Your browser is old and dusty. Try Google Chrome!

Details for sll1813

ORF sll1813
Accession NP_440652.1
Symbol rpl15
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L15
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -234 -248 -2.26202 0.287
NP_441418.1_6 Forward -251 -232 -30.1882 0.262
NP_441453.1_4 Forward -380 -372 5.42762 0.135
NP_441623.1_1 Reverse -242 -260 -2.43913 0.241
NP_441818.1_9 Forward -266 -247 -1.67217 0.2
NP_441818.1_9 Reverse -141 -160 -6.39206 0.263
NP_441818.1_9 Forward -260 -241 -9.63698 0.291
NP_442169.1_1 Reverse -158 -177 6.58763 0.26
NP_443002.1_5 Forward -161 -143 9.26148 0.296
NP_442752.1_4 Reverse -170 -177 5.44732 0.202
NP_443027.1_4 Forward -155 -145 6.37155 0.283
NP_441745.1_3 Forward -284 -265 14.9449 0.227
NP_441812.1_3 Forward -154 -140 8.65272 0.251
NP_440061.1_9 Reverse -247 -261 8.25877 0.177
NP_441476.1_5 Reverse -271 -290 -6.98204 0.279
NP_439979.1_9 Forward -277 -259 10.3439 0.227
NP_440878.1_9 Reverse -98 -117 -1.86883 0.255
NP_440878.1_9 Forward -268 -249 -1.86883 0.255
NP_442062.1_8 Reverse -170 -180 4.60159 0.206
NP_441859.1_3 Forward -381 -362 1.76863 0.275
NP_440304.1_4 Forward -260 -250 4.0116 0.281
NP_439918.1_2 Reverse -330 -349 5.60432 0.154
NP_439918.1_2 Reverse -324 -343 1.17943 0.217
NP_441594.1_2 Forward -161 -142 11.4058 0.273
NP_441594.1_6 Reverse -270 -289 0.687771 0.282
NP_441925.1_4 Forward -160 -141 -14.0626 0.261
NP_441083.1_5 Forward -324 -314 2.53664 0.194
NP_441083.1_5 Forward -380 -370 -0.41329 0.267
NP_442827.1_8 Reverse -51 -70 -0.984623 0.238
NP_442115.2_8 Reverse -364 -383 11.8975 0.229
NP_441738.1_2 Forward -177 -170 10.2652 0.101
NP_441558.1_5 Reverse -369 -388 7.27595 0.185
NP_441598.1_4 Reverse -226 -245 18.0924 0.239
NP_441624.1_7 Forward -278 -264 9.5377 0.218
NP_441163.1_1 Forward -286 -269 15.5744 0.174
NP_440343.1_9 Forward -276 -257 13.6675 0.164
NP_441130.1_10 Reverse -142 -156 6.09611 0.202
NP_442634.1_4 Reverse -25 -39 -4.4253 0.201
NP_441265.1_1 Forward -288 -269 -17.0118 0.255
NP_440403.1_4 Forward -296 -277 -9.047 0.268
NP_442848.1_4 Reverse -186 -200 5.50613 0.294
NP_442848.1_5 Reverse -242 -260 -0.964162 0.276
NP_442848.1_9 Reverse -243 -262 3.04771 0.245
NP_442848.1_9 Forward -285 -266 1.67108 0.255
NP_441012.1_4 Forward -295 -282 6.4108 0.279
NP_443018.1_3 Forward -379 -372 10.6589 0.0967
NP_443018.1_3 Reverse -372 -379 4.16902 0.278
NP_440376.1_1 Forward -287 -278 5.21127 0.144
NP_441588.1_4 Forward -378 -368 6.76487 0.185
NP_442687.1_7 Reverse -241 -251 9.7148 0.0994
NP_442687.1_7 Forward -259 -249 8.04317 0.116
NP_441077.1_6 Reverse -1 -17 7.23658 0.233
NP_441077.1_6 Reverse -8 -24 6.46533 0.239
NP_442485.1_3 Forward -155 -136 5.211 0.169
NP_441013.1_2 Forward -283 -265 1.19912 0.254
