281
NP_442782.1_2 Reverse -69 -83 1.08123 0.282
NP_441414.1_9 Reverse -144 -163 -3.83545 0.143
NP_439959.1_8 Reverse -63 -82 26.0572 0.00135
NP_442937.1_5 Reverse -139 -158 14.4541 0.0758
NP_442937.1_5 Forward -46 -27 7.7676 0.241
NP_441127.1_1 Reverse -231 -245 8.75105 0.288
NP_439905.1_1 Reverse -369 -382 18.8005 0.0249
NP_442911.1_2 Reverse -52 -71 -8.06369 0.226
NP_440153.1_5 Forward -232 -218 0.392915 0.299
NP_442119.1_6 Reverse -97 -116 3.6377 0.3
NP_442064.1_4 Forward -349 -330 6.39016 0.251
NP_443055.1_6 Reverse -210 -228 0.411736 0.243
NP_443055.1_6 Forward -314 -296 -2.43985 0.295
NP_441129.1_3 Forward -355 -336 -17.8968 0.296
NP_442440.1_7 Reverse -45 -64 11.9958 0.215
NP_441646.1_1 Forward -346 -327 0.0977854 0.254
NP_441646.1_1 Reverse -361 -380 -0.590531 0.269
NP_442438.1_10 Forward -344 -330 -0.000409212 0.244
NP_441752.1_6 Reverse -379 -398 0.294447 0.26
NP_441752.1_6 Reverse -198 -217 -0.590531 0.279
NP_442231.1_2 Reverse -228 -247 16.7027 0.221
NP_441000.1_6 Forward -219 -205 -3.63866 0.225
NP_442771.1_1 Forward -385 -367 -10.1089 0.242
NP_440147.1_4 Forward -155 -142 6.1158 0.103
NP_440147.1_4 Reverse -328 -341 0.805932 0.244
NP_441550.1_8 Forward -155 -145 6.37109 0.212
NP_441916.1_10 Reverse -195 -214 5.211 0.214
NP_440206.1_4 Reverse -213 -232 -1.57461 0.292
NP_441041.1_4 Reverse -144 -163 -6.39206 0.167
NP_440703.1_9 Reverse -368 -381 8.67183 0.226
NP_439966.1_9 Forward -380 -371 3.7363 0.253
NP_442941.1_3 Forward -152 -142 -1.29827 0.297
NP_440983.1_5 Forward -153 -134 -7.17871 0.287
NP_440983.1_5 Reverse -197 -216 -7.37537 0.288
NP_440260.1_8 Forward -348 -330 -3.32411 0.251
NP_440260.1_8 Forward -162 -144 -3.71743 0.256
NP_442281.1_2 Reverse -47 -66 12.2908 0.298
NP_442012.1_5 Forward -346 -327 -0.787193 0.288
NP_441556.1_10 Forward -232 -218 12.6552 0.195
NP_440498.1_1 Reverse -208 -226 -3.32411 0.261
NP_440375.1_8 Reverse -145 -164 5.99764 0.168
NP_440375.1_8 Reverse -218 -237 -0.590531 0.266
NP_441644.1_6 Forward -153 -143 12.3692 0.0339
NP_441644.1_6 Reverse -144 -154 5.87944 0.174
NP_440867.1_10 Forward -168 -149 4.62101 0.283
NP_440867.1_10 Forward -227 -208 2.55606 0.285
NP_442215.1_2 Forward -155 -139 -5.15301 0.246
NP_442215.1_2 Reverse -142 -158 -5.54633 0.251
NP_442215.1_2 Forward -39 -23 -6.13632 0.264
NP_442177.1_5 Forward -229 -215 8.06273 0.288
NP_441810.1_5 Reverse -210 -229 6.19431 0.297
NP_442933.1_10 Reverse -144 -153 10.6195 0.0484
NP_441310.1_9 Reverse -93 -112 -2.55715 0.239
NP_442554.1_8 Reverse -145 -155 4.69992 0.176
NP_442554.1_8 Forward -152 -142 4.50326 0.184
NP_442142.1_4 Forward -369 -356 3.85363 0.243
NP_442292.1_1 Forward -152 -143 5.80125 0.129
