Your browser is old and dusty. Try Google Chrome!

Details for sll1804

ORF sll1804
Accession NP_440663.1
Symbol rps3
Category Ribosomal proteins: synthesis and modification
Definition 30S ribosomal protein S3
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -355 -369 12.1926 0.0481
NP_441061.1_2 Forward -65 -51 1.57289 0.186
NP_441061.1_2 Reverse -202 -216 1.27789 0.192
NP_441061.1_2 Forward -59 -45 0.982901 0.196
NP_440557.1_1 Reverse -355 -374 0.884433 0.265
NP_440795.1_7 Forward -362 -355 14.6904 0.0123
NP_440795.1_7 Reverse -355 -362 14.6904 0.0123
NP_441418.1_6 Reverse -354 -373 -29.4015 0.224
NP_441418.1_6 Forward -363 -344 -29.6965 0.234
NP_442291.1_5 Forward -364 -348 -2.10475 0.21
NP_441453.1_1 Forward -132 -114 6.1149 0.241
NP_441453.1_4 Reverse -354 -362 16.539 0.00633
NP_441453.1_4 Forward -363 -355 16.539 0.00633
NP_441453.1_4 Forward -210 -202 4.14932 0.264
NP_442151.1_1 Forward -130 -111 5.89931 0.287
NP_442151.1_6 Reverse -354 -368 11.406 0.101
NP_442151.1_6 Forward -216 -202 9.14437 0.157
NP_442151.1_6 Forward -60 -46 7.27608 0.205
NP_442151.1_6 Forward -363 -349 6.3911 0.236
NP_443043.1_7 Forward -129 -110 17.109 0.0737
NP_440561.1_4 Forward -56 -37 13.5996 0.229
NP_441818.1_1 Forward -362 -351 16.7744 0.0118
NP_441818.1_9 Reverse -57 -76 -9.34199 0.29
NP_440226.1_1 Reverse -354 -373 6.39097 0.129
NP_440226.1_1 Forward -149 -130 6.19431 0.135
NP_441630.1_3 Reverse -346 -365 7.96426 0.118
NP_442623.1_3 Reverse -46 -65 -18.4868 0.263
NP_440150.1_2 Reverse -203 -222 10.0284 0.217
NP_440150.1_2 Forward -64 -45 5.11187 0.276
NP_440996.1_3 Reverse -50 -68 10.2456 0.259
NP_442655.1_1 Reverse -349 -368 -1.86883 0.293
NP_442173.1_1 Forward -362 -354 15.4574 0.00633
NP_442173.1_1 Reverse -355 -363 15.4574 0.00633
NP_442752.1_4 Forward -363 -356 13.8055 0.0199
NP_442752.1_4 Reverse -354 -361 13.8055 0.0199
NP_443027.1_4 Forward -365 -355 16.2046 0.0437
NP_443027.1_4 Reverse -21 -31 8.73149 0.191
NP_441745.1_3 Forward -57 -38 15.1416 0.222
NP_441812.1_3 Reverse -353 -367 9.83269 0.228
NP_442975.1_10 Reverse -350 -364 4.42388 0.245
NP_440784.1_7 Forward -362 -355 15.9687 0.0123
NP_440784.1_7 Reverse -355 -362 15.9687 0.0123
NP_441934.1_8 Forward -51 -32 13.1758 0.275
NP_440061.1_9 Forward -365 -351 11.897 0.105
NP_441054.1_4 Forward -373 -355 -2.43913 0.234
NP_441476.1_5 Reverse -46 -65 -5.99873 0.271
NP_441476.1_5 Reverse -196 -215 -7.27704 0.285
NP_439979.1_2 Forward -216 -197 10.8159 0.192
NP_439979.1_9 Reverse -46 -64 10.6389 0.227
NP_439979.1_9 Reverse -40 -58 10.6389 0.227
NP_442062.1_8 Forward -363 -353 17.6796 0.00193
NP_442062.1_8 Reverse -354 -364 10.3048 0.0493
NP_442062.1_8 Forward -156 -146 8.63316 0.0733
NP_442062.1_8 Forward -210 -200 6.37155 0.127
NP_442062.1_8 Forward -48 -38 2.83163 0.293
NP_440761.1_4 Reverse -349 -368 -14.1602 0.257
NP_441900.1_2 Forward -126 -108 -6.56973 0.294
NP_440839.1_4 Reverse -355 -374 11.2084 0.268
NP_441859.1_3 Forward -364 -345 3.63691 0.238
NP_441859.1_3 Reverse -200 -219 1.47364 0.284
NP_440304.1_4 Forward -365 -355 19.9412 0.00364
NP_440304.1_4 Reverse -49 -59 11.0914 0.051
NP_440304.1_4 Reverse -352 -362 9.91146 0.051
NP_442242.1_4 Forward -362 -355 14.3954 0.0124
NP_442242.1_4 Reverse -355 -362 14.3954 0.0124
NP_441781.1_7 Forward -60 -41 -0.197208 0.256
NP_441620.1_3 Forward -370 -351 13.5691 0.248
NP_441208.1_9 Reverse -351 -365 5.40779 0.267
NP_442196.1_10 Forward -158 -139 18.0924 0.131
NP_440132.1_1 Reverse -352 -370 12.5072 0.193
NP_442110.1_7 Reverse -354 -368 11.406 0.0595
NP_442110.1_7 Reverse -201 -215 8.45605 0.09
NP_442726.1_7 Forward -217 -199 1.39578 0.247
NP_440330.1_2 Reverse -140 -159 8.84924 0.297
NP_440856.1_4 Forward -163 -144 -4.42544 0.258
NP_441083.1_5 Forward -363 -353 19.3512 0.000718
NP_441083.1_5 Reverse -354 -364 11.2881 0.0159
NP_441083.1_5 Forward -93 -83 0.275027 0.237
NP_442827.1_8 Reverse -346 -365 3.63691 0.144
NP_441434.1_7 Forward -361 -347 5.70279 0.225
NP_441738.1_2 Forward -361 -354 15.28 0.0102
NP_441738.1_2 Reverse -356 -363 15.28 0.0102
NP_441558.1_5 Forward -365 -346 17.109 0.0231
NP_441558.1_5 Reverse -138 -157 6.09597 0.229
NP_440209.1_1 Reverse -354 -362 18.1123 0.00295
NP_440209.1_1 Forward -363 -355 18.1123 0.00295
NP_442889.1_1 Forward -206 -187 -13.6686 0.262
NP_442889.1_8 Reverse -351 -365 10.422 0.0848
NP_440447.1_6 Reverse -346 -364 2.0841 0.249
NP_441713.1_1 Forward -216 -197 -12.6852 0.248
NP_441713.1_8 Reverse -174 -192 12.7038 0.194
NP_440178.1_7 Reverse -353 -372 7.17762 0.013
NP_442570.1_3 Reverse -352 -371 -8.85033 0.294
NP_441716.1_1 Forward -363 -349 8.75105 0.133
NP_441327.1_5 Reverse -255 -264 15.831 0.191
NP_442111.1_4 Reverse -353 -367 8.55439 0.0729
NP_441624.1_7 Forward -54 -40 6.19444 0.29
NP_441163.1_1 Forward -67 -50 13.3128 0.183
NP_440906.1_5 Forward -362 -355 15.8704 0.0124
NP_440906.1_5 Reverse -355 -362 15.8704 0.0124
NP_440747.1_10 Forward -366 -354 7.80712 0.00223
NP_440747.1_10 Reverse -351 -363 7.4138 0.00422
NP_440747.1_10 Forward -213 -201 -11.8591 0.161
NP_441130.1_10 Forward -365 -351 11.3077 0.107
NP_441130.1_10 Forward -127 -113 5.60446 0.223
NP_441486.1_1 Forward -366 -352 -3.147 0.176
NP_441486.1_1 Forward -35 -21 -4.62196 0.204
NP_441486.1_1 Reverse -351 -365 -4.7203 0.205
NP_441486.1_1 Forward -213 -199 -5.80194 0.26
NP_442330.1_4 Reverse -113 -132 12.2135 0.289
NP_442634.1_4 Reverse -352 -366 25.074 0.0027
NP_440403.1_10 Reverse -48 -67 3.93269 0.268
NP_440842.1_10 Forward -120 -106 5.40779 0.251
NP_441012.1_4 Forward -108 -95 18.2105 0.104
NP_441012.1_4 Reverse -41 -54 15.5556 0.166
NP_441012.1_4 Reverse -368 -381 8.9674 0.272
NP_443018.1_3 Forward -362 -355 14.8871 0.0123
NP_443018.1_3 Reverse -355 -362 14.8871 0.0123
NP_443018.1_3 Forward -148 -141 8.39725 0.147
NP_443018.1_3 Reverse -202 -209 4.26735 0.267
NP_443018.1_3 Forward -209 -202 4.16902 0.278
NP_441316.1_7 Reverse -352 -367 7.45305 0.107