NP_442658.1_1 Forward -181 -171 7.0594 0.214
NP_442658.1_1 Forward -169 -159 4.99446 0.288
NP_441414.1_9 Forward -380 -361 -8.45701 0.236
NP_441487.1_9 Reverse -241 -260 -0.885524 0.269
NP_441478.1_6 Reverse -233 -252 13.2733 0.191
NP_442937.1_5 Forward -356 -337 7.96426 0.237
NP_442937.1_5 Reverse -337 -356 7.57094 0.248
NP_442937.1_5 Forward -293 -274 7.57094 0.248
NP_442937.1_5 Forward -256 -237 5.89931 0.295
NP_442321.1_4 Forward -342 -323 -6.78538 0.284
NP_441127.1_1 Reverse -270 -284 16.4209 0.1
NP_440318.1_1 Forward -285 -266 2.65439 0.266
NP_442836.1_10 Reverse -51 -61 17.9746 0.154
NP_440203.1_5 Forward -147 -137 15.6142 0.0701
NP_440203.1_5 Forward -177 -167 9.12434 0.271
NP_442025.1_4 Forward -121 -102 10.5209 0.291
NP_439905.1_1 Forward -67 -54 8.27909 0.234
NP_441162.1_3 Forward -277 -258 12.9791 0.181
NP_441338.2_5 Reverse -150 -169 2.55606 0.299
NP_442690.1_1 Forward -25 -6 -15.0452 0.277
NP_442064.1_1 Reverse -366 -385 5.70265 0.122
NP_443055.1_6 Forward -68 -50 5.62325 0.179
NP_443055.1_6 Forward -359 -341 -0.374908 0.259
NP_440827.1_3 Forward -278 -259 10.2259 0.299
NP_442210.1_9 Reverse -55 -73 14.6705 0.209
NP_441099.1_5 Forward -268 -249 -10.3253 0.25
NP_442002.1_9 Reverse -277 -284 13.9038 0.141
NP_440411.1_10 Reverse -57 -76 9.09059 0.293
NP_441646.1_1 Reverse -335 -354 -1.08219 0.278
NP_442438.1_10 Forward -158 -144 2.45787 0.176
NP_442431.1_10 Forward -248 -230 0.117479 0.281
NP_442431.1_10 Forward -263 -245 -0.7675 0.294
NP_440147.1_4 Reverse -247 -260 4.24752 0.167
NP_440147.1_4 Reverse -214 -227 1.49425 0.226
NP_441550.1_8 Reverse -369 -379 6.96107 0.183
NP_441550.1_8 Reverse -57 -67 5.58445 0.242
NP_441550.1_8 Forward -382 -372 4.60114 0.299
NP_440206.1_9 Reverse -152 -171 7.27595 0.292
NP_441041.1_4 Reverse -324 -343 -5.99873 0.162
NP_441041.1_4 Reverse -129 -148 -12.5869 0.269
NP_442281.1_1 Forward -172 -158 2.45727 0.266
NP_440177.1_5 Reverse -258 -277 12.4875 0.268
NP_440177.1_9 Forward -167 -148 11.1109 0.285
NP_442012.1_1 Reverse -272 -291 11.8975 0.0735
NP_442012.1_1 Reverse -152 -171 2.0644 0.205
NP_441457.1_7 Forward -260 -241 3.24438 0.246
NP_441860.1_1 Reverse -120 -134 15.2585 0.277
NP_441556.1_4 Forward -165 -146 13.2829 0.201
NP_443030.1_6 Reverse -241 -260 16.1257 0.172
NP_442068.1_4 Forward -161 -142 4.32522 0.296
NP_441644.1_6 Forward -380 -370 12.9592 0.0265
NP_441644.1_6 Forward -251 -241 7.35439 0.129
NP_440652.1_1 Forward -383 -364 32.842 0.0000584
NP_440652.1_2 Forward -269 -250 34.9069 0.00000467
NP_440652.1_3 Forward -173 -154 35.2019 0.00000291
NP_440652.1_5 Forward -233 -214 31.2687 0.0000787
NP_440652.1_6 Forward -203 -184 25.9588 0.00706
NP_440652.1_7 Forward -290 -271 26.5488 0.00564
NP_440652.1_8 Forward -362 -343 26.9421 0.00178
NP_440652.1_9 Forward -116 -97 25.0739 0.0104