NP_442292.1_1 Reverse -145 -154 -0.68859 0.268
NP_441264.1_10 Forward -54 -40 16.4209 0.264
NP_442381.1_8 Reverse -206 -225 -14.0619 0.28
NP_442301.1_2 Reverse -187 -206 11.2084 0.169
NP_440357.1_3 Forward -380 -361 21.7306 0.0342
NP_440357.1_3 Forward -251 -232 4.62101 0.242
NP_441448.1_1 Reverse -358 -377 4.81767 0.27
NP_441448.1_1 Forward -259 -240 4.32602 0.279
NP_440158.1_8 Forward -217 -198 11.5042 0.249
NP_440835.1_1 Forward -269 -250 0.0977854 0.122
NP_441468.1_1 Reverse -145 -152 4.26735 0.246
NP_441020.2_6 Forward -222 -205 6.23369 0.27
NP_441015.1_10 Forward -229 -210 -8.85033 0.277
NP_441673.1_1 Forward -153 -144 1.27803 0.155
NP_441673.1_1 Reverse -144 -153 1.27803 0.155
NP_441172.1_1 Reverse -205 -223 15.7521 0.0301
NP_441637.1_9 Forward -78 -60 -3.71743 0.296
NP_441764.1_8 Forward -115 -105 13.4162 0.284
NP_442719.1_2 Forward -77 -59 -10.9946 0.286
NP_441612.1_2 Forward -153 -143 8.25885 0.228
NP_442227.1_2 Reverse -208 -227 -0.295539 0.253
NP_442113.1_10 Reverse -213 -232 -7.4737 0.269
NP_440558.1_2 Forward -381 -362 7.27595 0.12
NP_440558.1_2 Reverse -365 -384 5.50599 0.145
NP_440558.1_2 Forward -342 -323 3.6377 0.154
NP_440558.1_3 Forward -349 -330 2.16274 0.283
NP_442789.1_4 Forward -100 -81 -7.76869 0.299
NP_440274.1_4 Reverse -248 -266 3.85406 0.157
NP_441878.1_6 Reverse -367 -377 1.55333 0.0937
NP_441878.1_6 Reverse -143 -153 1.55333 0.0937
NP_441878.1_6 Forward -384 -374 0.963343 0.128
NP_441878.1_6 Forward -154 -144 -0.314959 0.174
NP_441878.1_6 Forward -378 -368 -6.70647 0.194
NP_441878.1_6 Forward -198 -188 -6.70647 0.194
NP_441878.1_6 Forward -340 -330 -7.29646 0.217
NP_441878.1_6 Reverse -188 -198 -7.49312 0.231
NP_441878.1_6 Reverse -61 -71 -7.49312 0.231
NP_441878.1_6 Reverse -329 -339 -7.59145 0.245
NP_441878.1_6 Forward -315 -305 -7.68978 0.255
NP_441557.1_5 Forward -153 -144 0.393051 0.166
NP_441557.1_5 Reverse -144 -153 0.393051 0.166
NP_441445.1_1 Forward -207 -188 2.75272 0.229
NP_441445.1_1 Reverse -135 -154 1.86774 0.247
NP_441445.1_1 Forward -162 -143 0.491109 0.275
NP_441590.1_4 Reverse -210 -229 8.55343 0.249
NP_442777.1_3 Reverse -379 -397 0.0184138 0.298
NP_440101.1_3 Forward -388 -369 2.3594 0.257
NP_440356.1_2 Reverse -46 -65 -0.0988766 0.266
NP_441549.1_9 Forward -381 -363 -5.38906 0.198
NP_442347.1_2 Reverse -145 -154 5.01461 0.244
NP_442645.1_2 Forward -161 -142 -4.22878 0.0557
NP_441037.1_4 Reverse -216 -226 6.73295 0.245
NP_441633.1_3 Forward -379 -366 2.47756 0.0954
NP_441633.1_3 Reverse -187 -200 -7.25721 0.3
NP_442590.1_10 Forward -233 -214 17.8957 0.113
NP_442590.1_10 Forward -351 -332 4.62101 0.273
NP_442590.1_10 Reverse -218 -237 3.73603 0.286
NP_440299.1_1 Forward -157 -144 8.18017 0.0964
