Your browser is old and dusty. Try Google Chrome!

Details for sll1817

ORF sll1817
Accession NP_440646.1
Symbol rps11
Category Ribosomal proteins: synthesis and modification
Definition 30S ribosomal protein S11
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -154 -161 10.8555 0.132
NP_441418.1_6 Forward -180 -161 -20.7484 0.125
NP_441418.1_6 Forward -231 -212 -21.24 0.143
NP_441418.1_6 Reverse -222 -241 -21.4367 0.149
NP_441418.1_6 Forward -321 -302 -22.3217 0.175
NP_441418.1_6 Reverse -162 -181 -28.5165 0.205
NP_440897.1_6 Forward -231 -212 -0.29631 0.182
NP_440897.1_6 Forward -88 -69 -1.08295 0.187
NP_442151.1_6 Reverse -153 -167 10.521 0.122
NP_442151.1_6 Forward -162 -148 6.6861 0.224
NP_442151.1_6 Reverse -379 -393 5.01447 0.298
NP_441818.1_1 Forward -387 -376 9.89126 0.232
NP_441818.1_9 Reverse -112 -131 -7.67036 0.273
NP_442169.1_1 Reverse -29 -48 -1.08219 0.262
NP_442623.1_3 Reverse -94 -113 -8.752 0.127
NP_442744.1_8 Forward -211 -192 0.196116 0.235
NP_442655.1_1 Forward -132 -113 2.85105 0.238
NP_442752.1_4 Forward -231 -224 5.44732 0.202
NP_443027.1_4 Forward -233 -223 14.3364 0.0452
NP_442975.1_10 Reverse -218 -232 9.83206 0.0626
NP_440784.1_7 Forward -161 -154 9.67555 0.104
NP_440784.1_7 Reverse -342 -349 4.26735 0.272
NP_442909.1_2 Forward -168 -149 18.0924 0.113
NP_442000.2_10 Forward -335 -317 9.36059 0.249
NP_441054.1_2 Reverse -137 -156 9.83255 0.284
NP_441476.1_5 Reverse -148 -167 -6.78538 0.276
NP_439979.1_7 Forward -184 -167 14.2968 0.267
NP_442062.1_8 Forward -231 -221 6.27322 0.132
NP_442062.1_8 Reverse -379 -389 5.87989 0.149
NP_441859.1_3 Reverse -152 -171 7.57013 0.157
NP_440304.1_4 Reverse -377 -387 14.828 0.0466
NP_440304.1_4 Forward -233 -223 7.94484 0.094
NP_441781.1_7 Reverse -125 -144 -2.65548 0.289
NP_441781.1_7 Forward -168 -149 -3.44213 0.296
NP_441161.1_1 Forward -86 -67 16.9115 0.176
NP_440370.1_10 Forward -240 -221 12.3892 0.149
NP_440300.1_1 Forward -48 -29 6.68515 0.287
NP_441925.1_4 Forward -104 -85 -17.4058 0.294
NP_441772.1_10 Forward -207 -188 14.4541 0.0644
NP_441083.1_3 Forward -89 -79 13.1559 0.22
NP_441083.1_5 Forward -388 -378 6.76487 0.0775
NP_441083.1_5 Reverse -222 -232 6.17489 0.0894
NP_441083.1_5 Reverse -379 -389 1.16001 0.215
NP_441083.1_5 Forward -162 -152 -0.41329 0.267
NP_442827.1_8 Reverse -214 -233 -1.47628 0.247
NP_442115.2_7 Forward -98 -81 8.39697 0.204
NP_441738.1_2 Forward -386 -379 11.8385 0.0469
NP_441738.1_2 Reverse -224 -231 9.77352 0.143
NP_441713.1_1 Forward -105 -86 -15.9302 0.275
NP_442675.1_4 Reverse -154 -172 3.65739 0.217
NP_442570.1_3 Forward -154 -135 -0.0988766 0.208
NP_442570.1_3 Forward -96 -77 -9.24366 0.296
NP_441716.1_1 Reverse -202 -216 5.1128 0.24
NP_441716.1_1 Reverse -222 -236 3.73617 0.259
NP_442111.1_4 Forward -242 -228 7.07942 0.105
NP_441163.1_1 Reverse -214 -231 11.6411 0.183
NP_440906.1_9 Forward -86 -67 12.9783 0.296
NP_440747.1_1 Reverse -310 -328 6.90232 0.253
NP_440747.1_10 Reverse -150 -162 -4.48425 0.101
NP_440747.1_10 Forward -391 -379 -12.0557 0.199
NP_440747.1_10 Forward -165 -153 -12.2524 0.254
NP_441847.1_7 Reverse -145 -164 21.2389 0.113
NP_440944.1_2 Forward -400 -381 0.196116 0.256
NP_440403.1_4 Reverse -213 -232 -6.39206 0.231
NP_440403.1_4 Forward -330 -311 -8.65367 0.26
NP_440403.1_10 Reverse -96 -115 5.60432 0.242
NP_441695.1_10 Forward -102 -83 17.5015 0.262
NP_442848.1_1 Reverse -216 -230 4.32615 0.106
NP_442848.1_1 Forward -237 -223 -4.4253 0.291
