Your browser is old and dusty. Try Google Chrome!

Details for sll1819

ORF sll1819
Accession NP_440644.1
Symbol rpl17
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L17
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_4 Forward -326 -318 9.75419 0.0493
NP_440561.1_8 Forward -149 -130 5.89931 0.289
NP_440150.1_6 Reverse -314 -333 0.982764 0.295
NP_442744.1_8 Reverse -311 -330 -2.75381 0.297
NP_441812.1_1 Forward -312 -298 11.897 0.256
NP_442975.1_10 Forward -382 -368 4.62054 0.241
NP_440061.1_9 Forward -322 -308 8.55376 0.17
NP_440110.1_4 Forward -337 -318 9.0459 0.126
NP_442062.1_8 Forward -320 -310 3.51995 0.267
NP_442242.1_4 Forward -319 -312 9.47889 0.251
NP_441781.1_7 Reverse -293 -312 10.0292 0.138
NP_441781.1_7 Forward -114 -95 -2.16383 0.288
NP_441492.1_2 Reverse -47 -66 8.94757 0.191
NP_441594.1_6 Forward -329 -310 0.687771 0.282
NP_442375.1_2 Forward -148 -129 9.93088 0.279
NP_441925.1_4 Reverse -125 -144 -5.99948 0.185
NP_442827.1_8 Reverse -124 -143 -0.591301 0.231
NP_442889.1_10 Reverse -362 -381 11.1989 0.251
NP_440056.1_6 Forward -146 -127 16.7582 0.192
NP_440178.1_7 Reverse -80 -99 -14.4552 0.153
NP_440178.1_7 Reverse -131 -150 -21.83 0.241
NP_442570.1_3 Reverse -309 -328 -3.44213 0.219
NP_440644.1_1 Forward -179 -160 30.5804 0.000254
NP_440644.1_2 Forward -251 -232 32.0554 0.000107
NP_440644.1_3 Forward -149 -130 25.6638 0.00287
NP_440644.1_4 Forward -287 -268 30.9737 0.000141
NP_440644.1_5 Forward -230 -211 29.4004 0.000442
NP_440644.1_6 Forward -200 -181 27.5321 0.00213
NP_440644.1_7 Forward -119 -100 26.7455 0.00248
NP_440343.1_3 Reverse -125 -143 2.67334 0.291
NP_440747.1_10 Reverse -308 -320 -2.81262 0.0713
NP_440747.1_10 Forward -323 -311 -12.0557 0.199
NP_442634.1_4 Reverse -309 -323 -3.147 0.161
NP_441014.1_10 Forward -258 -239 0.981987 0.236
NP_443018.1_3 Forward -281 -274 8.20058 0.153
NP_443018.1_3 Reverse -65 -72 5.34899 0.212
NP_442687.1_7 Reverse -310 -320 7.05986 0.142
NP_442687.1_7 Reverse -104 -114 4.79825 0.234
NP_441077.1_6 Reverse -14 -30 2.12702 0.289
NP_442198.1_3 Reverse -287 -306 2.26107 0.299
NP_440446.1_8 Forward -344 -325 9.24257 0.226
NP_440203.1_5 Reverse -296 -306 9.81266 0.245
NP_440203.1_5 Forward -285 -275 9.81266 0.245
NP_440443.2_7 Forward -338 -319 20.4514 0.222
NP_439990.1_5 Forward -240 -227 5.62415 0.283
NP_442690.1_1 Forward -170 -151 -9.53865 0.201
NP_442690.1_1 Reverse -360 -379 -13.6686 0.264
NP_441646.1_1 Reverse -125 -144 -0.787193 0.272
NP_442438.1_10 Forward -325 -311 4.62115 0.144
NP_442438.1_10 Reverse -294 -308 -0.295402 0.256