NP_440299.1_1 Forward -75 -62 5.62358 0.169
NP_441799.1_1 Forward -157 -143 10.9137 0.0648
NP_441799.1_1 Reverse -326 -340 3.63724 0.289
NP_441007.1_10 Forward -223 -210 7.88576 0.126
NP_442333.2_5 Reverse -213 -232 -13.3736 0.255
NP_441559.1_8 Forward -64 -50 1.76955 0.153
NP_441559.1_8 Forward -382 -368 -6.39192 0.277
NP_441559.1_8 Reverse -70 -84 -6.49025 0.279
NP_442756.1_4 Forward -101 -82 22.6156 0.0145
NP_441270.1_5 Forward -230 -211 12.5063 0.236
NP_440915.1_6 Forward -343 -329 -0.295402 0.189
NP_440748.1_4 Reverse -351 -370 15.6332 0.26
NP_441464.1_8 Forward -153 -139 3.93283 0.283
NP_440695.1_2 Forward -384 -365 15.5357 0.179
NP_441939.1_3 Reverse -331 -350 10.2259 0.128
NP_442993.1_1 Forward -339 -323 -14.0028 0.295
NP_440677.1_1 Reverse -53 -72 13.9625 0.129
NP_441750.1_4 Forward -230 -211 1.47442 0.28
NP_442186.1_9 Reverse -366 -385 6.29264 0.228
NP_440168.1_9 Reverse -322 -341 -4.91709 0.296
NP_442240.1_2 Reverse -109 -128 -19.9617 0.295
NP_440586.1_8 Forward -152 -145 9.28187 0.164
NP_440586.1_8 Reverse -198 -205 7.02027 0.279
NP_440027.1_3 Reverse -205 -223 14.5713 0.113
NP_440027.1_3 Reverse -368 -386 12.2114 0.159
NP_440027.1_3 Reverse -211 -229 6.21323 0.23
NP_440027.1_3 Reverse -218 -236 1.98502 0.295
NP_441232.1_10 Reverse -115 -134 5.60432 0.173
NP_439937.1_9 Forward -72 -55 -3.89507 0.157
NP_439937.1_9 Reverse -49 -66 -6.55 0.157
NP_441657.1_5 Reverse -358 -377 -1.57384 0.285
NP_441740.2_6 Forward -333 -314 9.14423 0.298
NP_440439.1_1 Reverse -221 -234 7.00078 0.0703
NP_440439.1_1 Reverse -178 -191 -1.16069 0.255
NP_442239.1_8 Forward -230 -211 8.25926 0.249
NP_442239.1_8 Forward -224 -205 4.71934 0.296
NP_441181.1_6 Forward -350 -332 3.95239 0.254
NP_441789.1_7 Reverse -379 -398 0.785326 0.245
NP_441803.1_2 Reverse -369 -388 -0.590531 0.282
NP_442384.1_10 Reverse -144 -157 14.8673 0.0128
NP_441018.1_7 Forward -224 -205 7.07928 0.277
NP_440282.1_10 Reverse -320 -339 -8.06369 0.259
NP_442750.1_8 Reverse -269 -288 23.3039 0.0428
NP_442280.1_10 Forward -163 -145 7.59723 0.268
NP_441592.1_4 Reverse -368 -387 1.17943 0.225
NP_440894.1_2 Reverse -40 -59 -1.67217 0.296
NP_441679.1_1 Forward -63 -44 -4.91709 0.243
NP_442067.1_4 Forward -235 -216 3.73603 0.278
NP_440888.1_2 Forward -306 -292 11.1104 0.0757
NP_440888.1_2 Reverse -330 -344 5.89884 0.258
NP_440888.1_4 Forward -167 -153 16.6245 0.218
NP_442818.1_3 Forward -55 -38 0.727158 0.234
NP_441543.1_2 Forward -152 -143 11.6028 0.0504
NP_442845.1_2 Reverse -330 -344 4.12949 0.267
NP_441834.1_10 Forward -53 -34 5.211 0.26
NP_441918.1_7 Reverse -61 -80 -3.44213 0.297
NP_440982.1_1 Reverse -197 -216 7.07848 0.294
NP_442315.1_1 Forward -394 -376 19.6853 0.0494