NP_441012.1_4 Forward -172 -159 7.78743 0.272
NP_443018.1_3 Reverse -154 -161 4.07068 0.299
NP_440376.1_1 Forward -321 -312 13.1761 0.0174
NP_440376.1_1 Forward -231 -222 7.07956 0.0869
NP_440376.1_1 Reverse -379 -388 6.19458 0.109
NP_440376.1_1 Forward -388 -379 0.196389 0.283
NP_440376.1_1 Reverse -222 -231 0.0980582 0.285
NP_442687.1_7 Forward -100 -90 4.3066 0.255
NP_442687.1_7 Forward -163 -153 3.61828 0.299
NP_442191.1_4 Reverse -223 -237 14.1927 0.112
NP_442485.1_3 Forward -332 -313 -4.13045 0.278
NP_442485.1_3 Forward -393 -374 -5.80207 0.296
NP_442485.1_3 Reverse -308 -327 -5.99873 0.297
NP_441846.1_10 Reverse -28 -47 -12.5869 0.191
NP_441846.1_10 Reverse -23 -42 -14.8485 0.24
NP_441682.1_2 Reverse -138 -157 7.07928 0.227
NP_440533.1_9 Forward -241 -222 4.81767 0.216
NP_440141.1_8 Reverse -147 -166 5.80098 0.271
NP_440656.1_2 Forward -58 -39 1.47442 0.258
NP_441414.1_9 Reverse -379 -398 -7.76869 0.225
NP_441487.1_6 Forward -396 -377 0.786102 0.254
NP_442300.1_5 Reverse -151 -170 11.1109 0.282
NP_442937.1_5 Forward -173 -154 17.5024 0.0323
NP_442937.1_5 Reverse -148 -167 13.0775 0.095
NP_441958.1_5 Forward -232 -222 1.65166 0.0872
NP_441958.1_5 Reverse -378 -388 0.865012 0.12
NP_440610.1_3 Reverse -93 -112 14.1591 0.202
NP_440203.1_5 Forward -159 -149 16.2041 0.0611
NP_440203.1_5 Forward -198 -188 12.7626 0.138
NP_440203.1_5 Reverse -225 -235 11.8776 0.171
NP_440203.1_5 Forward -385 -375 11.6809 0.182
NP_442025.1_7 Reverse -222 -240 16.7538 0.248
NP_440984.1_7 Forward -47 -33 4.91614 0.281
NP_439990.1_5 Reverse -336 -349 10.049 0.128
NP_442690.1_1 Forward -284 -265 -17.2085 0.298
NP_442911.1_2 Forward -398 -379 1.17943 0.061
NP_442911.1_2 Reverse -369 -388 -1.57384 0.0871
NP_443055.1_3 Reverse -213 -232 13.7008 0.16
NP_443055.1_6 Reverse -178 -196 11.7197 0.114
NP_443055.1_6 Forward -95 -77 5.42659 0.179
NP_440993.1_5 Reverse -211 -229 19.4878 0.101
NP_440827.1_3 Reverse -94 -113 15.8307 0.167
NP_442210.1_7 Forward -173 -154 14.7491 0.208
NP_441429.1_6 Reverse -77 -96 3.83436 0.281
NP_439975.1_2 Reverse -30 -48 5.62401 0.266
NP_441099.1_5 Forward -172 -153 -7.08038 0.17
NP_442002.1_9 Reverse -378 -385 13.0188 0.185
NP_440809.1_9 Forward -240 -222 -5.38906 0.225
NP_441646.1_7 Reverse -126 -140 13.2743 0.292
NP_441646.1_7 Forward -173 -159 12.9793 0.299
NP_442438.1_10 Reverse -217 -231 7.07942 0.101
NP_442438.1_10 Forward -393 -379 1.96621 0.188
NP_440147.1_4 Reverse -377 -390 0.510939 0.252
NP_441550.1_8 Forward -164 -154 7.45273 0.159
NP_441916.1_7 Reverse -90 -100 3.91327 0.198
NP_440206.1_4 Reverse -314 -333 2.06362 0.289
NP_441041.1_4 Reverse -313 -332 -9.34199 0.215
NP_441041.1_4 Forward -231 -212 -12.6852 0.272
NP_441041.1_7 Reverse -90 -102 5.6684 0.245
NP_442004.1_6 Forward -388 -374 2.35953 0.266
NP_441725.1_5 Forward -387 -377 1.74999 0.125
NP_439966.1_7 Forward -44 -34 11.4843 0.0632
NP_439966.1_7 Forward -352 -342 9.51767 0.109
NP_439966.1_7 Reverse -220 -230 6.17443 0.191
NP_442941.1_3 Reverse -223 -233 0.963343 0.16
NP_442941.1_3 Forward -230 -220 -0.314959 0.256
NP_440289.1_2 Forward -324 -311 1.78924 0.115
NP_440983.1_5 Reverse -153 -172 -9.24366 0.3
NP_440260.1_8 Reverse -60 -78 -6.07737 0.285
NP_442281.1_1 Forward -125 -111 3.93223 0.213
NP_441334.1_7 Reverse -88 -107 -20.945 0.284
NP_440437.1_1 Forward -177 -158 0.491109 0.17
NP_440437.1_1 Forward -97 -78 -2.0655 0.21
NP_440437.1_1 Forward -327 -308 -5.9004 0.296
NP_441457.1_7 Reverse -310 -329 -0.295539 0.288