NP_441634.1_8 Forward -151 -137 3.34284 0.154
NP_441634.1_8 Forward -145 -131 -0.590395 0.262
NP_441634.1_8 Forward -68 -54 -1.67204 0.295
NP_441634.1_8 Forward -50 -36 -4.32697 0.295
NP_440376.1_1 Forward -363 -354 19.4693 0.000692
NP_440376.1_1 Reverse -354 -363 19.4693 0.000692
NP_440376.1_1 Reverse -201 -210 4.62128 0.154
NP_441857.1_5 Reverse -347 -365 1.29745 0.297
NP_443065.1_1 Forward -275 -256 12.1925 0.285
NP_442687.1_7 Reverse -353 -363 18.5646 0.0028
NP_442687.1_7 Forward -364 -354 9.02648 0.0994
NP_442687.1_7 Forward -211 -201 3.81494 0.286
NP_442485.1_3 Reverse -114 -133 10.9142 0.105
NP_442485.1_3 Forward -59 -40 -2.0655 0.261
NP_442485.1_3 Forward -374 -355 -4.03212 0.277
NP_440642.1_1 Reverse -233 -252 13.8641 0.141
NP_441422.1_7 Reverse -352 -369 4.26707 0.107
NP_441422.1_7 Reverse -199 -216 -7.63097 0.26
NP_441950.1_8 Forward -144 -130 7.07942 0.209
NP_441763.1_10 Forward -374 -355 11.6017 0.143
NP_442658.1_1 Reverse -352 -362 16.0075 0.00966
NP_442658.1_1 Forward -365 -355 13.0576 0.04
NP_442658.1_1 Reverse -145 -155 10.3043 0.125
NP_442658.1_1 Reverse -49 -59 5.78111 0.25
NP_442658.1_1 Reverse -199 -209 4.7978 0.297
NP_440141.1_4 Forward -378 -359 20.8456 0.00774
NP_442782.1_2 Reverse -147 -161 11.7993 0.173
NP_442782.1_2 Reverse -125 -139 8.65272 0.198
NP_442782.1_2 Reverse -354 -368 4.62115 0.251
NP_442205.1_9 Forward -369 -353 7.33503 0.105
NP_440656.1_8 Reverse -343 -362 -5.11376 0.214
NP_440656.1_8 Reverse -114 -133 -9.83364 0.3
NP_441414.1_9 Reverse -354 -373 -9.73531 0.266
NP_440800.1_5 Forward -55 -36 20.2556 0.125
NP_440607.1_5 Reverse -42 -61 -0.4922 0.279
NP_442937.1_5 Reverse -66 -85 11.6025 0.133
NP_441958.1_5 Forward -364 -354 21.2195 0.000805
NP_441958.1_5 Reverse -353 -363 20.5312 0.000966
NP_441127.1_5 Reverse -145 -164 13.8621 0.274
NP_442836.1_5 Reverse -348 -367 5.99764 0.185
NP_440203.1_5 Reverse -357 -367 12.5659 0.146
NP_439905.1_2 Forward -65 -51 9.63603 0.23
NP_440984.1_7 Forward -386 -372 7.17775 0.182
NP_440984.1_7 Reverse -349 -363 5.21113 0.265
NP_442911.1_2 Forward -373 -354 3.53937 0.0428
NP_442911.1_2 Reverse -344 -363 -9.63698 0.26
NP_441580.1_6 Forward -374 -355 -6.39206 0.235
NP_441580.1_6 Reverse -136 -155 -7.57203 0.244
NP_440153.1_8 Forward -216 -203 3.46087 0.21
NP_442064.1_4 Forward -70 -51 4.42355 0.287
NP_440993.1_3 Forward -70 -51 8.06178 0.135
NP_440993.1_4 Forward -375 -358 2.20212 0.3
NP_440827.1_3 Forward -59 -40 15.5357 0.169
NP_440827.1_3 Forward -374 -355 10.2259 0.299
NP_441099.1_5 Reverse -344 -363 4.32602 0.0495
NP_441099.1_5 Forward -373 -354 0.982764 0.0714
NP_441099.1_5 Reverse -41 -60 -10.3253 0.25
NP_442002.1_9 Reverse -353 -360 14.1004 0.074
NP_440475.1_2 Reverse -202 -221 17.1332 0.241
NP_441294.1_7 Reverse -350 -364 14.242 0.0448
NP_442438.1_10 Forward -368 -354 4.03116 0.152
NP_441000.1_6 Forward -364 -350 5.1128 0.0933
NP_442771.1_1 Reverse -352 -370 -4.70074 0.166
NP_440147.1_4 Forward -365 -352 11.6223 0.0326
NP_440147.1_4 Reverse -352 -365 9.95071 0.0362
NP_440147.1_4 Reverse -199 -212 0.707601 0.247
NP_441550.1_8 Reverse -352 -362 18.1707 0.00754
NP_441550.1_8 Forward -365 -355 13.0576 0.0273
NP_441916.1_7 Reverse -354 -364 18.9579 0.00144
NP_441916.1_7 Forward -363 -353 16.893 0.00407
NP_441916.1_10 Reverse -43 -62 6.19431 0.208
NP_441916.1_10 Reverse -49 -68 0.786102 0.275
NP_440206.1_4 Reverse -41 -60 3.53858 0.278
NP_440206.1_4 Reverse -97 -116 0.785326 0.289
NP_440206.1_4 Forward -64 -45 0.490334 0.289
NP_440206.1_4 Forward -220 -201 -0.492971 0.29
NP_440206.1_4 Reverse -99 -118 -2.36125 0.295
NP_441041.1_1 Reverse -45 -64 17.8957 0.138
NP_441041.1_4 Reverse -354 -373 10.4225 0.0279
NP_441041.1_4 Reverse -45 -64 -13.8652 0.297
NP_441041.1_7 Reverse -351 -363 20.245 0.00277
NP_441041.1_7 Forward -366 -354 6.34865 0.211
NP_441041.1_7 Reverse -290 -302 5.47405 0.255
NP_442004.1_6 Reverse -354 -368 15.0442 0.0661
NP_442004.1_6 Reverse -201 -215 5.40779 0.191
NP_441725.1_4 Forward -368 -354 2.45727 0.287
NP_441725.1_5 Forward -362 -352 11.7798 0.0247
NP_441725.1_5 Reverse -355 -365 11.1898 0.0247
NP_441725.1_5 Forward -59 -49 5.19158 0.115
NP_439966.1_7 Forward -365 -355 14.8275 0.0177
NP_439966.1_7 Reverse -352 -362 8.63269 0.132
NP_442941.1_3 Reverse -355 -365 19.9412 0.00262
NP_442941.1_3 Forward -362 -352 10.6981 0.0116
NP_440289.1_2 Reverse -351 -364 15.1623 0.0107
NP_440289.1_2 Forward -366 -353 6.70579 0.0591
NP_440289.1_4 Forward -344 -325 8.65258 0.295
NP_440983.1_5 Forward -222 -203 -6.09707 0.276
NP_440983.1_9 Forward -143 -124 -0.0988766 0.295
NP_441678.1_9 Reverse -273 -292 -5.01543 0.297
NP_442281.1_1 Forward -368 -354 15.0436 0.0144
NP_442281.1_1 Reverse -349 -363 12.192 0.0396
NP_441334.1_7 Reverse -199 -218 -20.945 0.284
NP_440177.1_1 Reverse -285 -303 6.70565 0.272
NP_442256.1_2 Reverse -352 -370 -7.55234 0.214
NP_001035871.2_7 Reverse -149 -159 14.533 0.187
NP_440647.1_9 Reverse -352 -370 6.41066 0.219
NP_442012.1_1 Forward -66 -47 3.34271 0.18
NP_441087.1_6 Forward -67 -49 -1.45654 0.265
NP_441457.1_7 Reverse -114 -133 1.27776 0.276
NP_440723.1_8 Reverse -44 -58 10.0294 0.285
NP_440498.1_1 Forward -372 -354 16.6371 0.0213
NP_443030.1_4 Forward -375 -356 -7.86702 0.299
NP_441644.1_6 Reverse -354 -364 19.0557 0.000803
NP_441644.1_6 Forward -363 -353 15.7125 0.0048
NP_441644.1_6 Forward -216 -206 8.63269 0.097
NP_441644.1_6 Reverse -372 -382 7.84605 0.115
NP_441644.1_6 Forward -60 -50 4.69947 0.228
NP_441644.1_6 Reverse -201 -211 4.01116 0.253
NP_441644.1_6 Forward -356 -346 3.42118 0.282
NP_442215.1_2 Reverse -205 -221 -6.23465 0.266
NP_441810.1_5 Forward -73 -54 6.88262 0.297
NP_442029.1_6 Forward -215 -196 5.11266 0.255
NP_440253.1_2 Forward -363 -345 -3.6191 0.297
NP_440929.1_8 Forward -363 -354 19.2726 0.000701
NP_440929.1_8 Reverse -354 -363 19.2726 0.000701
NP_442933.1_10 Forward -363 -354 17.601 0.00325
NP_442933.1_10 Reverse -354 -363 17.601 0.00325