NP_441462.1_2 Reverse -224 -234 6.07655 0.075
NP_441621.1_7 Reverse -207 -221 -4.52363 0.232
NP_442736.1_1 Forward -304 -285 4.03102 0.287
NP_443062.1_1 Reverse -144 -162 5.13317 0.238
NP_442204.1_5 Reverse -224 -243 2.3594 0.213
NP_440516.1_6 Forward -71 -57 13.7653 0.188
NP_442428.1_4 Forward -227 -208 10.8159 0.133
NP_442428.1_5 Reverse -145 -152 11.4455 0.062
NP_441267.1_1 Forward -159 -140 1.17943 0.279
NP_441835.1_2 Reverse -54 -73 5.11266 0.27
NP_440673.1_2 Forward -163 -144 10.0969 0.224
NP_441714.1_3 Forward -160 -142 13.0964 0.25
NP_441052.1_2 Reverse -144 -154 14.533 0.0196
NP_441052.1_2 Forward -153 -143 13.8447 0.0268
NP_442219.1_9 Reverse -145 -154 4.81794 0.196
NP_440436.1_4 Forward -152 -143 4.7192 0.244
NP_441884.1_8 Forward -238 -219 -6.29373 0.219
NP_441884.1_9 Reverse -215 -234 -20.8467 0.211
NP_441004.1_2 Reverse -358 -377 4.916 0.195
NP_441004.1_2 Forward -229 -210 -3.3438 0.277
NP_442366.1_3 Forward -352 -334 -5.48739 0.288
NP_442366.1_5 Forward -156 -146 11.9759 0.148
NP_442139.1_7 Forward -388 -369 7.86593 0.279
NP_442206.1_1 Forward -378 -359 5.70265 0.0633
NP_442206.1_1 Reverse -209 -228 -10.0303 0.219
NP_443054.1_2 Reverse -187 -201 0.196253 0.274
NP_443054.1_2 Forward -379 -365 -0.492064 0.295
NP_441851.1_10 Reverse -143 -153 4.99491 0.233
NP_442856.1_7 Forward -386 -367 -4.91709 0.27
NP_442515.1_1 Reverse -188 -202 1.76955 0.149
NP_442515.1_1 Forward -154 -140 1.76955 0.149
NP_442515.1_1 Forward -378 -364 -4.91696 0.298
NP_441396.1_5 Forward -205 -196 8.35786 0.224
NP_440593.1_3 Forward -76 -57 -3.54046 0.236
NP_440593.1_3 Reverse -229 -248 -6.29373 0.272
NP_441540.1_5 Reverse -272 -290 16.5379 0.237
NP_440432.1_9 Forward -152 -137 -4.54333 0.211
NP_442843.1_6 Forward -360 -341 9.14423 0.258
NP_440588.1_2 Reverse -365 -384 -6.78538 0.292
NP_442006.1_2 Forward -323 -306 -16.7758 0.264
NP_441078.1_4 Reverse -144 -153 7.57121 0.0591
NP_441078.1_4 Forward -339 -330 6.39124 0.0775
NP_441078.1_4 Forward -153 -144 0.786375 0.157
NP_441078.1_4 Forward -377 -368 -1.37691 0.254
NP_441078.1_4 Reverse -330 -339 -1.77023 0.266
NP_442348.1_2 Forward -49 -40 9.14451 0.28
NP_440707.1_9 Forward -217 -198 1.67108 0.292
NP_442443.1_1 Forward -134 -115 -2.55715 0.258
NP_441432.1_8 Forward -378 -369 12.2911 0.0444
NP_441432.1_8 Forward -154 -145 5.89959 0.13
NP_441432.1_8 Reverse -143 -152 4.22796 0.235
NP_441432.1_8 Forward -340 -331 3.34298 0.248
NP_442320.1_8 Reverse -138 -152 -6.39192 0.283
NP_441732.1_2 Reverse -326 -342 -16.9527 0.223
NP_442797.1_1 Reverse -376 -395 0.196116 0.223
NP_442797.1_6 Forward -75 -56 11.0368 0.238
NP_442797.1_7 Forward -379 -361 2.28076 0.243
NP_441057.1_4 Forward -387 -369 -2.93078 0.276