NP_440723.1_4 Forward -165 -146 -11.0136 0.284
NP_441556.1_4 Reverse -96 -115 10.4871 0.279
NP_442982.1_5 Forward -241 -222 -1.08219 0.263
NP_441644.1_6 Reverse -153 -163 8.73102 0.0944
NP_441644.1_6 Reverse -319 -329 8.04271 0.11
NP_441644.1_6 Reverse -379 -389 3.8145 0.261
NP_441644.1_6 Forward -162 -152 3.12618 0.297
NP_443049.1_6 Reverse -152 -162 13.3976 0.182
NP_442215.1_2 Forward -164 -148 2.02515 0.123
NP_442215.1_2 Reverse -129 -145 -6.62797 0.277
NP_441751.2_8 Reverse -127 -141 -5.70361 0.231
NP_442554.1_8 Forward -186 -176 11.9764 0.0312
NP_442554.1_8 Forward -161 -151 4.69992 0.176
NP_442554.1_8 Reverse -223 -233 4.50326 0.184
NP_442554.1_8 Forward -387 -377 3.02829 0.245
NP_441762.1_7 Reverse -302 -314 -5.66422 0.228
NP_442142.1_4 Forward -165 -152 6.11523 0.173
NP_442142.1_4 Reverse -150 -163 3.65697 0.248
NP_442292.1_1 Forward -161 -152 6.09625 0.116
NP_442292.1_1 Reverse -223 -232 5.60459 0.14
NP_442292.1_1 Forward -186 -177 3.7363 0.192
NP_442292.1_5 Reverse -308 -327 9.0459 0.138
NP_443009.1_5 Forward -232 -221 8.4163 0.109
NP_443009.1_5 Forward -389 -378 5.56471 0.197
NP_441715.1_4 Forward -230 -220 4.60159 0.261
NP_441715.1_4 Reverse -223 -233 4.40493 0.281
NP_440379.1_5 Reverse -75 -94 5.60432 0.133
NP_440464.1_10 Forward -161 -151 14.6315 0.169
NP_441468.1_1 Reverse -154 -161 4.07068 0.263
NP_441618.1_9 Reverse -78 -97 18.1216 0.196
NP_441015.1_10 Forward -167 -148 1.76941 0.158
NP_441015.1_10 Forward -173 -154 -10.522 0.284
NP_441673.1_1 Forward -388 -379 1.37636 0.114
NP_441673.1_1 Forward -231 -222 1.27803 0.155
NP_441673.1_1 Reverse -222 -231 1.27803 0.155
NP_441673.1_1 Reverse -379 -388 1.1797 0.163
NP_441876.1_9 Forward -46 -36 15.8108 0.267
NP_441876.1_9 Forward -317 -307 13.4509 0.267
NP_441826.1_2 Forward -168 -154 2.85119 0.119
NP_441826.1_2 Reverse -273 -287 0.392915 0.187
NP_441826.1_2 Reverse -216 -230 -2.65535 0.273
NP_441826.1_2 Forward -394 -380 -2.85201 0.277
NP_442868.1_6 Forward -352 -342 4.69992 0.169
NP_442868.1_6 Forward -390 -380 4.50326 0.174
NP_441612.1_2 Forward -211 -201 9.90466 0.21
NP_442427.1_3 Reverse -217 -235 1.00246 0.232
NP_442808.1_1 Reverse -221 -231 6.37109 0.116
NP_442808.1_1 Forward -322 -312 4.7978 0.19
NP_442808.1_1 Forward -43 -33 4.50281 0.197
NP_441315.1_2 Reverse -152 -170 15.7609 0.222
NP_440145.1_3 Forward -251 -232 -1.47551 0.152
NP_442050.1_5 Forward -390 -380 10.5993 0.141
NP_442342.1_9 Forward -137 -121 8.41667 0.194
NP_440601.1_7 Reverse -92 -106 14.5526 0.278
NP_441114.1_3 Forward -119 -110 7.66954 0.231
NP_440274.1_1 Reverse -25 -44 17.109 0.251
NP_441878.1_6 Reverse -378 -388 2.14332 0.0501
NP_441878.1_6 Reverse -125 -135 -7.39479 0.222
NP_441036.1_8 Reverse -221 -231 6.46988 0.229
NP_441557.1_5 Forward -388 -379 0.491382 0.144
NP_441557.1_5 Forward -231 -222 0.393051 0.166
NP_441557.1_5 Reverse -222 -231 0.393051 0.166
NP_441557.1_5 Reverse -379 -388 0.29472 0.174
NP_441557.1_8 Reverse -313 -323 11.4843 0.246
NP_441433.1_8 Reverse -319 -338 3.83436 0.197
NP_441308.1_8 Reverse -220 -230 14.3364 0.218
NP_441308.1_8 Forward -233 -223 9.41981 0.226
NP_442183.1_1 Forward -231 -217 7.47274 0.141
NP_442183.1_1 Forward -388 -374 5.1128 0.231
NP_442183.1_1 Reverse -222 -236 4.62115 0.254
NP_442166.1_7 Forward -98 -84 11.5043 0.19
NP_440440.1_2 Forward -110 -91 14.8466 0.256
NP_440979.1_3 Forward -170 -152 11.1305 0.235
NP_442444.1_6 Reverse -82 -100 12.2435 0.285
NP_441549.1_9 Reverse -375 -393 -9.32229 0.245
NP_442347.1_2 Forward -161 -152 4.91628 0.249