NP_442933.1_10 Reverse -201 -210 5.01461 0.204
NP_441751.2_8 Reverse -355 -369 23.5007 0.00466
NP_441751.2_8 Forward -362 -348 11.6026 0.0222
NP_442926.1_3 Reverse -40 -59 14.8474 0.087
NP_442926.1_3 Forward -59 -40 12.8808 0.108
NP_442926.1_3 Forward -374 -355 11.6025 0.119
NP_442554.1_8 Reverse -355 -365 16.9913 0.0065
NP_442554.1_8 Forward -362 -352 15.123 0.00944
NP_442554.1_8 Reverse -202 -212 7.45319 0.092
NP_442554.1_8 Forward -215 -205 3.71661 0.215
NP_442554.1_8 Reverse -40 -50 2.53664 0.268
NP_442554.1_8 Reverse -337 -347 2.14332 0.281
NP_442554.1_8 Reverse -141 -151 2.04498 0.285
NP_442075.1_10 Reverse -354 -373 10.8159 0.294
NP_441762.1_7 Reverse -353 -365 1.61227 0.0736
NP_441762.1_7 Reverse -200 -212 -5.66422 0.228
NP_441762.1_7 Reverse -115 -127 -5.86088 0.246
NP_441762.1_7 Forward -364 -352 -6.74586 0.284
NP_442142.1_4 Reverse -351 -364 12.5067 0.0442
NP_442142.1_4 Forward -366 -353 8.18017 0.12
NP_442142.1_4 Forward -219 -206 5.62358 0.187
NP_442142.1_4 Forward -213 -200 5.23026 0.197
NP_442292.1_1 Reverse -355 -364 17.5026 0.00435
NP_442292.1_1 Forward -362 -353 9.53783 0.0183
NP_442292.1_1 Reverse -202 -211 -0.786921 0.287
NP_442292.1_5 Forward -367 -348 -1.57384 0.265
NP_440895.1_10 Reverse -368 -385 -5.76269 0.294
NP_442381.1_8 Reverse -343 -362 -14.9469 0.29
NP_441523.1_6 Reverse -285 -304 5.211 0.239
NP_443009.1_5 Forward -364 -353 17.0694 0.00659
NP_443009.1_5 Reverse -353 -364 16.7744 0.00677
NP_443009.1_5 Forward -211 -200 5.85971 0.185
NP_442406.1_9 Reverse -32 -51 0.884433 0.277
NP_441715.1_4 Reverse -355 -365 14.238 0.0295
NP_441715.1_4 Forward -362 -352 9.81313 0.097
NP_441715.1_9 Forward -374 -360 18.1908 0.261
NP_440183.1_1 Reverse -355 -374 13.5691 0.239
NP_441198.1_8 Forward -365 -355 13.2713 0.108
NP_440379.1_5 Forward -378 -359 7.07928 0.133
NP_440379.1_5 Reverse -68 -87 -11.0136 0.288
NP_441468.1_1 Forward -362 -355 15.8704 0.0124
NP_441468.1_1 Reverse -355 -362 15.8704 0.0124
NP_441468.1_1 Reverse -202 -209 4.36568 0.237
NP_441015.1_10 Reverse -202 -221 11.9958 0.0657
NP_441015.1_10 Forward -215 -196 4.52268 0.125
NP_441015.1_10 Forward -374 -355 4.12936 0.128
NP_441015.1_10 Reverse -40 -59 -4.72043 0.211
NP_441015.1_10 Reverse -46 -65 -9.44032 0.282
NP_441673.1_1 Forward -363 -354 20.8459 0.000698
NP_441673.1_1 Reverse -354 -363 20.8459 0.000698
NP_441826.1_2 Forward -66 -52 -1.27871 0.242
NP_441826.1_2 Forward -369 -355 -2.75368 0.275
NP_441826.1_2 Forward -216 -202 -3.147 0.283
NP_441826.1_2 Reverse -348 -362 -3.44199 0.285
NP_442490.1_9 Forward -375 -356 -7.08038 0.275
NP_442868.1_6 Reverse -352 -362 18.5646 0.0104
NP_442868.1_6 Reverse -49 -59 4.40493 0.178
NP_442868.1_6 Forward -365 -355 1.06167 0.205
NP_442868.1_6 Forward -212 -202 -0.41329 0.295
NP_442719.1_2 Forward -134 -116 -11.0929 0.287
NP_441056.1_1 Reverse -354 -373 6.39097 0.104
NP_441056.1_1 Forward -86 -67 -6.68705 0.271
NP_442227.1_2 Forward -126 -107 -3.24547 0.29
NP_443058.1_9 Forward -59 -41 14.0805 0.164
NP_442808.1_1 Reverse -353 -363 8.73102 0.0481
NP_442808.1_1 Forward -364 -354 8.73102 0.0481
NP_442808.1_1 Reverse -139 -149 5.28945 0.162
NP_442542.1_2 Reverse -352 -365 10.4424 0.126
NP_442050.1_1 Reverse -50 -69 11.2092 0.233
NP_442050.1_5 Forward -365 -355 18.0724 0.00365
NP_442050.1_5 Reverse -352 -362 13.6475 0.0295
NP_442342.1_9 Reverse -352 -368 10.1866 0.137
NP_440558.1_2 Forward -165 -146 4.03102 0.152
NP_440558.1_2 Forward -219 -200 2.55606 0.167
NP_440558.1_2 Forward -372 -353 1.76941 0.176
NP_440558.1_2 Forward -63 -44 0.58944 0.19
NP_440558.1_2 Forward -57 -38 -0.688862 0.204
NP_440558.1_5 Forward -59 -45 16.0275 0.239
NP_442789.1_4 Reverse -352 -371 -6.88371 0.289
NP_442792.1_5 Reverse -147 -164 9.87194 0.285
NP_441878.1_6 Reverse -353 -363 20.2362 0.0046
NP_441878.1_6 Forward -364 -354 10.5014 0.0176
NP_441878.1_6 Reverse -50 -60 -7.19813 0.21
NP_441878.1_6 Reverse -200 -210 -7.29646 0.217
NP_441036.1_8 Forward -364 -354 15.713 0.00724
NP_441036.1_8 Reverse -353 -363 8.4365 0.174
NP_441557.1_5 Forward -363 -354 19.9609 0.000699
NP_441557.1_5 Reverse -354 -363 19.9609 0.000699
NP_441557.1_5 Forward -210 -201 -0.590259 0.219
NP_440744.1_2 Reverse -353 -372 17.4369 0.172
NP_440084.1_8 Forward -197 -183 8.60589 0.299
NP_441308.1_8 Forward -365 -355 13.353 0.218
NP_442183.1_1 Reverse -354 -368 17.5025 0.0107
NP_440979.1_3 Reverse -355 -373 14.0805 0.234
NP_441574.1_1 Forward -161 -142 -7.27704 0.286
NP_441574.1_1 Reverse -354 -373 -7.37537 0.289
NP_441574.1_1 Reverse -45 -64 -7.86702 0.297
NP_442444.1_6 Forward -371 -353 12.6304 0.27
NP_441549.1_9 Reverse -350 -368 3.55906 0.0925
NP_442347.1_2 Forward -362 -353 3.34298 0.284
NP_442347.1_2 Reverse -355 -364 3.34298 0.284
NP_442645.1_2 Forward -371 -352 -7.37537 0.106
NP_442645.1_2 Reverse -42 -61 -14.1602 0.171
NP_442645.1_2 Forward -191 -172 -21.1417 0.29
NP_442645.1_2 Reverse -199 -218 -22.8133 0.296
NP_442645.1_2 Reverse -150 -169 -22.8133 0.296
NP_442965.1_2 Reverse -120 -139 -7.67036 0.274
NP_441037.1_4 Reverse -352 -362 9.55921 0.21
NP_441037.1_4 Forward -365 -355 7.31769 0.237
NP_441037.1_4 Reverse -49 -59 5.95329 0.289
NP_441633.1_3 Forward -365 -352 -3.71729 0.177
NP_441633.1_3 Reverse -352 -365 -3.91395 0.177
NP_440136.1_2 Forward -362 -355 15.9687 0.0123
NP_440136.1_2 Reverse -355 -362 15.9687 0.0123
NP_442590.1_10 Reverse -347 -366 11.4058 0.158
NP_442590.1_10 Reverse -354 -373 4.22769 0.278
NP_441728.2_4 Forward -400 -381 13.3207 0.248
NP_442998.1_10 Forward -361 -354 15.5754 0.0102
NP_442998.1_10 Reverse -356 -363 15.5754 0.0102
NP_440731.1_2 Reverse -45 -64 21.6323 0.0158
NP_440899.1_1 Reverse -45 -64 8.11467 0.238
NP_440899.1_2 Forward -374 -355 10.9134 0.146
NP_440299.1_1 Forward -214 -201 11.3267 0.0506
NP_440299.1_1 Forward -367 -354 3.46031 0.243
NP_441799.1_1 Reverse -350 -364 13.2736 0.0337
NP_441799.1_1 Forward -367 -353 8.75042 0.106