NP_442489.1_2 Reverse -198 -217 5.89931 0.187
NP_442489.1_7 Reverse -144 -153 8.06287 0.0371
NP_442489.1_7 Forward -153 -144 0.589713 0.17
NP_442489.1_7 Forward -377 -368 -1.37691 0.195
NP_442489.1_7 Forward -339 -330 -1.37691 0.195
NP_442489.1_7 Reverse -368 -377 -1.6719 0.235
NP_442079.1_7 Forward -205 -186 1.0811 0.263
NP_441659.2_8 Forward -153 -143 6.37155 0.0774
NP_441022.1_1 Forward -81 -72 10.587 0.294
NP_441040.1_2 Forward -385 -366 -14.7502 0.286
NP_441800.1_7 Reverse -212 -230 0.904127 0.21
NP_442346.1_5 Forward -154 -144 12.1731 0.0475
NP_442346.1_5 Reverse -143 -153 11.4848 0.0663
NP_440831.1_3 Forward -229 -210 11.0468 0.166
NP_440831.1_3 Reverse -215 -234 5.02806 0.29
NP_440459.1_2 Forward -235 -218 14.9851 0.117
NP_440010.1_3 Forward -238 -219 -4.13045 0.25
NP_442551.1_4 Reverse -366 -381 -1.29841 0.245
NP_441233.1_2 Forward -229 -210 15.0441 0.162
NP_441233.1_2 Forward -386 -367 11.7008 0.276
NP_442060.1_5 Reverse -67 -86 14.6508 0.235
NP_440671.1_4 Reverse -218 -232 6.19444 0.257
NP_441973.1_1 Reverse -113 -128 0.27489 0.235
NP_442943.1_1 Reverse -64 -79 9.23067 0.19
NP_440772.1_6 Reverse -54 -73 13.8641 0.187
NP_440875.1_9 Forward -195 -185 9.63741 0.233
NP_440590.1_1 Reverse -339 -358 12.9783 0.22
NP_440590.1_4 Forward -232 -219 -6.07724 0.299
NP_441951.1_4 Forward -233 -214 1.57275 0.283
NP_440156.1_4 Forward -70 -60 16.4008 0.176
NP_440400.1_1 Reverse -211 -230 10.1267 0.217
NP_441892.1_1 Forward -323 -306 3.77542 0.119
NP_441526.1_6 Forward -229 -210 7.66927 0.258
NP_440949.1_5 Forward -85 -66 17.5024 0.221
NP_440949.1_7 Reverse -210 -229 8.55343 0.28
NP_442052.1_7 Forward -61 -47 12.586 0.259
NP_440546.1_4 Forward -220 -210 6.74945 0.282
NP_441230.1_5 Forward -238 -219 6.4893 0.179
NP_440675.1_1 Forward -387 -368 11.7008 0.177
NP_442465.1_9 Forward -88 -74 10.521 0.291
NP_442499.1_6 Reverse -63 -82 11.7008 0.203
NP_441474.1_1 Reverse -376 -395 -0.787962 0.255
NP_440696.1_3 Forward -387 -369 -0.177514 0.241
NP_440696.1_3 Forward -230 -212 -1.45582 0.259
NP_440696.1_6 Reverse -84 -103 2.94938 0.296
NP_442696.1_6 Reverse -205 -224 -3.24547 0.147
NP_442696.1_6 Reverse -381 -400 -12.8819 0.253
NP_441701.1_3 Reverse -359 -376 9.67528 0.245
NP_440914.1_1 Reverse -144 -154 6.66328 0.269
NP_440914.1_1 Forward -153 -143 6.27291 0.288
NP_441011.1_8 Forward -350 -341 7.86621 0.165
NP_441011.1_8 Forward -338 -329 6.78456 0.184
NP_442533.1_6 Forward -153 -144 14.946 0.00753
NP_442533.1_6 Reverse -144 -153 6.39124 0.111
NP_442533.1_6 Reverse -374 -383 2.458 0.255
NP_442533.1_6 Reverse -189 -198 2.16301 0.27
NP_442541.1_10 Reverse -368 -382 14.7486 0.182
NP_442541.1_10 Forward -333 -319 3.04726 0.254