NP_440929.1_8 Forward -380 -371 4.91628 0.162
NP_441751.2_8 Forward -286 -272 -6.29359 0.259
NP_442554.1_8 Reverse -372 -382 12.9597 0.021
NP_442554.1_8 Reverse -243 -253 2.33998 0.274
NP_442554.1_9 Reverse -93 -112 12.1205 0.29
NP_442292.1_1 Reverse -372 -381 4.81794 0.17
NP_442292.1_5 Forward -262 -243 0.196116 0.257
NP_442143.1_9 Forward -215 -196 13.5683 0.289
NP_442381.1_1 Forward -286 -267 20.2488 0.0799
NP_443009.1_5 Forward -259 -248 11.9562 0.0586
NP_441865.1_6 Reverse -289 -308 14.9458 0.183
NP_440881.1_7 Forward -261 -242 11.4058 0.283
NP_440183.1_9 Reverse -265 -284 -13.4719 0.26
NP_440183.1_9 Forward -331 -312 -16.3235 0.276
NP_441468.1_1 Forward -379 -372 3.97235 0.277
NP_442099.1_1 Forward -257 -239 13.2938 0.274
NP_440265.1_1 Reverse -97 -116 16.0265 0.253
NP_441826.1_5 Reverse -258 -277 6.68596 0.222
NP_441826.1_5 Forward -278 -259 4.62101 0.253
NP_441826.1_6 Forward -378 -364 13.5693 0.248
NP_441612.1_2 Forward -374 -364 6.80666 0.277
NP_442808.1_1 Forward -151 -141 4.10949 0.207
NP_440031.1_9 Forward -374 -355 8.35759 0.258
NP_442542.1_2 Reverse -268 -281 5.52582 0.262
NP_440038.1_4 Reverse -370 -389 -1.18052 0.296
NP_442342.1_9 Forward -152 -136 2.12349 0.29
NP_441114.1_3 Forward -331 -322 7.37455 0.239
NP_440558.1_2 Reverse -269 -288 -6.78538 0.28
NP_441518.1_3 Reverse -134 -153 -15.7335 0.299
NP_441878.1_6 Forward -259 -249 -7.00147 0.201
NP_441445.1_1 Forward -260 -241 0.196116 0.281
NP_441459.1_3 Reverse -233 -252 11.1347 0.294
NP_441574.1_1 Reverse -330 -349 -0.688862 0.211
NP_442347.1_10 Forward -350 -336 18.0918 0.143
NP_441037.1_4 Forward -382 -372 9.75413 0.21
NP_441037.1_4 Reverse -276 -286 6.63549 0.25
NP_441037.1_4 Reverse -376 -386 6.14821 0.278
NP_441633.1_3 Reverse -247 -260 11.9173 0.0286
NP_441633.1_3 Forward -155 -142 -5.97891 0.236
NP_442468.1_8 Reverse -154 -173 19.764 0.1
NP_442998.1_5 Forward -44 -34 8.92815 0.26
NP_440899.1_2 Forward -155 -136 5.30853 0.29
NP_440299.1_1 Forward -349 -336 3.16532 0.256
NP_441799.1_1 Forward -384 -370 4.12889 0.266
NP_441007.1_10 Reverse -165 -178 0.805932 0.216
NP_442334.1_2 Reverse -268 -285 -14.2191 0.297
NP_441559.1_8 Reverse -244 -258 -3.93365 0.213
NP_440915.1_6 Reverse -274 -288 -0.688726 0.205
NP_440915.1_6 Forward -183 -169 -2.85201 0.284
NP_440748.1_5 Reverse -374 -393 1.37609 0.232
NP_442993.1_1 Reverse -242 -258 -10.9545 0.231
NP_442993.1_1 Reverse -27 -43 -10.9545 0.231
NP_441750.1_1 Forward -272 -253 -10.7186 0.3
NP_441750.1_4 Forward -156 -137 6.98095 0.159
NP_441750.1_7 Reverse -173 -183 13.943 0.254
NP_441340.1_5 Reverse -372 -379 11.3472 0.0526
NP_442484.1_2 Forward -337 -318 8.45592 0.144
NP_440168.1_9 Forward -260 -241 -5.01543 0.296
NP_441676.1_9 Forward -180 -163 13.0178 0.253
NP_440586.1_8 Forward -152 -145 10.7568 0.128