NP_441799.1_1 Forward -160 -146 3.8339 0.279
NP_442802.1_2 Reverse -41 -60 13.7649 0.223
NP_441007.1_10 Forward -368 -355 12.9006 0.0499
NP_441007.1_10 Forward -386 -373 -0.767364 0.293
NP_442201.1_10 Reverse -136 -155 -11.4069 0.267
NP_442333.2_5 Forward -220 -201 -15.5368 0.298
NP_440256.1_1 Forward -159 -140 4.62101 0.0429
NP_440256.1_1 Forward -366 -347 0.786102 0.0805
NP_440087.1_1 Forward -372 -353 -6.1954 0.252
NP_441559.1_8 Reverse -196 -210 -0.688726 0.179
NP_441559.1_8 Reverse -349 -363 -5.60527 0.267
NP_441559.1_8 Forward -64 -50 -5.80194 0.27
NP_441559.1_8 Forward -53 -39 -6.29359 0.276
NP_440915.1_6 Reverse -350 -364 12.6843 0.0208
NP_440915.1_6 Forward -367 -353 1.96621 0.128
NP_442785.1_7 Forward -83 -69 11.3077 0.228
NP_442785.1_7 Forward -365 -351 10.521 0.228
NP_442866.1_4 Reverse -355 -374 8.65258 0.18
NP_440748.1_5 Reverse -53 -72 1.17943 0.24
NP_440748.1_5 Reverse -143 -162 -0.983855 0.264
NP_441464.1_1 Forward -367 -348 7.96426 0.261
NP_441464.1_8 Forward -363 -349 9.14437 0.192
NP_440695.1_5 Reverse -354 -373 6.68596 0.15
NP_441199.1_6 Forward -367 -348 2.65439 0.197
NP_441199.1_6 Forward -64 -45 0.491109 0.242
NP_441494.1_6 Reverse -46 -59 12.6056 0.225
NP_441494.1_6 Forward -368 -355 8.57408 0.23
NP_442993.1_1 Reverse -354 -370 6.35172 0.0399
NP_442993.1_1 Forward -363 -347 1.73016 0.0502
NP_442386.1_9 Forward -211 -202 10.324 0.132
NP_442386.1_9 Reverse -38 -47 8.84908 0.182
NP_442386.1_9 Reverse -146 -155 7.86578 0.215
NP_442386.1_9 Forward -162 -153 6.48915 0.219
NP_442386.1_9 Forward -364 -355 6.39082 0.219
NP_442386.1_9 Reverse -353 -362 6.39082 0.219
NP_442386.1_9 Reverse -200 -209 5.11253 0.266
NP_442386.1_9 Forward -217 -208 4.7192 0.289
NP_440570.1_5 Reverse -41 -60 5.211 0.204
NP_440570.1_5 Forward -159 -140 2.75272 0.234
NP_441750.1_1 Forward -155 -136 -9.24366 0.3
NP_441340.1_5 Forward -362 -355 15.6737 0.0124
NP_441340.1_5 Reverse -355 -362 15.6737 0.0124
NP_441340.1_5 Forward -209 -202 4.07068 0.239
NP_442791.1_5 Forward -303 -284 -10.817 0.281
NP_440168.1_2 Reverse -358 -377 -4.03212 0.276
NP_440168.1_4 Forward -70 -51 -5.60541 0.255
NP_440168.1_8 Reverse -195 -214 10.3242 0.179
NP_440168.1_8 Forward -66 -47 7.7676 0.179
NP_440168.1_9 Reverse -352 -371 5.80098 0.227
NP_440327.1_6 Reverse -60 -79 7.27595 0.228
NP_442240.1_1 Forward -68 -49 8.75009 0.235
NP_440586.1_1 Forward -379 -360 0.982764 0.236
NP_440586.1_8 Forward -362 -355 13.2151 0.026
NP_440586.1_8 Reverse -355 -362 13.2151 0.026
NP_440586.1_8 Forward -209 -202 7.70858 0.227
NP_440586.1_8 Forward -148 -141 7.21693 0.27
NP_442251.1_6 Forward -362 -355 15.2804 0.0124
NP_442251.1_6 Reverse -355 -362 15.2804 0.0124
NP_440684.1_9 Reverse -366 -380 12.9793 0.168
NP_440684.1_9 Forward -31 -17 6.98109 0.283
NP_441262.1_3 Reverse -354 -361 14.7888 0.0223
NP_441262.1_3 Forward -363 -356 14.7888 0.0223
NP_443051.1_1 Forward -364 -355 19.5676 0.00335
NP_443051.1_1 Reverse -353 -362 18.0926 0.00402
NP_439996.1_6 Forward -303 -284 6.45564 0.296
NP_439937.1_8 Reverse -46 -65 5.89931 0.192
NP_439937.1_8 Forward -374 -355 5.50599 0.192
NP_439937.1_8 Reverse -361 -380 -4.81876 0.286
NP_439937.1_9 Reverse -288 -305 -9.59824 0.196
NP_440926.1_5 Forward -59 -40 12.6841 0.23
NP_440408.1_7 Reverse -44 -63 11.9958 0.212
NP_440408.1_10 Reverse -116 -135 4.71934 0.293
NP_440439.1_1 Forward -366 -353 18.2105 0.0105
NP_440439.1_1 Reverse -351 -364 1.78924 0.143
NP_440372.1_2 Forward -362 -355 16.3621 0.0124
NP_440372.1_2 Reverse -355 -362 16.3621 0.0124
NP_440316.1_10 Reverse -107 -117 9.02648 0.236
NP_440316.1_10 Reverse -50 -60 7.15819 0.251
NP_441803.1_2 Forward -368 -349 7.96426 0.124
NP_441803.1_2 Forward -218 -199 -0.885524 0.291
NP_439977.1_5 Forward -131 -112 -2.45882 0.282
NP_440139.1_1 Reverse -348 -367 4.03023 0.193
NP_441572.1_3 Forward -58 -39 7.47261 0.261
NP_441572.1_7 Forward -369 -350 -3.14714 0.207
NP_441572.1_7 Reverse -348 -367 -5.60541 0.265
NP_440267.1_2 Reverse -349 -363 10.3237 0.141
NP_440267.1_2 Forward -161 -147 9.04542 0.162
NP_442384.1_10 Reverse -354 -367 13.589 0.0195
NP_442384.1_10 Forward -363 -350 5.13249 0.137
NP_442384.1_10 Forward -59 -46 5.03416 0.139
NP_442384.1_10 Reverse -201 -214 0.510939 0.289
NP_440364.1_2 Forward -59 -40 15.9797 0.213
NP_442790.1_4 Reverse -345 -364 -14.3569 0.274
NP_442262.1_10 Forward -362 -355 14.1988 0.0123
NP_442262.1_10 Reverse -355 -362 14.1988 0.0123
NP_442262.1_10 Forward -148 -141 10.7572 0.124
NP_441689.1_5 Forward -365 -355 17.8758 0.0158
NP_440163.1_10 Reverse -54 -64 16.303 0.0762
NP_440344.1_10 Reverse -347 -364 -9.59759 0.15
NP_440344.1_10 Forward -87 -70 -10.6792 0.187
NP_440282.1_10 Forward -373 -354 4.12936 0.125
NP_440282.1_10 Forward -379 -360 -8.94866 0.269
NP_440189.1_2 Reverse -206 -225 5.211 0.268
NP_440826.1_5 Reverse -115 -133 13.7372 0.269
NP_441965.1_10 Reverse -351 -367 13.3332 0.103
NP_442529.1_4 Reverse -345 -364 9.93088 0.235
NP_442693.1_7 Reverse -206 -225 7.57094 0.282
NP_442693.1_7 Forward -382 -363 7.07928 0.295
NP_440297.1_9 Forward -362 -352 9.61647 0.0917
NP_440297.1_9 Reverse -355 -365 9.22315 0.0917
NP_442280.1_10 Forward -58 -40 7.98684 0.268
NP_442067.1_4 Reverse -234 -253 3.24438 0.289
NP_440999.1_9 Reverse -350 -364 -0.885388 0.22
NP_440999.1_9 Forward -367 -353 -1.8687 0.252
NP_440888.1_2 Reverse -354 -368 11.2087 0.0729
NP_440888.1_2 Forward -363 -349 6.98048 0.212
NP_440888.1_2 Forward -222 -208 6.78381 0.22
NP_440888.1_2 Forward -156 -142 6.29216 0.241
NP_440888.1_2 Reverse -201 -215 5.30886 0.284
NP_440060.1_1 Forward -268 -249 16.2241 0.212
NP_440491.1_1 Reverse -137 -156 7.50176 0.265
NP_440491.1_1 Reverse -191 -210 6.52718 0.296
NP_439969.1_3 Forward -64 -45 0.196116 0.268
NP_440663.1_1 Forward -77 -58 29.1054 0.000564
NP_440663.1_2 Forward -271 -252 30.3837 0.000335
NP_440663.1_3 Forward -221 -202 33.6286 0.00000445
NP_440663.1_4 Forward -110 -91 33.5303 0.0000155