NP_442232.1_3 Reverse -360 -379 -15.6352 0.295
NP_442322.1_4 Reverse -382 -399 -5.07504 0.265
NP_442322.1_4 Reverse -380 -397 -7.63163 0.286
NP_442322.1_4 Reverse -197 -214 -7.72996 0.286
NP_441482.1_7 Reverse -336 -350 -1.47537 0.0721
NP_441028.1_6 Forward -303 -293 5.48612 0.255
NP_440116.1_8 Forward -236 -217 -2.75381 0.139
NP_440007.1_9 Reverse -71 -85 5.89945 0.242
NP_439965.1_1 Forward -246 -227 -2.75381 0.177
NP_439965.1_7 Reverse -67 -86 11.7797 0.294
NP_441961.1_4 Forward -314 -295 2.75272 0.281
NP_441544.1_1 Forward -380 -368 15.9686 0.242
NP_441602.1_3 Forward -383 -364 0.392778 0.217
NP_441972.1_5 Reverse -351 -370 -7.57203 0.25
NP_441106.1_1 Forward -227 -218 2.75299 0.261
NP_441815.1_3 Reverse -367 -386 8.16093 0.257
NP_441815.1_6 Reverse -198 -217 1.76863 0.24
NP_442306.1_10 Reverse -184 -203 5.60432 0.0484
NP_442306.1_10 Forward -382 -363 -3.44213 0.11
NP_441286.1_1 Forward -378 -366 -4.77924 0.175
NP_441286.1_1 Reverse -143 -155 -6.64753 0.271
NP_441286.1_1 Forward -154 -142 -6.64753 0.271
NP_440886.1_7 Forward -154 -144 7.0594 0.106
NP_442072.1_9 Reverse -61 -79 -22.4003 0.234
NP_442213.1_6 Forward -68 -49 10.6192 0.246
NP_441808.1_8 Forward -226 -207 5.99764 0.294
NP_441021.1_1 Reverse -369 -388 -2.75381 0.145
NP_441021.1_8 Forward -319 -301 4.44404 0.223
NP_440176.1_3 Reverse -306 -320 16.1252 0.219
NP_442211.1_3 Reverse -29 -48 9.80632 0.257
NP_441460.1_5 Reverse -270 -284 13.8636 0.28
NP_442794.1_1 Reverse -140 -152 4.5622 0.256
NP_442615.1_1 Forward -348 -330 -3.02911 0.154
NP_442615.1_1 Reverse -321 -339 -4.30741 0.183
NP_441962.1_4 Forward -232 -213 -11.2103 0.238
NP_441962.1_4 Forward -76 -57 -14.7502 0.293
NP_440387.1_1 Reverse -144 -160 -4.75968 0.198
NP_441431.1_2 Reverse -206 -220 8.45543 0.216
NP_441993.1_1 Forward -204 -185 7.30684 0.169
NP_441993.1_1 Forward -77 -58 1.4594 0.276
NP_441174.1_4 Forward -55 -45 13.5497 0.267
NP_442352.1_8 Reverse -194 -208 16.3219 0.242
NP_440114.1_10 Forward -339 -325 6.6861 0.26
NP_441206.1_2 Forward -232 -213 13.3725 0.206
NP_441510.2_7 Reverse -218 -232 15.5352 0.28
NP_440293.1_1 Forward -385 -366 11.6025 0.228
NP_440293.1_3 Reverse -361 -380 -2.65548 0.241
NP_440293.1_9 Forward -219 -205 11.3443 0.257
NP_440293.1_10 Forward -398 -379 -0.688862 0.255
NP_439988.1_3 Forward -382 -368 9.2427 0.249
NP_439988.1_3 Forward -344 -330 3.63784 0.298
NP_441237.1_9 Forward -377 -367 10.6981 0.22
NP_441133.1_1 Forward -226 -207 16.5191 0.163
NP_442680.1_7 Reverse -289 -308 -9.14533 0.283
NP_441984.1_1 Forward -226 -208 14.8671 0.152
NP_441332.1_6 Reverse -216 -226 11.8404 0.244
NP_442514.1_5 Forward -233 -214 -4.03287 0.238
NP_440734.1_9 Forward -243 -224 18.6823 0.0967