NP_440586.1_8 Forward -379 -372 5.74197 0.283
NP_443051.1_1 Forward -381 -372 -0.000272808 0.245
NP_439996.1_1 Forward -302 -283 9.53756 0.252
NP_439996.1_6 Reverse -134 -153 6.1641 0.298
NP_439937.1_8 Forward -155 -136 -3.44213 0.268
NP_443039.1_7 Forward -344 -330 7.76712 0.19
NP_443039.1_7 Forward -338 -324 6.39049 0.197
NP_440408.1_7 Reverse -236 -255 6.78429 0.299
NP_439943.1_1 Reverse -336 -355 -9.93197 0.29
NP_440372.1_3 Forward -48 -34 12.8075 0.292
NP_440316.1_10 Reverse -269 -279 6.76487 0.253
NP_442384.1_10 Forward -380 -367 2.18257 0.235
NP_442384.1_10 Forward -68 -55 1.9859 0.24
NP_442384.1_10 Forward -167 -154 1.78924 0.247
NP_442114.1_8 Forward -373 -359 3.93223 0.281
NP_440364.1_6 Forward -279 -266 13.2934 0.282
NP_441018.1_7 Reverse -166 -185 10.7175 0.199
NP_442790.1_4 Reverse -362 -381 -10.522 0.213
NP_442262.1_10 Forward -379 -372 12.0355 0.062
NP_442262.1_10 Reverse -28 -35 8.20058 0.25
NP_442917.1_8 Forward -162 -143 13.9625 0.245
NP_440189.1_10 Reverse -332 -351 11.7992 0.172
NP_440100.1_3 Forward -62 -43 -3.04881 0.282
NP_440894.1_10 Forward -283 -264 4.916 0.241
NP_440894.1_10 Reverse -297 -316 2.85105 0.281
NP_440999.1_9 Reverse -245 -259 -2.26202 0.264
NP_440888.1_2 Forward -258 -244 5.60385 0.272
NP_442277.1_4 Reverse -240 -259 2.16195 0.254
NP_442033.1_10 Reverse -247 -266 -11.5053 0.254
NP_441759.1_2 Reverse -300 -319 0.982764 0.219
NP_441543.1_2 Forward -152 -143 11.3078 0.0567
NP_441543.1_2 Reverse -372 -381 4.32629 0.26
NP_442845.1_2 Forward -386 -372 7.17775 0.198
NP_442845.1_2 Reverse -365 -379 6.3911 0.21
NP_441551.1_5 Reverse -149 -165 7.33433 0.249
NP_440982.1_1 Reverse -257 -276 6.29183 0.294
NP_443064.1_6 Reverse -249 -259 10.5308 0.148
NP_443064.1_6 Forward -287 -277 9.85209 0.193
NP_442337.1_8 Reverse -209 -228 -0.885524 0.278
NP_440071.1_1 Reverse -256 -273 7.80625 0.298
NP_441462.1_2 Reverse -371 -381 -1.19994 0.291
NP_441621.1_7 Forward -155 -141 -4.52363 0.232
NP_441601.1_4 Reverse -259 -278 -6.09707 0.296
NP_440889.1_1 Reverse -188 -207 10.3242 0.212
NP_442204.1_1 Reverse -23 -34 9.89177 0.0736
NP_442204.1_1 Reverse -137 -148 0.94365 0.281
NP_440255.1_8 Reverse -250 -269 14.7221 0.28
NP_442537.1_3 Forward -144 -125 14.0608 0.239
NP_440516.1_2 Forward -146 -128 -0.964162 0.271
NP_440516.1_6 Forward -278 -264 8.25877 0.247
NP_442428.1_4 Reverse -51 -70 5.70265 0.211
NP_442428.1_5 Forward -379 -372 4.36568 0.271
NP_442120.1_10 Reverse -243 -262 -11.8986 0.265
NP_440673.1_2 Forward -307 -288 7.95079 0.286
NP_440992.1_2 Forward -392 -373 11.1109 0.26
NP_440314.1_9 Reverse -81 -100 -2.85214 0.168
NP_440314.1_9 Reverse -250 -269 -8.45701 0.248
NP_441733.1_9 Reverse -137 -151 16.4209 0.259
NP_441004.1_1 Forward -264 -245 -6.88371 0.192