NP_442431.1_10 Forward -144 -126 6.214 0.195
NP_441041.1_4 Forward -399 -380 -9.73531 0.222
NP_442941.1_3 Forward -319 -309 6.8632 0.0954
NP_441079.1_4 Forward -118 -99 15.9797 0.224
NP_442500.1_8 Reverse -16 -30 15.1915 0.151
NP_441644.1_6 Forward -320 -310 7.84605 0.115
NP_442215.1_2 Reverse -309 -325 -5.54633 0.251
NP_442215.1_2 Forward -335 -319 -6.62797 0.277
NP_442029.1_6 Forward -336 -317 3.44104 0.282
NP_442029.1_6 Reverse -306 -325 2.45773 0.296
NP_442933.1_10 Reverse -311 -320 4.22796 0.267
NP_442554.1_8 Reverse -318 -328 2.43831 0.272
NP_442292.1_1 Reverse -391 -400 3.04799 0.211
NP_443009.1_5 Forward -236 -225 3.69644 0.282
NP_441715.1_4 Forward -319 -309 14.828 0.0268
NP_441468.1_1 Reverse -227 -234 8.79057 0.111
NP_441020.2_6 Forward -143 -126 5.84037 0.289
NP_441015.1_10 Reverse -306 -325 1.37609 0.16
NP_441015.1_10 Forward -146 -127 -3.24547 0.186
NP_441826.1_2 Forward -326 -312 2.85119 0.119
NP_442868.1_6 Reverse -309 -319 6.17489 0.125
NP_441612.1_2 Reverse -354 -364 8.25885 0.228
NP_442559.1_3 Forward -106 -87 9.53756 0.276
NP_442808.1_1 Reverse -389 -399 5.48612 0.151
NP_442542.1_2 Forward -328 -315 4.54251 0.3
NP_442113.1_10 Reverse -323 -342 -8.26035 0.278
NP_440558.1_2 Forward -111 -92 -5.70374 0.264
NP_441557.1_5 Reverse -311 -320 -0.885252 0.26
NP_441557.1_8 Forward -106 -96 13.2542 0.224
NP_440101.1_3 Reverse -306 -325 7.27595 0.177
NP_440356.1_9 Reverse -19 -38 14.1591 0.198
NP_442317.1_6 Reverse -127 -146 1.67108 0.298
NP_440136.1_2 Reverse -227 -234 4.16902 0.234
NP_441799.1_1 Reverse -307 -321 3.8339 0.279
NP_441007.1_5 Forward -218 -199 9.63589 0.225
NP_442158.1_4 Forward -21 -11 10.3048 0.299
NP_442866.1_1 Reverse -59 -78 -7.37537 0.266
NP_442386.1_9 Reverse -389 -398 4.81753 0.282
NP_441750.1_4 Forward -131 -112 1.47442 0.28
NP_442186.1_10 Reverse -124 -143 23.598 0.0264
NP_442714.1_5 Forward -149 -130 1.57275 0.238
NP_440586.1_8 Forward -281 -274 9.08521 0.178
NP_442251.1_6 Forward -319 -312 10.3639 0.134
NP_439937.1_9 Reverse -147 -164 -13.5315 0.287
NP_442384.1_10 Forward -320 -307 6.1158 0.11
NP_441018.1_7 Reverse -307 -326 7.47261 0.269
NP_442262.1_10 Forward -281 -274 9.38056 0.202
NP_442262.1_10 Reverse -65 -72 7.6106 0.274
NP_442123.1_10 Forward -363 -344 5.11266 0.288
NP_441060.1_1 Reverse -369 -388 12.4733 0.294
NP_441592.1_4 Reverse -317 -336 -4.22878 0.297
NP_440999.1_9 Reverse -131 -145 -2.65535 0.273
NP_440999.1_9 Reverse -307 -321 -3.04867 0.283
NP_440822.1_8 Forward -143 -124 9.43923 0.258
NP_441543.1_2 Forward -319 -310 4.22796 0.267
NP_442845.1_2 Reverse -311 -325 8.94771 0.183