NP_441885.1_5 Forward -153 -143 2.24165 0.0822
NP_441885.1_5 Reverse -144 -154 1.35667 0.11
NP_441428.1_8 Reverse -361 -380 10.3242 0.178
NP_442310.1_1 Forward -385 -366 18.6823 0.122
NP_442341.1_7 Forward -154 -140 6.48943 0.126
NP_442341.1_9 Reverse -372 -386 8.45543 0.17
NP_440507.2_3 Forward -227 -208 10.1267 0.208
NP_442451.1_2 Forward -385 -366 -1.47551 0.172
NP_442451.1_2 Reverse -216 -235 -11.4069 0.294
NP_441122.1_1 Forward -157 -142 2.8315 0.294
NP_440149.1_8 Forward -351 -332 -6.49039 0.253
NP_440149.1_8 Reverse -62 -81 -7.08038 0.272
NP_441105.1_3 Reverse -319 -338 -9.53865 0.29
NP_442373.1_10 Forward -230 -211 8.84924 0.137
NP_440172.1_1 Reverse -189 -199 4.50326 0.184
NP_440172.1_1 Reverse -342 -352 3.42162 0.228
NP_440172.1_1 Forward -153 -143 2.53664 0.277
NP_440172.1_1 Reverse -144 -154 2.43831 0.279
NP_442015.1_3 Reverse -195 -214 9.53674 0.296
NP_442329.1_7 Forward -266 -247 11.7983 0.3
NP_441226.1_7 Reverse -218 -225 8.59356 0.197
NP_441226.1_7 Forward -232 -225 7.1186 0.218
NP_441226.1_7 Reverse -2 -9 6.52862 0.253
NP_440416.1_9 Reverse -335 -354 -6.88371 0.0951
NP_440416.1_9 Forward -244 -225 -8.35868 0.114
NP_443052.1_9 Reverse -373 -392 -5.99873 0.276
NP_443052.1_9 Reverse -207 -226 -6.58872 0.285
NP_440820.2_8 Forward -227 -208 10.7175 0.261
NP_442154.1_1 Forward -226 -208 -7.84733 0.148
NP_442154.1_1 Forward -217 -199 -9.0273 0.175
NP_442154.1_1 Forward -394 -376 -16.0088 0.229
NP_440988.1_10 Reverse -232 -246 11.8693 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGGGGGAGCTTGTGTGGGTGCTGGCATTGGCCCCACCATGATTGACCGAGTTATCGGCGTGGCTAAGGCCTATACCACCCGAGTGGGAGAAGGACCCTTTCCCACAGAGCTAGATGGAGAATTAAATCAACATCTCTGTGACCGTGGAGCAGAGTTTGGCACCACGACCGGTCGGCGTCGGCGCTGTGGCTGGTTTGATGGGGTCATTGGCCGCTACGCTGTGCGTATTAATGGGCTGGACTGTTTGGCCATCACCAAATTAGACGTGCTGGACCAACTAGCGGAAATCAAAGTTTGCGTCGCCTATGAACTAGACGGCAAAACCTGTGACCATTTCCCCGGTAATGCGGCGGAATTTGCTCGGTGTCAGCCCATCTATAAAACCCTTCCCGGTTGGCA

CDS

ATGTTCCACGGAAGAATGCCGCACCCTGGAGGATTTACCTCCCCAGGCCCTGGACTACTTGAAGTTCCTGGCAGAATTAATGGAGGTGCCGATCGCGATTGTTTCCCTAGGGGCCAGTCGGGATCAGACAATTATTGTCGAAGACCCCATCCATGGGCCAAAGCGAGCTTTACTTTATGCCAACGGCGATCCGCTAGCTTGATGTGGCCCAAAATTGCCTTTCCTTTGTTAACCCTGATTATTATTTTTACGAGTATTACCATGGCCCTTTCCATTGAATGTCAACAACGTCCCGAAAAAGTTAATCCTAGAGCTTTGCGTCGGGAAGGTTTAATTCCCGCGACCCTCTATGGACACAATGGTGCAGAATCCATTTCCCTAGTGGTGGATCATAAAACCGCCATCACCATGTTGCGGAGTGTGACTGTTAAAGAAACCCCCATTGAAGTTAAAATCCCCCATCTTTCCTGGGAAGGGGAAGCCGTAGTGCAGGAGATTCAGTGCCATCCTTGGCGCCGGAATCTTTACCACTTGGCTTTTTTTGCCGGTAAAAAATAA

Protein

MFHGRMPHPGGFTSPGPGLLEVPGRINGGADRDCFPRGQSGSDNYCRRPHPWAKASFTLCQRRSASLMWPKIAFPLLTLIIIFTSITMALSIECQQRPEKVNPRALRREGLIPATLYGHNGAESISLVVDHKTAITMLRSVTVKETPIEVKIPHLSWEGEAVVQEIQCHPWRRNLYHLAFFAGKK