NP_441004.1_1 Reverse -318 -337 -11.7019 0.241
NP_441004.1_2 Forward -268 -249 -2.95047 0.269
NP_441004.1_4 Forward -261 -251 8.73149 0.267
NP_441004.1_5 Forward -262 -248 11.5043 0.241
NP_442366.1_3 Reverse -157 -175 1.10079 0.158
NP_442694.1_4 Reverse -171 -180 12.3894 0.249
NP_443054.1_2 Forward -389 -375 5.21113 0.237
NP_441851.1_9 Forward -255 -236 8.65258 0.261
NP_441851.1_10 Reverse -277 -287 9.12481 0.114
NP_442515.1_1 Reverse -248 -262 -4.81863 0.298
NP_440593.1_3 Forward -356 -337 -3.14714 0.233
NP_440593.1_3 Reverse -259 -278 -3.73712 0.241
NP_440593.1_9 Reverse -54 -68 7.9644 0.267
NP_440474.1_8 Reverse -145 -159 5.50552 0.25
NP_440726.1_2 Reverse -137 -156 -0.885524 0.296
NP_442006.1_2 Reverse -135 -152 -16.0874 0.238
NP_441078.1_4 Reverse -278 -287 -2.06522 0.295
NP_442348.1_2 Reverse -170 -179 15.7327 0.119
NP_442348.1_2 Reverse -158 -167 14.7494 0.146
NP_442443.1_1 Forward -274 -255 4.42435 0.157
NP_442443.1_1 Forward -265 -246 -1.18052 0.231
NP_442443.1_4 Forward -377 -367 15.1225 0.179
NP_440526.1_9 Reverse -25 -34 16.421 0.26
NP_441432.1_8 Forward -381 -372 4.22796 0.235
NP_441432.1_9 Reverse -358 -371 8.59837 0.287
NP_442815.1_2 Forward -385 -367 3.85406 0.256
NP_440760.1_1 Reverse -170 -189 -14.5535 0.133
NP_442797.1_1 Reverse -235 -254 0.687771 0.212
NP_442274.1_8 Forward -211 -193 13.9515 0.286
NP_441057.1_4 Forward -312 -294 1.39578 0.253
NP_440913.1_3 Reverse -236 -249 14.4739 0.246
NP_441072.1_2 Forward -391 -372 15.2408 0.14
NP_442489.1_7 Forward -380 -371 -1.47524 0.203
NP_442489.1_7 Reverse -249 -258 -1.86856 0.259
NP_442489.1_7 Forward -287 -278 -1.96689 0.28
NP_442489.1_7 Forward -258 -249 -1.96689 0.28
NP_441830.1_2 Reverse -150 -169 -1.18052 0.257
NP_442079.1_7 Reverse -136 -155 0.196116 0.286
NP_441659.2_8 Forward -380 -370 1.94665 0.22
NP_441659.2_8 Reverse -371 -381 -0.216628 0.292
NP_440426.1_7 Reverse -148 -167 3.14605 0.207
NP_440426.1_7 Forward -163 -144 2.65439 0.207
NP_441040.1_2 Forward -253 -234 -13.4719 0.281
NP_442346.1_2 Forward -391 -372 4.71934 0.289
NP_442346.1_5 Forward -381 -371 4.40493 0.29
NP_442346.1_10 Forward -155 -136 -2.0655 0.294
NP_440545.1_3 Forward -291 -274 -6.64766 0.285
NP_440545.1_3 Reverse -140 -157 -7.13932 0.298
NP_441629.1_1 Forward -108 -89 8.55425 0.235
NP_441126.1_6 Reverse -112 -126 14.5155 0.267
NP_440459.1_2 Forward -389 -372 8.29864 0.266
NP_440010.1_10 Forward -284 -265 2.94938 0.267
NP_441888.1_7 Reverse -211 -225 9.83269 0.136
NP_441888.1_7 Reverse -244 -258 1.47456 0.249
NP_440449.1_6 Forward -158 -140 6.11605 0.259
NP_441047.1_1 Reverse -256 -275 0.884433 0.256
NP_441915.1_4 Reverse -262 -281 6.29183 0.293
NP_442199.1_5 Forward -359 -340 0.786102 0.167
NP_442140.1_3 Forward -379 -369 10.2065 0.0902
NP_441671.1_1 Forward -164 -145 1.0811 0.263