NP_442645.1_2 Forward -170 -151 -17.0118 0.246
NP_442645.1_2 Forward -233 -214 -20.2567 0.288
NP_442645.1_2 Forward -390 -371 -20.65 0.288
NP_442645.1_2 Reverse -271 -290 -22.0267 0.29
NP_441037.1_4 Reverse -310 -320 11.4109 0.148
NP_442594.1_8 Reverse -32 -51 2.3594 0.295
NP_441633.1_3 Forward -323 -310 -3.81562 0.177
NP_441633.1_3 Forward -390 -377 -6.96221 0.283
NP_440136.1_2 Reverse -342 -349 4.26735 0.218
NP_440899.1_1 Forward -167 -148 7.7243 0.254
NP_440299.1_6 Reverse -142 -161 5.211 0.292
NP_441007.1_10 Forward -104 -91 0.904263 0.212
NP_441007.1_10 Forward -167 -154 -0.570702 0.287
NP_440256.1_1 Forward -234 -215 -0.983855 0.0988
NP_440087.1_1 Reverse -153 -172 -5.9004 0.249
NP_441559.1_8 Forward -236 -222 2.85119 0.143
NP_441559.1_8 Reverse -217 -231 -3.93365 0.213
NP_441559.1_8 Forward -326 -312 -4.91696 0.241
NP_441559.1_8 Forward -157 -143 -5.40861 0.261
NP_440915.1_6 Forward -325 -311 -0.393733 0.193
NP_440915.1_6 Forward -392 -378 -1.18038 0.224
NP_442158.1_4 Reverse -334 -344 10.7964 0.283
NP_440717.1_1 Forward -101 -82 5.40766 0.272
NP_440717.1_3 Forward -47 -33 7.76712 0.28
NP_442452.1_3 Forward -84 -65 6.39097 0.218
NP_442866.1_1 Forward -333 -314 -4.32711 0.226
NP_442866.1_1 Forward -167 -148 -6.09707 0.249
NP_441464.1_1 Reverse -208 -227 7.47261 0.261
NP_441494.1_6 Reverse -374 -387 9.85238 0.227
NP_441494.1_6 Forward -104 -91 8.37742 0.23
NP_442993.1_1 Reverse -303 -319 -9.67623 0.19
NP_442993.1_1 Forward -328 -312 -10.5612 0.222
NP_442386.1_9 Forward -43 -34 9.63573 0.154
NP_442386.1_9 Forward -163 -154 4.91586 0.276
NP_440168.1_9 Reverse -110 -129 -5.60541 0.296
NP_440168.1_9 Forward -323 -304 -5.99873 0.296
NP_441776.1_5 Reverse -149 -168 9.93088 0.291
NP_442240.1_1 Forward -116 -97 6.39016 0.256
NP_440586.1_8 Reverse -154 -161 7.41359 0.251
NP_440586.1_8 Forward -210 -203 7.02027 0.279
NP_441262.1_2 Reverse -273 -287 18.6325 0.23
NP_440027.1_3 Reverse -86 -104 7.49153 0.21
NP_443051.1_1 Forward -232 -223 -0.000272808 0.245
NP_439984.1_3 Forward -142 -128 13.2736 0.225
NP_440439.1_1 Forward -234 -221 9.65572 0.0447
NP_440439.1_1 Reverse -219 -232 -0.472371 0.221
NP_442239.1_8 Forward -105 -86 4.62101 0.296
NP_441803.1_2 Forward -107 -88 10.0292 0.091
NP_441803.1_2 Forward -186 -167 5.40766 0.17
NP_441803.1_2 Reverse -304 -323 4.22769 0.18
NP_441803.1_2 Forward -327 -308 1.86774 0.223
NP_439977.1_5 Forward -141 -122 -1.27885 0.245
NP_439977.1_5 Reverse -335 -354 -2.36049 0.277
NP_442384.1_10 Reverse -222 -235 6.01747 0.113
NP_442035.1_8 Forward -165 -151 13.8643 0.237
NP_442114.1_4 Forward -102 -91 8.61347 0.197
NP_441877.1_7 Reverse -148 -167 1.27698 0.242
NP_442262.1_10 Forward -240 -233 9.38056 0.202
NP_441689.1_5 Forward -233 -223 5.97777 0.197
NP_440163.1_10 Reverse -108 -118 11.1898 0.171
NP_440344.1_10 Reverse -336 -353 -10.5809 0.185
NP_440344.1_10 Reverse -215 -232 -10.8759 0.194
NP_442123.1_10 Reverse -69 -88 6.98095 0.288
NP_442750.1_3 Reverse -41 -60 -5.9004 0.236
NP_442750.1_3 Reverse -38 -57 -12.9802 0.295
NP_440297.1_9 Forward -134 -124 6.76487 0.17
NP_440297.1_9 Forward -387 -377 0.865012 0.282
NP_440999.1_9 Forward -166 -152 8.84938 0.0709
NP_440999.1_9 Reverse -318 -332 -0.688726 0.214
NP_440888.1_2 Reverse -379 -393 16.2235 0.00758
NP_440888.1_2 Forward -231 -217 11.307 0.0705
NP_440888.1_2 Reverse -222 -236 11.307 0.0705
NP_440888.1_2 Forward -42 -28 5.60385 0.272
NP_440803.1_3 Reverse -309 -328 3.93269 0.286