NP_443064.1_6 Forward -320 -310 10.046 0.181
NP_443062.1_1 Forward -235 -217 4.64563 0.255
NP_441410.1_4 Forward -117 -98 8.06178 0.297
NP_442219.1_9 Reverse -312 -321 5.50626 0.153
NP_440436.1_4 Forward -319 -310 4.42421 0.265
NP_440746.1_3 Forward -143 -124 0.392778 0.285
NP_442854.1_6 Reverse -311 -330 1.47442 0.279
NP_441851.1_10 Reverse -225 -235 4.79825 0.247
NP_442622.1_8 Reverse -317 -335 -18.8604 0.285
NP_441542.1_4 Forward -384 -370 10.226 0.25
NP_442515.1_1 Reverse -353 -367 -3.44199 0.29
NP_440940.1_7 Reverse -45 -63 2.67334 0.295
NP_442843.1_1 Forward -72 -53 -10.7186 0.28
NP_441477.1_10 Forward -327 -309 -0.570838 0.294
NP_442168.1_5 Reverse -125 -144 4.22769 0.218
NP_440588.1_2 Forward -335 -316 -1.27885 0.155
NP_442006.1_2 Forward -150 -133 -15.2025 0.22
NP_441570.1_1 Reverse -311 -329 -10.7973 0.18
NP_441078.1_4 Reverse -191 -200 3.14632 0.15
NP_440707.1_9 Forward -152 -133 1.47442 0.292
NP_441432.1_8 Reverse -310 -319 7.96454 0.0953
NP_441432.1_8 Reverse -44 -53 2.55633 0.298
NP_441333.1_1 Forward -28 -18 15.1171 0.175
NP_441805.1_1 Forward -101 -82 -2.95047 0.201
NP_440281.1_6 Forward -293 -274 9.73422 0.268
NP_442400.1_10 Reverse -18 -31 10.1839 0.265
NP_442489.1_7 Forward -320 -311 -1.86856 0.259
NP_440559.1_1 Reverse -312 -321 4.42462 0.277
NP_442346.1_5 Reverse -310 -320 9.02648 0.118
NP_440010.1_4 Reverse -301 -320 -3.04956 0.294
NP_442603.1_7 Reverse -311 -325 6.78381 0.23
NP_441948.1_9 Forward -342 -324 12.9988 0.294
NP_441329.1_6 Reverse -359 -378 4.34446 0.206
NP_440671.1_4 Forward -326 -312 9.5377 0.18
NP_441671.1_10 Forward -152 -133 5.80098 0.215
NP_441239.1_9 Reverse -224 -236 3.38223 0.285
NP_441009.1_7 Forward -327 -308 10.6192 0.246
NP_440624.1_5 Forward -178 -160 7.18536 0.298
NP_440546.1_4 Reverse -317 -327 7.33119 0.246
NP_441603.1_5 Forward -373 -354 12.4867 0.277
NP_442465.1_9 Forward -95 -81 12.0943 0.221
NP_441848.1_4 Reverse -8 -24 8.98304 0.288
NP_439942.1_7 Reverse -266 -285 -1.27885 0.242
NP_442625.1_6 Forward -329 -310 14.5524 0.184
NP_442837.1_3 Reverse -227 -234 9.77388 0.115
NP_440505.1_3 Reverse -309 -319 7.55152 0.151
NP_441203.1_1 Reverse -312 -331 -14.7502 0.202
NP_441408.2_7 Forward -98 -79 -3.93378 0.279
NP_442533.1_6 Forward -257 -248 1.47469 0.298
NP_441482.1_7 Forward -194 -180 -9.63684 0.208
NP_441028.1_6 Forward -362 -352 5.38779 0.255
NP_441527.1_7 Forward -38 -19 7.76679 0.289
NP_441972.1_5 Forward -319 -300 -6.39206 0.229
NP_441106.1_1 Forward -236 -227 5.01461 0.191
NP_439903.1_6 Reverse -61 -80 3.24359 0.211
NP_440886.1_7 Reverse -131 -141 5.28945 0.188