NP_440875.1_9 Reverse -146 -156 9.44274 0.233
NP_440875.1_9 Forward -165 -155 9.3454 0.233
NP_440590.1_4 Forward -386 -373 -0.570702 0.192
NP_440567.1_1 Forward -286 -272 1.47456 0.204
NP_441239.1_9 Forward -280 -268 6.72548 0.178
NP_441239.1_9 Forward -382 -370 5.25052 0.223
NP_441951.1_9 Reverse -268 -287 -0.0988766 0.265
NP_440400.1_1 Forward -188 -169 -3.04956 0.29
NP_443035.1_10 Reverse -137 -154 6.43035 0.273
NP_442809.1_6 Forward -386 -367 3.73603 0.256
NP_440546.1_6 Forward -301 -282 7.17762 0.278
NP_440675.1_1 Forward -261 -242 3.24438 0.252
NP_442340.1_3 Forward -151 -132 1.17943 0.144
NP_442611.1_2 Forward -173 -154 16.0265 0.299
NP_442499.1_1 Forward -197 -178 2.26107 0.289
NP_442787.1_9 Reverse -163 -182 11.6025 0.296
NP_440270.1_2 Forward -173 -154 11.1109 0.24
NP_442358.1_9 Forward -156 -137 13.6675 0.28
NP_442039.1_4 Forward -224 -217 6.13563 0.297
NP_442039.1_7 Forward -378 -368 14.238 0.211
NP_440825.1_4 Forward -268 -249 3.83436 0.266
NP_442053.1_1 Forward -287 -278 9.63616 0.0621
NP_440505.1_3 Reverse -168 -178 10.3048 0.112
NP_442971.1_5 Forward -285 -266 11.8975 0.25
NP_440914.1_1 Forward -380 -370 12.226 0.0652
NP_440914.1_1 Forward -179 -169 10.9573 0.116
NP_442533.1_6 Forward -380 -371 3.93297 0.197
NP_442533.1_6 Forward -351 -342 1.67135 0.293
NP_441527.1_4 Forward -370 -351 -12.7486 0.293
NP_440115.1_6 Reverse -275 -285 8.4365 0.13
NP_440007.1_9 Reverse -23 -37 2.94952 0.277
NP_440007.1_9 Forward -384 -370 0.491246 0.297
NP_441602.1_3 Forward -290 -271 -2.55715 0.233
NP_441602.1_3 Reverse -165 -184 -4.13045 0.261
NP_441106.1_1 Forward -381 -372 5.70292 0.131
NP_442588.1_6 Reverse -151 -170 -1.37718 0.268
NP_001035870.1_3 Reverse -360 -379 -5.99873 0.297
NP_441286.1_1 Forward -252 -240 -6.05754 0.245
NP_440670.1_8 Reverse -371 -380 5.01461 0.175
NP_440670.1_8 Forward -380 -371 4.22796 0.202
NP_440886.1_7 Forward -325 -315 5.58445 0.175
NP_440886.1_7 Reverse -248 -258 4.7978 0.218
NP_440886.1_7 Reverse -377 -387 4.20782 0.249
NP_442072.1_9 Forward -259 -241 -23.187 0.284
NP_442401.1_2 Forward -183 -164 6.78348 0.282
NP_441808.1_8 Forward -284 -265 15.5357 0.152
NP_442022.1_4 Reverse -141 -160 17.109 0.138
NP_439967.1_1 Reverse -256 -274 20.767 0.0393
NP_441463.1_3 Forward -172 -153 -6.88371 0.251
NP_441463.1_7 Reverse -23 -42 13.3725 0.285
NP_442061.1_6 Reverse -188 -198 16.303 0.26
NP_442221.1_4 Reverse -260 -279 6.68596 0.296
NP_442238.1_1 Reverse -324 -343 15.9291 0.0445
NP_442238.1_3 Reverse -324 -343 10.6192 0.146
NP_442615.1_1 Reverse -362 -380 -5.88071 0.227
NP_441962.1_4 Reverse -274 -293 -13.4719 0.273
NP_440387.1_1 Reverse -371 -387 -4.36636 0.185
NP_441431.1_2 Forward -383 -369 5.60385 0.294
NP_441993.1_1 Reverse -141 -160 4.38312 0.221
NP_441993.1_1 Reverse -336 -355 3.11618 0.241