NP_439969.1_1 Forward -116 -97 -6.68705 0.288
NP_442033.1_10 Reverse -220 -239 -6.88371 0.186
NP_442033.1_10 Reverse -91 -110 -12.3902 0.269
NP_441543.1_2 Forward -161 -152 4.81794 0.219
NP_442845.1_2 Forward -168 -154 7.17775 0.198
NP_442845.1_2 Forward -356 -342 7.07942 0.199
NP_441918.1_7 Reverse -158 -177 -1.86883 0.297
NP_441469.1_8 Reverse -221 -230 14.0611 0.0612
NP_442337.1_8 Reverse -68 -87 -0.39387 0.273
NP_440710.1_1 Reverse -82 -100 -6.1757 0.222
NP_441462.1_2 Reverse -222 -232 0.668351 0.135
NP_441462.1_2 Forward -388 -378 0.668351 0.135
NP_441621.1_7 Reverse -91 -105 -2.65535 0.188
NP_443062.1_1 Forward -162 -144 6.59578 0.195
NP_441601.1_2 Reverse -172 -191 -4.03212 0.28
NP_440349.1_3 Reverse -154 -173 9.7334 0.299
NP_442204.1_1 Reverse -149 -160 -0.0396598 0.285
NP_442487.1_5 Reverse -221 -240 8.16011 0.198
NP_440516.1_8 Reverse -153 -162 -0.491928 0.262
NP_440516.1_8 Reverse -303 -312 -0.590259 0.283
NP_442428.1_4 Reverse -221 -240 4.12936 0.238
NP_442428.1_5 Reverse -154 -161 4.56234 0.249
NP_440783.1_5 Forward -327 -308 -4.72043 0.276
NP_441443.1_10 Forward -92 -74 5.52492 0.251
NP_442120.1_10 Reverse -153 -172 -8.16202 0.23
NP_442120.1_10 Forward -186 -167 -10.4236 0.258
NP_440673.1_3 Forward -160 -153 9.38056 0.192
NP_440673.1_3 Reverse -3 -10 9.08556 0.202
NP_440673.1_3 Forward -86 -79 6.23397 0.283
NP_441714.1_3 Forward -169 -151 14.9646 0.169
NP_440718.1_1 Forward -125 -106 15.3382 0.263
NP_441052.1_2 Forward -162 -152 15.2213 0.0136
NP_441052.1_2 Forward -211 -201 7.35486 0.0742
NP_441052.1_2 Reverse -153 -163 4.0116 0.168
NP_441052.1_2 Reverse -379 -389 0.963343 0.255
NP_442219.1_9 Forward -161 -152 4.71961 0.198
NP_440436.1_4 Forward -161 -152 4.42421 0.265
NP_440436.1_4 Reverse -380 -389 4.32588 0.272
NP_441884.1_9 Reverse -90 -109 -18.7818 0.141
NP_441884.1_9 Reverse -307 -326 -21.535 0.25
NP_442907.1_9 Forward -104 -85 0.196116 0.211
NP_441719.1_4 Forward -240 -233 3.77569 0.285
NP_441004.1_1 Forward -168 -149 -13.8652 0.262
NP_442873.1_3 Reverse -212 -231 5.80018 0.248
NP_440328.1_4 Forward -327 -308 8.16093 0.114
NP_443054.1_2 Reverse -169 -183 6.98109 0.175
NP_441851.1_10 Reverse -378 -388 6.37155 0.172
NP_441851.1_10 Reverse -221 -231 4.89658 0.24
NP_442622.1_5 Forward -95 -76 3.04771 0.166
NP_442856.1_7 Forward -171 -152 -4.81876 0.268
NP_441668.1_4 Reverse -143 -162 18.3873 0.0435
NP_442515.1_1 Forward -389 -375 8.06273 0.0833
NP_442515.1_1 Reverse -378 -392 -4.62196 0.298
NP_440593.1_3 Forward -113 -94 -5.80207 0.266
NP_440593.1_9 Forward -105 -91 8.16106 0.261
NP_440933.1_1 Forward -228 -209 11.8975 0.289
NP_441596.1_5 Forward -299 -280 17.6007 0.221
NP_440588.1_2 Reverse -294 -313 -5.60541 0.256
NP_440943.1_5 Forward -26 -12 12.9793 0.244
NP_441003.1_9 Reverse -144 -163 7.47261 0.232
NP_441570.1_1 Forward -231 -213 3.26407 0.0221
NP_441078.1_4 Reverse -222 -231 7.37455 0.0688
NP_441078.1_4 Reverse -312 -321 6.09625 0.0863
NP_441078.1_4 Reverse -379 -388 0.688044 0.164
NP_441078.1_4 Forward -388 -379 0.688044 0.164
NP_441078.1_4 Forward -231 -222 0.29472 0.205
NP_441078.1_4 Reverse -153 -162 -1.86856 0.272
NP_442729.1_8 Forward -354 -341 6.21414 0.207
NP_441663.1_8 Forward -327 -308 2.16274 0.206
NP_442348.1_2 Reverse -111 -120 14.356 0.159
NP_442348.1_2 Reverse -63 -72 12.2911 0.218
NP_442348.1_2 Forward -364 -355 10.3245 0.27
NP_441432.1_8 Reverse -152 -161 11.0128 0.0629
NP_441432.1_8 Forward -389 -380 8.06287 0.0877
NP_442320.1_8 Reverse -87 -101 -4.81863 0.188