NP_440663.1_5 Forward -314 -295 31.367 0.00014
NP_440663.1_6 Forward -292 -273 31.2687 0.000121
NP_440663.1_7 Forward -155 -136 28.5154 0.0012
NP_440663.1_8 Forward -131 -112 21.5339 0.0477
NP_440663.1_9 Forward -356 -337 26.6471 0.00369
NP_440663.1_10 Forward -197 -178 23.8939 0.0231
NP_442277.1_4 Reverse -345 -364 0.981987 0.291
NP_442033.1_10 Forward -127 -108 -5.21209 0.179
NP_442033.1_10 Reverse -334 -353 -12.4886 0.271
NP_441543.1_2 Reverse -355 -364 15.9293 0.00518
NP_441543.1_2 Forward -362 -353 9.34117 0.0818
NP_442845.1_2 Forward -369 -355 18.3875 0.0608
NP_441551.1_5 Reverse -350 -366 7.13767 0.249
NP_441178.1_6 Forward -120 -101 5.11187 0.268
NP_441178.1_6 Forward -219 -200 1.76863 0.279
NP_441319.1_5 Forward -124 -105 10.5209 0.25
NP_440982.1_1 Reverse -360 -379 3.73524 0.294
NP_441469.1_8 Reverse -353 -362 13.3727 0.073
NP_441469.1_8 Forward -217 -208 11.2095 0.176
NP_441469.1_8 Forward -364 -355 6.5879 0.227
NP_443064.1_6 Forward -363 -353 13.8273 0.0796
NP_443064.1_6 Reverse -354 -364 10.8217 0.13
NP_442337.1_6 Reverse -70 -89 12.3725 0.3
NP_442578.1_7 Forward -362 -355 14.5921 0.026
NP_442578.1_7 Reverse -355 -362 14.5921 0.026
NP_441462.1_2 Reverse -354 -364 20.2362 0.000805
NP_441462.1_2 Forward -363 -353 20.1379 0.000967
NP_441621.1_7 Reverse -114 -128 5.01447 0.0934
NP_441621.1_7 Reverse -352 -366 2.5562 0.123
NP_441621.1_7 Reverse -49 -63 -3.63866 0.192
NP_441621.1_7 Reverse -46 -60 -4.81863 0.246
NP_443062.1_1 Reverse -354 -372 18.4917 0.0224
NP_443062.1_1 Reverse -140 -158 4.45062 0.26
NP_443062.1_1 Reverse -23 -41 4.2556 0.268
NP_443062.1_1 Reverse -39 -57 3.86557 0.282
NP_443062.1_6 Reverse -346 -365 2.3594 0.256
NP_441601.1_4 Reverse -97 -116 -4.32711 0.293
NP_441601.1_4 Forward -129 -110 -5.31042 0.293
NP_442204.1_1 Forward -367 -356 9.40011 0.0786
NP_442204.1_5 Reverse -47 -66 1.86774 0.225
NP_441560.1_8 Forward -368 -349 15.7004 0.0972
NP_440516.1_2 Reverse -33 -51 3.95239 0.142
NP_440516.1_6 Reverse -366 -380 6.48882 0.293
NP_440516.1_8 Forward -363 -354 16.9127 0.00442
NP_440516.1_8 Reverse -354 -363 16.9127 0.00442
NP_442428.1_5 Forward -362 -355 15.8704 0.0124
NP_442428.1_5 Reverse -355 -362 15.8704 0.0124
NP_442428.1_5 Reverse -202 -209 4.66067 0.244
NP_440818.1_6 Reverse -123 -142 6.68596 0.284
NP_440783.1_5 Reverse -96 -115 -5.99873 0.289
NP_442120.1_10 Reverse -45 -64 -6.09707 0.203
NP_442120.1_10 Reverse -354 -373 -8.45701 0.237
NP_442120.1_10 Reverse -51 -70 -15.3402 0.294
NP_441867.1_2 Reverse -42 -61 8.65258 0.0487
NP_441867.1_2 Reverse -62 -81 -16.5201 0.291
NP_440603.1_9 Forward -155 -136 0.58944 0.284
NP_440673.1_2 Reverse -197 -216 9.60917 0.24
NP_440673.1_2 Forward -385 -366 8.92631 0.26
NP_440673.1_2 Reverse -29 -48 8.24345 0.275
NP_440673.1_3 Forward -361 -354 12.4288 0.0426
NP_440673.1_3 Reverse -356 -363 12.4288 0.0426
NP_440673.1_3 Forward -64 -57 8.8889 0.206
NP_440673.1_3 Forward -58 -51 6.23397 0.283
NP_440865.1_9 Forward -369 -350 0.884433 0.128
NP_441052.1_2 Forward -363 -353 10.4031 0.0285
NP_441052.1_2 Reverse -354 -364 10.4031 0.0285
NP_441052.1_2 Forward -216 -206 4.89658 0.14
NP_441052.1_2 Reverse -191 -201 0.373358 0.259
NP_440992.1_2 Forward -161 -142 16.0274 0.189
NP_442219.1_9 Forward -362 -353 8.25953 0.0681
NP_442219.1_9 Reverse -355 -364 8.25953 0.0681
NP_442219.1_9 Reverse -202 -211 5.11294 0.186
NP_440436.1_4 Forward -362 -353 15.9289 0.00508
NP_440436.1_4 Reverse -355 -364 9.24241 0.0871
NP_440436.1_4 Forward -209 -200 4.52254 0.256
NP_441884.1_9 Forward -228 -209 -21.6334 0.256
NP_441884.1_9 Forward -130 -111 -28.3199 0.294
NP_440314.1_9 Reverse -355 -374 -5.70374 0.225
NP_440314.1_9 Forward -362 -343 -10.4236 0.298
NP_440648.1_1 Reverse -354 -373 4.22769 0.228
NP_440577.1_2 Reverse -195 -214 13.3725 0.219
NP_440041.1_6 Forward -145 -126 11.3067 0.285
NP_441719.1_4 Forward -362 -355 16.3621 0.0124
NP_441719.1_4 Reverse -355 -362 16.3621 0.0124
NP_441733.1_10 Forward -366 -353 4.14919 0.273
NP_441004.1_1 Reverse -45 -64 14.5524 0.0361
NP_441004.1_1 Forward -155 -136 -7.27704 0.197
NP_441004.1_1 Forward -387 -368 -7.96535 0.2
NP_441004.1_1 Reverse -201 -220 -11.8003 0.242
NP_441004.1_2 Reverse -40 -59 14.1591 0.11
NP_441004.1_4 Reverse -48 -58 9.22315 0.259
NP_441004.1_5 Forward -153 -139 13.6676 0.223
NP_442366.1_3 Reverse -353 -371 1.10079 0.158
NP_442206.1_10 Reverse -354 -369 -0.413427 0.292
NP_440328.1_4 Reverse -348 -367 7.17762 0.124
NP_443054.1_2 Forward -365 -351 10.3243 0.0761
NP_442308.1_3 Reverse -198 -217 11.7008 0.252
NP_441851.1_10 Reverse -353 -363 17.4829 0.0027
NP_441851.1_10 Forward -364 -354 8.53483 0.114
NP_441851.1_10 Forward -211 -201 4.60159 0.259
NP_442208.1_5 Forward -56 -37 -4.22878 0.258
NP_442208.1_5 Forward -124 -105 -8.16202 0.275
NP_442622.1_8 Forward -363 -345 0.707465 0.0642
NP_442011.1_1 Reverse -206 -225 5.99764 0.186
NP_441668.1_4 Forward -159 -140 2.0644 0.205
NP_442515.1_1 Forward -364 -350 3.93283 0.11
NP_442515.1_1 Reverse -353 -367 3.93283 0.11
NP_440593.1_3 Reverse -355 -374 1.67108 0.187
NP_440593.1_3 Forward -65 -46 1.57275 0.19
NP_440593.1_3 Forward -221 -202 -3.93378 0.242
NP_440593.1_9 Reverse -104 -118 13.2743 0.24
NP_442709.1_3 Forward -370 -351 10.5209 0.121
NP_441046.1_2 Reverse -147 -166 0.0977854 0.271
NP_441349.1_10 Reverse -344 -363 -1.57384 0.105
NP_441409.1_6 Forward -369 -350 3.34271 0.0491
NP_441409.1_6 Reverse -348 -367 -15.0452 0.275
NP_440432.1_9 Forward -362 -347 7.94471 0.0427
NP_442843.1_1 Reverse -110 -129 -11.4069 0.291
NP_439960.1_6 Forward -162 -143 10.1275 0.22
NP_439960.1_10 Reverse -100 -118 0.0191479 0.216
NP_439960.1_10 Forward -156 -138 -3.91409 0.284
NP_442944.1_9 Reverse -280 -299 16.6174 0.228
NP_440474.1_8 Reverse -355 -369 7.86545 0.196
NP_441477.1_10 Forward -370 -352 1.49411 0.258
NP_442450.1_5 Reverse -352 -362 10.0098 0.115
NP_442450.1_5 Forward -365 -355 9.41981 0.115