NP_440358.1_8 Forward -215 -196 -1.86883 0.29
NP_442805.1_5 Reverse -98 -117 -5.80282 0.277
NP_441425.1_2 Forward -25 -6 20.0032 0.114
NP_441817.1_1 Forward -121 -103 15.1621 0.19
NP_442698.1_10 Forward -378 -359 7.17762 0.233
NP_439988.1_3 Reverse -47 -61 12.586 0.195
NP_440457.1_1 Reverse -274 -286 -0.551008 0.268
NP_440213.1_4 Reverse -146 -165 18.56 0.216
NP_440798.1_6 Reverse -372 -385 1.88757 0.192
NP_440801.1_10 Reverse -265 -284 5.11266 0.289
NP_442509.1_9 Forward -107 -97 8.63269 0.192
NP_442509.1_9 Reverse -278 -288 6.76441 0.254
NP_442936.1_10 Reverse -10 -24 7.92401 0.27
NP_441885.1_5 Reverse -216 -226 -0.609952 0.215
NP_442341.1_7 Reverse -248 -262 6.19444 0.134
NP_441756.1_5 Forward -281 -262 -4.03212 0.29
NP_440409.1_1 Reverse -241 -260 -2.45882 0.248
NP_440679.1_10 Reverse -137 -156 -12.3902 0.192
NP_440679.1_10 Forward -249 -230 -19.2734 0.279
NP_442451.1_2 Reverse -241 -260 9.83255 0.0755
NP_439962.1_4 Forward -161 -142 -8.35868 0.293
NP_440175.1_4 Forward -260 -241 -2.95047 0.122
NP_440175.1_7 Forward -276 -258 16.6825 0.0997
NP_442495.1_5 Forward -161 -142 7.07928 0.291
NP_440216.1_1 Forward -258 -244 -11.3085 0.178
NP_440216.1_9 Forward -378 -369 7.17789 0.286
NP_440216.1_9 Forward -143 -134 7.17789 0.286
NP_440172.1_1 Reverse -249 -259 7.15819 0.0897
NP_440172.1_1 Forward -380 -370 2.7333 0.268
NP_440172.1_1 Forward -251 -241 2.14332 0.283
NP_442329.1_8 Forward -278 -259 7.37428 0.192
NP_441226.1_7 Reverse -372 -379 12.4284 0.0404
NP_442252.1_2 Forward -312 -294 17.2271 0.27
NP_440416.1_9 Forward -174 -155 -8.65367 0.119
NP_443052.1_9 Reverse -232 -251 -4.52377 0.258
NP_442154.1_1 Forward -259 -241 -16.0088 0.229
NP_440261.1_5 Forward -67 -54 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAGCTGTCCGTAAAGGGGTAGCCGATGGCAAAAAACAACTAATTGAAGTGCCCTTGACCAAATCCAATTCCATTACCCATATCACCAATGGAGTTTCTGGAGGAGCCAAAGTGGTGGTTCGCCCCGCTGCCCCTGGTACTGGGGTAATTGCCGGTGGCGCTGTTCGTACTGTGCTAGAGCTAGCCGGAGTTAAGAATATCCTAGCCAAACAACTAGGCTCCAACAATCCCCTCAACAATGCCCGGGCTGCCATCAACGCCTTGGAAACCCTGCGTACTTTTTCGGAAGTAGCAGAAGAACGGGGAGTTTCTGTCGAGCATCTTTACACCTAAGCTGAAGGCCCCAAGCCTTTACTAAGTGAAAATTCCATCTCCTGTGAACTTAATTTTTAATATTAGCC

CDS

ATGAATTTGAGCGAACTCTCTCCCAAGGACGGTGCCAAGAAACGCCGTCGCCGTGTTGGCCGGGGTATTGCGGCAGGGCAAGGCGCTAGCTGTGGTTTTGGTATGCGGGGCCAGAAATCCCGTTCTGGTACCGGTACCAAAGCTGGTTTTGAAGGGGGACAAATGCCCCTCTACCGTCGTCTGCCTAAGTTAAAGCACTTTCCCCTCTACAATCCCAAGCATTTTACGGTGGTTAACGTTGGTAAGTTGGCCGGTCTAGCCCCCAACACCGTGGTCACCCTAGAAAGCCTGATGGAAGCGGGTATTGTCACTAGTAATGACGGTCCCCTAAAAGTTTTGGGCAACGGGGAATTAGCCGTAGCTCTCACCGTCCATGCTCCCTGTAGCAAAGCAGCCCAAGCCAAAATTGAAGCGGCCGGTGGCAGTGTGGTGGCGCAGGGCTAA

Protein

MNLSELSPKDGAKKRRRRVGRGIAAGQGASCGFGMRGQKSRSGTGTKAGFEGGQMPLYRRLPKLKHFPLYNPKHFTVVNVGKLAGLAPNTVVTLESLMEAGIVTSNDGPLKVLGNGELAVALTVHAPCSKAAQAKIEAAGGSVVAQG