NP_441732.1_2 Forward -235 -219 -6.82463 0.0533
NP_441732.1_2 Reverse -218 -234 -8.0046 0.105
NP_441732.1_2 Reverse -149 -165 -16.4611 0.167
NP_441732.1_2 Reverse -375 -391 -16.6577 0.186
NP_442815.1_2 Reverse -154 -172 3.65739 0.259
NP_440760.1_1 Forward -388 -369 -22.2233 0.252
NP_440913.1_1 Reverse -88 -106 4.6407 0.26
NP_440713.1_4 Reverse -149 -168 5.99764 0.198
NP_440713.1_4 Forward -241 -222 4.12936 0.231
NP_442489.1_7 Reverse -379 -388 7.76787 0.0518
NP_442489.1_7 Forward -388 -379 0.688044 0.152
NP_442489.1_7 Forward -231 -222 0.589713 0.17
NP_442489.1_7 Reverse -222 -231 0.589713 0.17
NP_442489.1_7 Reverse -153 -162 -1.57357 0.213
NP_440559.1_1 Forward -387 -378 4.32629 0.288
NP_441659.2_8 Reverse -222 -232 1.35667 0.242
NP_441659.2_8 Forward -388 -378 0.176696 0.271
NP_441040.1_2 Forward -116 -97 -16.1268 0.294
NP_441968.1_1 Forward -76 -68 15.162 0.257
NP_441800.1_3 Forward -167 -149 6.01734 0.286
NP_442346.1_5 Forward -163 -153 7.25653 0.176
NP_442346.1_5 Forward -11 -1 6.17489 0.212
NP_442346.1_5 Forward -389 -379 4.3066 0.291
NP_440545.1_3 Reverse -127 -144 -3.00942 0.197
NP_440545.1_3 Forward -392 -375 -4.09106 0.218
NP_440545.1_3 Forward -139 -122 -4.18939 0.22
NP_440545.1_3 Forward -235 -218 -4.58271 0.229
NP_440250.1_4 Forward -31 -12 6.09517 0.253
NP_440010.1_3 Forward -113 -94 -7.4737 0.278
NP_440010.1_3 Forward -119 -100 -7.57203 0.278
NP_440010.1_4 Forward -172 -153 3.44025 0.22
NP_440010.1_4 Reverse -149 -168 1.76863 0.227
NP_440010.1_4 Forward -112 -93 -3.14789 0.294
NP_442551.1_4 Forward -390 -375 -0.413427 0.245
NP_442603.1_7 Reverse -93 -107 7.07881 0.216
NP_441948.1_4 Reverse -121 -139 -2.73412 0.175
NP_442498.1_5 Forward -107 -88 16.6174 0.284
NP_442073.1_6 Forward -171 -152 -2.26216 0.286
NP_442140.1_3 Reverse -154 -164 4.60159 0.242
NP_441813.1_5 Reverse -230 -240 -0.806614 0.285
NP_440590.1_4 Reverse -342 -355 1.00259 0.136
NP_440590.1_4 Forward -230 -217 -4.79893 0.267
NP_440590.1_4 Forward -186 -173 -5.97891 0.296
NP_442497.1_10 Forward -387 -378 0.393051 0.175
NP_440821.1_4 Reverse -377 -387 0.176696 0.198
NP_440821.1_4 Reverse -220 -230 -0.314959 0.251
NP_441239.1_9 Forward -314 -302 6.72548 0.178
NP_441239.1_9 Forward -390 -378 4.66053 0.248
NP_441951.1_4 Forward -114 -95 9.73422 0.229
NP_441951.1_9 Forward -329 -310 5.01433 0.254
NP_441951.1_9 Reverse -302 -321 -1.47551 0.295
NP_441892.1_1 Forward -108 -91 -1.82945 0.214
NP_442193.1_1 Reverse -111 -129 7.78729 0.28
NP_442193.1_8 Reverse -376 -395 10.4217 0.286
NP_442270.1_9 Reverse -148 -167 -9.14533 0.228
NP_440546.1_4 Reverse -33 -43 10.9186 0.101
NP_440546.1_4 Reverse -178 -188 7.71902 0.224
NP_440462.1_6 Forward -233 -223 5.28991 0.161
NP_442340.1_3 Forward -86 -67 -8.16202 0.244
NP_442499.1_3 Forward -322 -304 3.65739 0.289
NP_440270.1_4 Reverse -80 -99 18.4857 0.0851
NP_442402.1_4 Forward -158 -139 -5.1145 0.236
NP_442402.1_9 Forward -367 -348 9.24257 0.277
NP_440696.1_3 Forward -231 -213 0.805796 0.225
NP_442039.1_4 Forward -349 -342 9.47889 0.145
NP_442039.1_4 Reverse -223 -230 7.80726 0.24
NP_441811.1_8 Reverse -373 -387 8.25939 0.238
NP_442837.1_3 Forward -349 -342 9.38056 0.132
NP_442053.1_1 Forward -231 -222 11.4061 0.0409
NP_442053.1_1 Reverse -379 -388 4.91628 0.218
NP_442053.1_1 Reverse -341 -350 3.63797 0.298
NP_440505.1_3 Forward -390 -380 5.87989 0.206
NP_440505.1_3 Forward -233 -223 4.60159 0.277
NP_440914.1_1 Reverse -153 -163 13.2995 0.0325
NP_440914.1_1 Reverse -222 -232 6.07773 0.297