NP_442168.1_5 Forward -144 -125 -0.39387 0.264
NP_440588.1_2 Forward -372 -353 8.75091 0.0448
NP_440195.1_4 Forward -215 -196 7.17762 0.26
NP_440195.1_4 Reverse -45 -64 6.88262 0.269
NP_442006.1_3 Reverse -45 -63 -5.78238 0.298
NP_443047.1_7 Forward -362 -343 9.83255 0.188
NP_440483.1_1 Reverse -103 -122 -8.752 0.295
NP_441570.1_1 Reverse -354 -372 -7.35568 0.0887
NP_441570.1_1 Forward -363 -345 -16.1071 0.238
NP_441078.1_4 Forward -363 -354 19.6659 0.0007
NP_441078.1_4 Reverse -354 -363 19.6659 0.0007
NP_441078.1_4 Reverse -201 -210 -1.86856 0.272
NP_440539.1_4 Forward -216 -197 6.29264 0.273
NP_441663.1_8 Reverse -348 -367 1.0811 0.212
NP_442348.1_2 Forward -49 -40 6.68623 0.299
NP_442443.1_1 Forward -236 -217 1.0811 0.21
NP_442443.1_1 Reverse -111 -130 -4.22878 0.268
NP_441091.1_5 Forward -373 -354 5.40766 0.249
NP_441094.1_7 Forward -217 -198 16.9475 0.171
NP_440526.1_3 Forward -362 -351 10.9729 0.0646
NP_441432.1_8 Forward -364 -355 16.8143 0.00595
NP_441432.1_8 Reverse -353 -362 8.35786 0.0755
NP_441732.1_2 Forward -367 -351 -7.90627 0.0983
NP_441732.1_2 Forward -171 -155 -16.9527 0.223
NP_440760.1_1 Reverse -354 -373 -0.295539 0.0279
NP_440760.1_1 Forward -363 -344 -12.2919 0.0927
NP_442797.1_6 Forward -64 -45 17.1451 0.17
NP_442797.1_7 Reverse -139 -157 -0.0791831 0.281
NP_442274.1_8 Forward -67 -49 15.6694 0.235
NP_440578.1_4 Reverse -195 -214 13.9625 0.247
NP_441072.1_2 Reverse -343 -362 9.63589 0.218
NP_441072.1_2 Reverse -282 -301 6.39097 0.28
NP_441072.1_8 Reverse -119 -138 4.32602 0.247
NP_440713.1_4 Reverse -142 -161 2.0644 0.273
NP_442489.1_7 Forward -363 -354 20.1576 0.000695
NP_442489.1_7 Reverse -354 -363 20.1576 0.000695
NP_442489.1_7 Reverse -201 -210 -1.37691 0.195
NP_440757.1_7 Reverse -40 -58 10.2456 0.156
NP_440757.1_7 Forward -65 -47 2.37909 0.269
NP_440559.1_1 Forward -362 -353 17.306 0.00658
NP_440559.1_1 Reverse -355 -364 8.65285 0.0586
NP_441659.2_8 Reverse -354 -364 20.9245 0.000805
NP_441659.2_8 Forward -363 -353 19.3512 0.000966
NP_441659.2_8 Reverse -372 -382 2.7333 0.19
NP_440363.1_9 Forward -68 -50 12.4089 0.281
NP_441040.1_2 Forward -68 -49 1.67108 0.119
NP_441040.1_5 Forward -221 -202 8.55425 0.226
NP_441040.1_5 Reverse -196 -215 5.70265 0.229
NP_439956.1_7 Reverse -195 -214 1.96607 0.276
NP_440708.1_6 Reverse -356 -375 -4.81876 0.232
NP_440442.1_3 Forward -217 -203 15.7325 0.271
NP_441800.1_3 Forward -59 -41 5.72234 0.286
NP_442776.1_1 Forward -374 -355 18.7807 0.0502
NP_440779.1_5 Forward -363 -346 -14.4158 0.246
NP_441185.1_5 Forward -208 -189 10.5209 0.278
NP_442346.1_5 Reverse -353 -363 17.9746 0.00128
NP_442346.1_5 Forward -364 -354 16.303 0.00248
NP_442346.1_5 Forward -211 -201 5.68323 0.234
NP_440545.1_3 Reverse -350 -367 4.56207 0.0691
NP_440545.1_3 Forward -58 -41 3.97208 0.0764
NP_440545.1_3 Reverse -47 -64 -3.40274 0.203
NP_440545.1_3 Forward -64 -47 -4.68105 0.23
NP_440545.1_3 Reverse -203 -220 -4.97604 0.237
NP_440545.1_3 Reverse -112 -129 -5.46769 0.25
NP_440545.1_3 Reverse -362 -379 -6.64766 0.285
NP_441856.1_3 Reverse -351 -370 10.6192 0.101
NP_440831.1_3 Forward -372 -353 9.00822 0.214
NP_440831.1_3 Reverse -109 -128 6.9696 0.268
NP_441629.1_3 Forward -217 -198 -4.22953 0.29
NP_441923.1_6 Reverse -208 -222 7.9644 0.292
NP_440486.1_6 Forward -223 -204 5.99764 0.284
NP_440459.1_2 Reverse -138 -155 20.295 0.0386
NP_440459.1_2 Reverse -198 -215 12.8219 0.135
NP_440459.1_2 Forward -158 -141 11.9369 0.165
NP_440459.1_2 Reverse -48 -65 10.3636 0.2
NP_440459.1_2 Reverse -345 -362 9.57695 0.224
NP_441653.1_2 Reverse -40 -59 13.2896 0.0959
NP_440010.1_3 Reverse -104 -123 -8.26035 0.295
NP_440010.1_4 Forward -70 -51 5.11187 0.208
NP_440010.1_10 Forward -152 -133 2.65439 0.275
NP_442137.1_1 Forward -224 -205 12.8808 0.114
NP_442551.1_4 Forward -62 -47 -3.46169 0.29
NP_441948.1_4 Reverse -347 -365 -1.55415 0.146
NP_441833.1_4 Forward -362 -355 15.9687 0.0124
NP_441833.1_4 Reverse -355 -362 15.9687 0.0124
NP_442699.1_8 Reverse -43 -62 -4.32711 0.238
NP_442162.1_9 Forward -362 -355 16.2637 0.0124
NP_442162.1_9 Reverse -355 -362 16.2637 0.0124
NP_440671.1_4 Forward -369 -355 11.7993 0.125
NP_440671.1_4 Reverse -51 -65 7.17775 0.226
NP_440671.1_4 Reverse -348 -362 5.1128 0.292
NP_440772.1_6 Forward -164 -145 11.1109 0.212
NP_442045.1_5 Forward -219 -200 -1.96717 0.292
NP_442199.1_5 Forward -56 -37 -1.7705 0.181
NP_442199.1_5 Reverse -144 -163 -4.22878 0.221
NP_442140.1_3 Forward -362 -352 11.5831 0.0743
NP_442140.1_3 Forward -148 -138 6.96153 0.156
NP_442140.1_3 Reverse -208 -218 3.61828 0.288
NP_442723.1_1 Forward -126 -107 3.04693 0.28
NP_442021.1_6 Forward -317 -298 7.17762 0.262
NP_441696.1_6 Reverse -355 -374 1.0811 0.294
NP_440875.1_9 Reverse -356 -366 8.27469 0.233
NP_440875.1_9 Forward -361 -351 7.59334 0.255
NP_442547.1_7 Reverse -41 -60 15.8678 0.146
NP_441813.1_5 Reverse -352 -362 18.3679 0.00743
NP_441813.1_5 Forward -365 -355 15.9097 0.01
NP_441813.1_7 Reverse -137 -151 11.897 0.215
NP_442254.1_1 Reverse -195 -214 -1.7705 0.282
NP_440590.1_4 Forward -362 -349 4.8375 0.0585
NP_440590.1_4 Reverse -51 -64 -0.767364 0.2
NP_440590.1_4 Reverse -141 -154 -2.24233 0.239
NP_440567.1_1 Reverse -355 -369 12.8809 0.0215
NP_440567.1_1 Reverse -202 -216 4.42448 0.121
NP_442497.1_10 Forward -362 -353 19.8626 0.00532
NP_442497.1_10 Reverse -355 -364 17.601 0.00813
NP_440821.1_4 Forward -365 -355 11.0914 0.0146
NP_440821.1_4 Reverse -352 -362 10.9931 0.0146
NP_441239.1_9 Forward -365 -353 15.6736 0.0186
NP_441239.1_9 Reverse -352 -364 12.6253 0.0446
NP_441239.1_9 Reverse -37 -49 5.54551 0.217
NP_441239.1_9 Forward -119 -107 4.26721 0.256
NP_441239.1_9 Forward -50 -38 3.67722 0.279
NP_441239.1_9 Forward -218 -206 3.18557 0.292
NP_441009.1_4 Reverse -354 -373 10.8159 0.26
NP_441727.1_3 Forward -67 -48 8.06259 0.213
NP_441892.1_1 Reverse -345 -362 3.57876 0.123
NP_441892.1_1 Forward -219 -202 -4.87771 0.269