NP_442614.1_2 Forward -326 -312 6.6861 0.287
NP_440907.2_8 Reverse -227 -237 3.8145 0.297
NP_442794.1_1 Reverse -307 -319 5.34885 0.225
NP_442615.1_1 Forward -209 -191 -5.88071 0.227
NP_440387.1_1 Forward -141 -125 -4.36636 0.185
NP_441836.1_2 Reverse -305 -324 -2.75381 0.231
NP_441174.1_2 Forward -144 -130 16.6175 0.0675
NP_441174.1_4 Reverse -352 -362 16.9913 0.184
NP_440114.1_10 Reverse -317 -331 9.5377 0.169
NP_442437.1_3 Forward -348 -329 11.7 0.193
NP_440287.1_6 Forward -380 -361 12.8808 0.127
NP_442930.1_1 Reverse -16 -26 12.7626 0.239
NP_439910.1_2 Reverse -218 -235 -13.1375 0.14
NP_442582.1_3 Forward -86 -72 12.9985 0.284
NP_441253.1_1 Forward -312 -293 4.03102 0.296
NP_442514.1_5 Forward -110 -91 2.55527 0.167
NP_441885.1_5 Reverse -311 -321 0.668351 0.133
NP_443000.1_3 Forward -303 -284 13.6556 0.242
NP_443000.1_7 Reverse -309 -319 7.35486 0.0859
NP_443000.1_7 Forward -322 -312 3.71661 0.226
NP_440679.1_10 Forward -148 -129 -12.9802 0.215
NP_442451.1_2 Reverse -125 -144 -9.44032 0.259
NP_441105.1_3 Forward -331 -312 -9.44032 0.289
NP_440216.1_9 Forward -100 -91 10.3245 0.286
NP_440678.1_9 Forward -146 -127 19.469 0.0677
NP_440172.1_1 Reverse -311 -321 4.20827 0.2
NP_440172.1_1 Forward -371 -361 1.94665 0.29
NP_442015.1_10 Forward -324 -311 -0.570702 0.272
NP_440305.1_1 Reverse -16 -30 17.5821 0.133
NP_441757.1_3 Reverse -190 -209 -0.4922 0.225
NP_441766.1_8 Forward -143 -124 16.6593 0.278
NP_440416.1_9 Reverse -304 -323 -18.5851 0.26
NP_440416.1_9 Reverse -292 -311 -19.9617 0.281
NP_443052.1_9 Reverse -326 -345 -6.78538 0.289
NP_440072.1_5 Forward -150 -132 -2.3408 0.271
NP_440261.1_5 Forward -319 -306 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGCGTTGTCGGAAGCATCTGACATTATTGCCAATCTTTTTATCCCCCTTAAGGATCTCAATGAGCTGGAGGCGGCCCATAGCGATTACCAGGACGAGGTCAATCCGGAAAGTCAAATTCCCATCGAAGAGTTACAGCTTTCTGTCCGTGCCTATAACTGTCTGAAGCGAGCCCAGATTAATTCCGTGGCAGATCTACTGGAGTATAGCCAGGAAGATCTACTGGAAATCAAGAATTTTGGTCTCAAATCCGCAGAGGAGGTGATTGAGGCACTGCAAAAACGTTTGGGTATTACCCTGCCCCACGAAAAGGCTAAAGCTTAACAAGCTCAATGGGTTTGATTACTGCTGCTTGCCTTAGAGTAACCCCCTGTTGTTAATTTTTTAGGAGTTCAGTTACC

CDS

ATGCGACACAGATGTCGAGTGCCTCAGTTGGGGAAGCCCGCTGACCAAAGAAAGGCCCTGCTGAGGGCTTTAACTACGGAGTTAATCCGCCACGGACAAATCAAGACCACTAAGGCTAGAGCTAAAGCCGTGCGTTCTGAGGTAGACCGCATGATTACCCTAGCTAAGGATGGTTCCCTGGCCGCCCGTCGCCGGGCCCTAGGCTATATGTATGACAAACCCACAGTCCACGCTTTGTTTGCGGATGCTCCCAGCCGCTATAAAGACAGGGATGGGGGCTATACCCGCATTATTAGAACCCTACGTCGCCGGGGTGACAATGCGGAAATGGCTGTGATTGAATTGGTCTAG

Protein

MRHRCRVPQLGKPADQRKALLRALTTELIRHGQIKTTKARAKAVRSEVDRMITLAKDGSLAARRRALGYMYDKPTVHALFADAPSRYKDRDGGYTRIIRTLRRRGDNAEMAVIELV