NP_441011.1_8 Reverse -313 -322 7.07956 0.179
NP_442533.1_6 Reverse -222 -231 6.78456 0.103
NP_442533.1_6 Reverse -153 -162 4.32629 0.184
NP_442533.1_6 Forward -211 -202 4.22796 0.186
NP_442533.1_6 Forward -99 -90 3.44131 0.212
NP_442533.1_6 Reverse -178 -187 2.26134 0.266
NP_442533.1_6 Forward -114 -105 2.06468 0.275
NP_442533.1_6 Forward -42 -33 1.96635 0.28
NP_442541.1_10 Forward -115 -101 1.27731 0.287
NP_442322.1_4 Forward -45 -28 -2.71511 0.235
NP_442322.1_4 Forward -46 -29 -9.69657 0.296
NP_442229.1_1 Forward -314 -300 5.60385 0.26
NP_441482.1_7 Reverse -373 -387 -9.83351 0.209
NP_441482.1_7 Reverse -147 -161 -10.9151 0.222
NP_441482.1_7 Forward -237 -223 -11.2101 0.245
NP_441482.1_7 Reverse -216 -230 -11.2101 0.245
NP_439944.1_9 Reverse -127 -137 8.73149 0.102
NP_439944.1_9 Reverse -380 -390 5.68323 0.231
NP_441028.1_6 Forward -47 -37 15.5158 0.137
NP_440116.1_8 Reverse -94 -113 -0.885524 0.114
NP_441527.1_4 Reverse -12 -31 -9.97933 0.263
NP_440007.1_9 Reverse -149 -163 1.08123 0.29
NP_441972.1_5 Reverse -311 -330 -9.047 0.278
NP_441972.1_5 Reverse -160 -179 -10.0303 0.296
NP_441106.1_1 Reverse -161 -170 2.35967 0.287
NP_441106.1_1 Reverse -89 -98 2.26134 0.293
NP_441815.1_6 Reverse -68 -87 0.392004 0.284
NP_440646.1_1 Forward -87 -68 31.957 0.000135
NP_440646.1_2 Forward -123 -104 31.4654 0.000179
NP_440646.1_3 Forward -237 -218 29.5971 0.000635
NP_440646.1_4 Forward -174 -155 32.0554 0.0000818
NP_440646.1_5 Forward -144 -125 30.0887 0.000641
NP_440646.1_6 Forward -321 -302 26.4505 0.0034
NP_440646.1_7 Forward -213 -194 29.3021 0.000576
NP_440646.1_8 Forward -375 -356 27.9255 0.00221
NP_440646.1_9 Forward -297 -278 26.2538 0.00274
NP_439903.1_6 Forward -165 -146 1.08032 0.255
NP_441286.1_1 Forward -389 -377 4.46387 0.0326
NP_441286.1_1 Reverse -152 -164 1.21895 0.091
NP_442674.1_3 Forward -170 -151 6.1935 0.246
NP_440670.1_8 Reverse -379 -388 11.8978 0.03
NP_440670.1_8 Forward -231 -222 5.40793 0.158
NP_440886.1_7 Reverse -161 -171 5.68278 0.168
NP_440886.1_7 Reverse -221 -231 5.38779 0.185
NP_440886.1_7 Forward -313 -303 4.89613 0.213
NP_440886.1_7 Forward -43 -33 4.20782 0.249
NP_440886.1_7 Reverse -92 -102 3.42118 0.282
NP_442614.1_2 Reverse -153 -167 11.6026 0.189
NP_440460.1_10 Reverse -152 -171 15.2408 0.269
NP_442072.1_9 Reverse -378 -396 -1.35749 0.0316
NP_442072.1_9 Reverse -311 -329 -13.9439 0.126
NP_442773.2_4 Forward -105 -91 17.3058 0.149
NP_441753.1_10 Reverse -24 -43 11.7992 0.121
NP_441021.1_1 Reverse -380 -399 -11.7019 0.272
NP_440176.1_3 Forward -43 -29 14.7486 0.243
NP_441463.1_3 Forward -172 -153 -4.32711 0.201
NP_442794.1_1 Reverse -149 -161 9.67541 0.0795
NP_442615.1_1 Forward -397 -379 -7.35568 0.287
NP_441962.1_4 Reverse -154 -173 -3.73712 0.151
NP_441962.1_4 Forward -167 -148 -7.37537 0.188
NP_441962.1_5 Reverse -181 -200 5.60432 0.29
NP_440387.1_1 Reverse -379 -395 -2.98973 0.153
NP_440387.1_1 Reverse -222 -238 -4.56302 0.19
NP_440387.1_1 Forward -231 -215 -5.25134 0.222
NP_441431.1_2 Forward -315 -301 9.43874 0.186
NP_441431.1_2 Reverse -96 -110 6.98048 0.255
NP_441836.1_2 Reverse -84 -103 5.40766 0.124
NP_441836.1_2 Forward -168 -149 -4.6221 0.261
NP_441993.1_1 Reverse -153 -172 1.26449 0.282
NP_442352.1_1 Forward -318 -305 14.4877 0.251
NP_440114.1_5 Reverse -80 -99 7.27595 0.291
NP_440114.1_10 Forward -388 -374 6.09611 0.285
NP_440114.1_10 Reverse -111 -125 6.09611 0.285
NP_441720.1_2 Forward -235 -216 3.73524 0.236
NP_441272.1_4 Forward -117 -98 1.37609 0.241