NP_441892.1_1 Reverse -198 -215 -5.1727 0.275
NP_440604.1_6 Reverse -354 -373 -1.7705 0.206
NP_442270.1_9 Reverse -196 -215 -6.39206 0.207
NP_442643.1_5 Reverse -143 -162 -0.4922 0.257
NP_441526.1_6 Reverse -54 -73 13.5691 0.219
NP_440354.1_5 Reverse -216 -235 4.22769 0.217
NP_442138.1_10 Forward -363 -344 -5.9004 0.274
NP_442052.1_7 Reverse -203 -217 11.8976 0.281
NP_442052.1_8 Reverse -49 -59 13.5497 0.253
NP_441782.1_10 Forward -163 -149 14.4922 0.296
NP_440546.1_4 Reverse -354 -364 13.5365 0.0459
NP_440546.1_4 Forward -363 -353 12.8578 0.0572
NP_441230.1_5 Reverse -349 -368 12.2908 0.0748
NP_440462.1_6 Forward -365 -355 16.893 0.00853
NP_440462.1_6 Reverse -352 -362 9.7148 0.0429
NP_442592.1_3 Forward -68 -49 9.43923 0.262
NP_440868.1_4 Forward -367 -355 15.1819 0.0164
NP_440868.1_4 Reverse -136 -148 6.92215 0.0822
NP_440868.1_4 Reverse -350 -362 1.12062 0.192
NP_442499.1_3 Forward -126 -108 5.42735 0.282
NP_442402.1_4 Forward -152 -133 -3.24622 0.213
NP_442402.1_4 Forward -196 -177 -9.04772 0.285
NP_441848.1_4 Forward -400 -384 8.50558 0.288
NP_441084.1_6 Reverse -42 -56 10.1198 0.254
NP_440653.1_10 Forward -155 -136 4.32602 0.252
NP_440696.1_3 Reverse -197 -215 2.37909 0.216
NP_442039.1_4 Forward -362 -355 15.1821 0.0124
NP_442039.1_4 Reverse -355 -362 15.1821 0.0124
NP_442039.1_7 Forward -46 -36 7.15819 0.279
NP_441811.1_1 Forward -126 -107 4.42435 0.285
NP_442409.1_10 Forward -63 -49 16.1252 0.266
NP_441926.1_3 Forward -363 -347 7.2367 0.17
NP_441926.1_3 Reverse -354 -370 6.9417 0.17
NP_442837.1_3 Forward -362 -355 15.7721 0.0124
NP_442837.1_3 Reverse -355 -362 15.7721 0.0124
NP_440160.1_2 Reverse -38 -57 -1.18052 0.235
NP_440160.1_2 Forward -162 -143 -7.4737 0.286
NP_440160.1_2 Reverse -39 -58 -9.24366 0.293
NP_440160.1_7 Reverse -97 -116 10.6192 0.297
NP_442053.1_1 Forward -363 -354 18.3876 0.0007
NP_442053.1_1 Reverse -354 -363 18.3876 0.0007
NP_440505.1_3 Forward -365 -355 15.123 0.014
NP_440505.1_3 Reverse -352 -362 9.61647 0.122
NP_440505.1_7 Forward -52 -33 -2.36049 0.289
NP_440914.1_1 Reverse -354 -364 16.3248 0.00196
NP_440914.1_1 Forward -363 -353 8.51751 0.186
NP_441011.1_8 Reverse -355 -364 16.6177 0.00602
NP_441011.1_8 Forward -362 -353 14.356 0.0249
NP_441011.1_8 Forward -209 -200 5.01461 0.289
NP_442101.1_10 Forward -371 -352 -7.96535 0.224
NP_442533.1_6 Forward -363 -354 17.2076 0.00137
NP_442533.1_6 Reverse -354 -363 17.2076 0.00137
NP_442533.1_6 Forward -210 -201 6.19458 0.115
NP_442533.1_6 Forward -216 -207 4.0313 0.194
NP_442533.1_6 Forward -59 -50 3.24465 0.219
NP_442533.1_6 Reverse -45 -54 1.86802 0.284
NP_442229.1_1 Forward -212 -198 8.06211 0.185
NP_442229.1_1 Forward -383 -369 6.39049 0.226
NP_441482.1_7 Forward -369 -355 7.86607 0.0233
NP_441482.1_7 Reverse -348 -362 -10.2268 0.209
NP_439944.1_9 Reverse -355 -365 17.6796 0.00347
NP_439944.1_9 Reverse -202 -212 14.238 0.0423
NP_439944.1_9 Forward -362 -352 8.82982 0.101
NP_440116.1_5 Reverse -155 -172 4.85706 0.178
NP_440116.1_8 Forward -362 -343 -3.83545 0.158
NP_440115.1_6 Forward -366 -356 7.45319 0.147
NP_440115.1_6 Reverse -351 -361 7.15819 0.158
NP_440115.1_6 Reverse -48 -58 4.79825 0.282
NP_440007.1_9 Forward -159 -145 7.07942 0.213
NP_440007.1_9 Reverse -350 -364 2.2612 0.281
NP_440007.1_9 Forward -367 -353 0.491246 0.297
NP_441347.1_5 Forward -369 -355 8.06211 0.298
NP_441972.1_5 Reverse -202 -221 2.45773 0.121
NP_441106.1_1 Forward -364 -355 18.486 0.0028
NP_441106.1_1 Reverse -353 -362 9.73449 0.0311
NP_441106.1_1 Reverse -200 -209 4.62128 0.213
NP_441106.1_1 Reverse -56 -65 2.458 0.283
NP_439903.1_6 Reverse -351 -370 11.5033 0.095
NP_439903.1_6 Forward -366 -347 0.195343 0.268
NP_442588.1_8 Forward -335 -316 4.916 0.289
NP_442306.1_10 Forward -151 -132 -20.945 0.237
NP_442306.1_10 Forward -368 -349 -21.1417 0.247
NP_441286.1_1 Forward -364 -352 6.03717 0.0258
NP_441286.1_1 Reverse -353 -365 4.95553 0.027
NP_442674.1_1 Reverse -149 -168 11.5322 0.251
NP_440670.1_8 Forward -363 -354 18.3876 0.000699
NP_440670.1_8 Reverse -354 -363 18.3876 0.000699
NP_440886.1_7 Forward -364 -354 8.04271 0.0805
NP_440886.1_7 Reverse -353 -363 8.04271 0.0805
NP_440828.1_1 Forward -154 -135 1.57197 0.249
NP_440828.1_4 Forward -67 -48 -4.1312 0.246
NP_442614.1_2 Reverse -354 -368 9.2427 0.242
NP_442614.1_2 Forward -363 -349 6.88276 0.28
NP_441399.1_6 Forward -110 -91 13.6666 0.185
NP_442072.1_9 Reverse -353 -371 -11.7806 0.0798
NP_442072.1_9 Forward -364 -346 -20.827 0.204
NP_441403.1_4 Reverse -204 -222 9.55725 0.282
NP_440028.1_6 Reverse -40 -58 9.95058 0.294
NP_440907.2_8 Forward -362 -352 9.91099 0.103
NP_440907.2_8 Reverse -355 -365 9.51767 0.103
NP_442264.1_5 Reverse -354 -368 12.291 0.253
NP_441021.1_1 Forward -59 -40 9.93088 0.0375
NP_441021.1_1 Reverse -141 -160 -9.93197 0.224
NP_441463.1_3 Forward -70 -51 -5.11376 0.22
NP_441626.1_2 Forward -362 -355 15.7721 0.0124
NP_441626.1_2 Reverse -355 -362 15.7721 0.0124
NP_442794.1_1 Forward -153 -141 4.8572 0.244
NP_442615.1_1 Reverse -192 -210 4.83737 0.0426
NP_442615.1_1 Reverse -345 -363 -5.48739 0.215
NP_441962.1_4 Reverse -46 -65 10.4225 0.0495
NP_441962.1_4 Reverse -113 -132 -13.1769 0.271
NP_440387.1_1 Reverse -354 -370 21.6913 0.00219
NP_440387.1_1 Reverse -158 -174 -5.34967 0.227
NP_440855.1_5 Forward -224 -205 3.34192 0.287
NP_441431.1_2 Forward -213 -199 8.75042 0.207
NP_441431.1_2 Reverse -351 -365 6.58715 0.266
NP_441431.1_2 Reverse -137 -151 5.50552 0.298
NP_441431.1_2 Forward -51 -37 5.50552 0.298
NP_441836.1_2 Forward -152 -133 0.294447 0.203
NP_441836.1_2 Reverse -134 -153 -4.22878 0.255
NP_440634.1_1 Forward -212 -193 13.6675 0.26
NP_441993.1_1 Reverse -45 -64 5.45515 0.201
NP_441993.1_1 Reverse -354 -373 5.16278 0.207
NP_441993.1_1 Forward -369 -350 4.38312 0.221
NP_441993.1_1 Forward -66 -47 3.21363 0.239
NP_441993.1_1 Reverse -201 -220 1.36194 0.28
NP_442224.1_1 Reverse -199 -218 -2.65548 0.233
NP_440814.1_4 Reverse -345 -364 -9.53865 0.221
NP_440114.1_10 Forward -363 -349 16.1259 0.02
NP_440114.1_10 Reverse -354 -368 11.6026 0.107
NP_441510.2_2 Forward -129 -110 7.66846 0.213
NP_440293.1_3 Reverse -43 -62 -0.590531 0.232
NP_440293.1_9 Forward -59 -45 10.1846 0.282
NP_440766.1_4 Forward -367 -353 4.12949 0.135
NP_440766.1_5 Forward -396 -384 8.61071 0.277
NP_442743.1_5 Reverse -202 -221 5.01433 0.209
NP_442635.1_2 Reverse -142 -161 22.9097 0.033
NP_439910.1_2 Reverse -346 -363 -12.0559 0.0788
NP_440457.1_1 Reverse -350 -362 9.18376 0.0949
NP_440457.1_1 Forward -367 -355 1.31728 0.241
NP_440457.1_1 Reverse -46 -58 0.432302 0.25
NP_441801.1_6 Forward -163 -144 12.4867 0.159
NP_441984.1_3 Forward -122 -104 7.78729 0.239
NP_441332.1_6 Forward -217 -207 10.7754 0.287
NP_440473.1_9 Reverse -343 -362 -7.96535 0.241
NP_442509.1_4 Forward -216 -197 15.8307 0.237
NP_442509.1_9 Forward -363 -353 17.3841 0.00128
NP_442509.1_9 Reverse -354 -364 8.04271 0.192
NP_441496.1_1 Forward -271 -257 14.7174 0.265
NP_440524.1_2 Forward -64 -45 2.45773 0.236
NP_440554.1_4 Reverse -355 -365 16.1063 0.0189
NP_440554.1_4 Forward -362 -352 8.82982 0.0646
NP_441845.1_6 Reverse -342 -360 7.00065 0.165
NP_441885.1_5 Forward -363 -353 11.3864 0.00668
NP_441885.1_5 Reverse -354 -364 11.3864 0.00668
NP_440478.1_4 Reverse -47 -66 10.0292 0.293
NP_440478.1_10 Forward -218 -204 10.0294 0.208
NP_442341.1_3 Reverse -40 -59 3.34271 0.236
NP_442341.1_5 Reverse -133 -152 10.9142 0.297
NP_442341.1_7 Reverse -139 -153 5.50613 0.154
NP_442341.1_7 Reverse -353 -367 2.5562 0.252
NP_442341.1_7 Reverse -49 -63 2.35953 0.259
NP_442341.1_9 Reverse -352 -366 10.2254 0.136
NP_442341.1_9 Forward -365 -351 8.84875 0.164
NP_442341.1_9 Reverse -210 -224 6.39049 0.228
NP_441756.1_5 Forward -120 -101 -2.45882 0.277
NP_440423.1_6 Reverse -346 -365 -12.3902 0.195
NP_440423.1_6 Forward -371 -352 -16.1268 0.231
NP_443000.1_7 Forward -365 -355 17.4829 0.00719
NP_443000.1_7 Reverse -352 -362 11.6814 0.0344
NP_440507.2_3 Forward -69 -50 8.94676 0.237
NP_440507.2_3 Forward -75 -56 8.25844 0.257
NP_440275.1_3 Reverse -352 -362 16.9913 0.0133
NP_440275.1_3 Forward -365 -355 9.12481 0.055
NP_440275.1_3 Forward -383 -373 5.19158 0.161
NP_440091.1_1 Reverse -350 -362 1.41561 0.197
NP_442275.1_1 Reverse -137 -156 1.47442 0.284
NP_442275.1_1 Reverse -40 -59 1.0811 0.284
NP_440679.1_10 Reverse -56 -75 -13.3736 0.222
NP_440679.1_10 Reverse -356 -375 -16.1268 0.251
NP_440679.1_10 Reverse -112 -131 -20.5517 0.286
NP_443010.1_10 Forward -366 -349 4.41357 0.23
NP_442451.1_2 Forward -371 -352 -9.73531 0.259
NP_439962.1_4 Forward -59 -40 -6.39206 0.283
NP_440175.1_4 Forward -371 -352 -14.4552 0.277
NP_442495.1_5 Reverse -40 -59 5.40766 0.291
NP_440149.1_8 Reverse -201 -220 4.62101 0.0809
NP_440149.1_8 Forward -216 -197 0.884433 0.132
NP_440149.1_8 Reverse -354 -373 -0.983855 0.154
NP_441105.1_3 Reverse -343 -362 0.392778 0.125
NP_441105.1_3 Forward -221 -202 -2.85214 0.169
NP_441105.1_3 Reverse -66 -85 -5.01543 0.211
NP_441105.1_3 Forward -71 -52 -5.99873 0.227
NP_440216.1_1 Forward -363 -349 16.2242 0.00307
NP_440216.1_1 Reverse -354 -368 -2.55701 0.0521
NP_440172.1_1 Reverse -354 -364 17.5813 0.00421
NP_440172.1_1 Forward -363 -353 16.303 0.00854
NP_440172.1_1 Reverse -147 -157 4.40493 0.189
NP_442015.1_10 Reverse -350 -363 3.75586 0.178
NP_442015.1_10 Forward -367 -354 1.39592 0.204
NP_441226.1_7 Forward -362 -355 14.4934 0.0123
NP_441226.1_7 Reverse -355 -362 14.4934 0.0123
NP_441226.1_7 Forward -209 -202 11.2485 0.0971
NP_441111.1_7 Forward -362 -354 18.7023 0.00294
NP_441111.1_7 Reverse -355 -363 18.7023 0.00294
NP_441111.1_7 Reverse -202 -210 -0.570565 0.233
NP_442379.1_10 Forward -370 -353 16.9518 0.025
NP_441766.1_2 Forward -363 -354 17.5026 0.00297
NP_441766.1_2 Reverse -354 -363 17.5026 0.00297
NP_440416.1_9 Forward -217 -198 -10.4236 0.141
NP_440416.1_9 Forward -370 -351 -12.1936 0.155
NP_440416.1_9 Forward -336 -317 -18.5851 0.26
NP_440416.1_9 Forward -66 -47 -19.0768 0.269
NP_440416.1_9 Reverse -359 -378 -19.1751 0.27
NP_440416.1_9 Reverse -94 -113 -19.6667 0.276
NP_440416.1_9 Reverse -358 -377 -20.3551 0.284
NP_443052.1_8 Reverse -106 -125 -11.1119 0.223
NP_442403.1_9 Reverse -360 -379 2.45773 0.285
NP_440261.1_5 Forward -362 -349 5.13249 0.0476
NP_440261.1_5 Reverse -355 -368 -1.16069 0.0662
NP_440261.1_5 Reverse -202 -215 -12.1738 0.272
NP_440988.1_10 Forward -62 -48 9.2554 0.205
NP_440988.1_10 Reverse -49 -63 4.7052 0.253
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCAGTATGACAAAACTTGATACGACGGCCGAGGTCAAGGCGATCGCCCGTTACGTGCGGATGTCTCCCCTTAAGGTGCGCCGGGTACTAGATCAAATTCGGGGTCGTTCCTACCGGGAAGCTCTGATCATTCTGGAATTTATGCCTTACAAAGCCTGTGAGCCGGTGCTGAAAGTACTGCGCTCCGCCGTGGCCAACGCTGAGCATAACGAAGGTTTGGAACCAGCGGACCTAGTTGTTAGCCAAGCCTTTGCCGATGGAGGCCCCAGCTTGCGCCGTTTTCGCCCCCGGGCCCAGGGTCGTGCCTACCAGATTCGCAAGCCCACTTGCCACATTACCGTCGCCGTTGCCCCGGCCTTGGCAGATAACTAACATCGCTGTTCACGTCACGCATACAAAAC

CDS

ATGGGACAAAAAATACATCCAGTTGGCTTCCGCCTCGGCATCACTAAGGACCACAAATCCTGTTGGTATGCCGACCCCAAGCGCTATCCGGAGCTTTTACAGGAAGACCACAAAATTCGCCAATATATTGAGAAAACCCTCAACAATGCCGGTATTTCCGATATCCGCATTGAGCGTAAAGCTGAACAGATTGAGTTGGGTATTCACACCGCTCGCCCCGGGGTAGTTGTCGGTCGAGGCGGCTCTGGTATTGAACAACTACGGGAAGGCTTGCAAAAACTGCTGGGTTCAGCCCGTCAGATTCGAGTCAATGTCATCGAAGTCCCCAATGCTGATGCGGATGCGGCTCTAATGGCCGAGTACATCGGTCAACAGTTAGAACGTCGGGTTTCCTTCCGCCGGGTGGTGCGCCAAGCATTGCAAAGGGCAGAAAGGGCCGAAGTTAAGGGTATCAAAATACAAGTTAGCGGTCGCCTAAATGGGGCAGAAATTGCCCGGACGGAATGGGTTCGGGAAGGCCGGGTGCCTCTCCATACCCTGCGGGCAGACATTGATTATGCCTACCGCACCGCCCTGACCACCTACGGCATTTTAGGGATTAAGGTCTGGATTTTTAAAGGGGAAGTCATCCCTGGCCAGGAAGCCGCCATCGTTGCTCCCCCCAGCCAACCCCGTCGCAAATCCCGTCGGCAACAGTTCGATGACCGTTCCCAGGACGGTTAA

Protein

MGQKIHPVGFRLGITKDHKSCWYADPKRYPELLQEDHKIRQYIEKTLNNAGISDIRIERKAEQIELGIHTARPGVVVGRGGSGIEQLREGLQKLLGSARQIRVNVIEVPNADADAALMAEYIGQQLERRVSFRRVVRQALQRAERAEVKGIKIQVSGRLNGAEIARTEWVREGRVPLHTLRADIDYAYRTALTTYGILGIKVWIFKGEVIPGQEAAIVAPPSQPRRKSRRQQFDDRSQDG