NP_440293.1_3 Forward -95 -76 -3.83545 0.254
NP_441979.1_5 Forward -177 -158 -0.39387 0.147
NP_442867.1_8 Forward -113 -94 11.5042 0.198
NP_440457.1_1 Reverse -29 -41 -0.944332 0.285
NP_441436.1_2 Reverse -26 -45 6.88262 0.19
NP_442509.1_9 Forward -388 -378 11.4843 0.128
NP_441253.1_1 Forward -97 -78 5.70265 0.257
NP_440524.1_2 Forward -86 -67 -0.197208 0.27
NP_440554.1_4 Forward -240 -230 4.79825 0.175
NP_440554.1_4 Reverse -223 -233 3.02829 0.244
NP_441885.1_5 Reverse -379 -389 1.55333 0.109
NP_441885.1_5 Reverse -222 -232 -0.609952 0.215
NP_441885.1_5 Reverse -312 -322 -1.49493 0.264
NP_441428.1_8 Forward -107 -88 2.0644 0.287
NP_442341.1_5 Reverse -308 -327 12.2908 0.249
NP_442341.1_7 Forward -232 -218 7.47274 0.105
NP_442341.1_7 Forward -389 -375 1.76955 0.281
NP_442341.1_7 Reverse -309 -323 1.37622 0.292
NP_441173.1_9 Forward -46 -38 10.1471 0.261
NP_440423.1_6 Reverse -78 -97 -13.8652 0.224
NP_440679.1_5 Forward -159 -140 7.07928 0.292
NP_441359.1_5 Forward -94 -75 0.491109 0.29
NP_442451.1_2 Forward -329 -310 -9.047 0.258
NP_442451.1_2 Reverse -214 -233 -9.83364 0.26
NP_439962.1_4 Reverse -91 -110 2.85105 0.196
NP_439962.1_4 Forward -116 -97 -7.17871 0.288
NP_440149.1_8 Forward -388 -369 8.45592 0.0599
NP_440149.1_8 Forward -231 -212 -7.08038 0.272
NP_440216.1_1 Forward -95 -81 -5.40861 0.129
NP_440216.1_1 Reverse -312 -326 -11.0135 0.159
NP_440216.1_1 Reverse -379 -393 -11.4068 0.184
NP_440172.1_1 Reverse -178 -188 10.9931 0.0445
NP_440172.1_1 Reverse -153 -163 10.4031 0.0511
NP_440172.1_1 Reverse -379 -389 10.1081 0.0551
NP_440172.1_1 Forward -388 -378 3.32329 0.232
NP_440167.1_3 Reverse -96 -115 11.5042 0.223
NP_442015.1_10 Reverse -149 -162 4.73917 0.162
NP_442015.1_10 Reverse -218 -231 0.707601 0.221
NP_442015.1_10 Forward -235 -222 -0.275709 0.259
NP_441226.1_7 Forward -41 -34 8.29857 0.205
NP_441226.1_7 Forward -107 -100 6.82361 0.246
NP_440198.1_10 Reverse -110 -129 8.35759 0.296
NP_442379.1_10 Forward -395 -378 2.69378 0.211
NP_441766.1_2 Forward -231 -222 3.93297 0.2
NP_441766.1_2 Reverse -379 -388 3.83464 0.202
NP_441766.1_2 Forward -312 -303 1.1797 0.299
NP_440416.1_9 Forward -95 -76 -12.3902 0.157
NP_443052.1_9 Forward -106 -87 2.3594 0.172
NP_440261.1_5 Reverse -91 -104 -2.43899 0.0924
NP_440261.1_5 Reverse -127 -140 -4.79893 0.17
NP_440261.1_5 Forward -320 -307 -10.5021 0.201
NP_440261.1_5 Forward -387 -374 -12.3704 0.284
NP_440988.1_10 Forward -164 -150 15.9355 0.112
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGATAAGCGTGTGGAAATCGCCCTCACTTATCTGTACGGTATTGGTCTGTCGCGCTCCCATGAAATTCTGGACGCCACCGGGGTTAGCCCCGATGTCCGAGTCAAAGATCTCAGTGATGAAGATGCGCTGAAATTAAGAACCTACATCGATGAAAACTACGAGATCGAAGGGGATCTCCGTCGTTGGGAGGCCATGAACATTAAACGCCTTGGAGACATCGGCACCTACCGTGGTCGTCGTCATCGCCAAGGTTTACCAGTGCGGGGACAACGCACTAGAACCAATGCCCGTACCCGTCGGGGCCGCCGCTTGACCGTTGCCGGCAAGAAAAAGACCCCTGCGAAGAAATAATCTTCCCCCCATCCCTGTCCTGTTTATTGAAGCTTTCAAGCAATCATT

CDS

ATGGCGCGTCCTACCAGAAAAACTGGGCCCAAAAAGGCAAAAAAGAATGTCCCTAGCGGGGTGGCCCACATTCAATCTACTTTTAACAACACCATTGTCACCATTTCCGACATTCGGGGCGATGTGATTTCCTGGGCTTCCGCTGGTTCTAGCGGTTTCAAAGGAGCTAAAAAGGGCACTCCCTACGCCGCCCAAACCGCTGCTGATTCTGCGGCCCGTCGGGCCATGGAACAGGGTATGCGGCAATTAGAGGTAATGGTAAGTGGCCCCGGTGCCGGTCGGGAAACTGCTATCCGGGCCCTCCAAGGGGCTGGTTTGGAAATCACCCTGATCAGGGATGTTACCCCCATCCCCCACAATGGTTGTCGTCCCCCCAAACGCCGTCGGGTCTAG

Protein

MARPTRKTGPKKAKKNVPSGVAHIQSTFNNTIVTISDIRGDVISWASAGSSGFKGAKKGTPYAAQTAADSAARRAMEQGMRQLEVMVSGPGAGRETAIRALQGAGLEITLIRDVTPIPHNGCRPPKRRRV