Your browser is old and dusty. Try Google Chrome!

Details for sll1802

ORF sll1802
Accession NP_440666.1
Symbol rpl2
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L2
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -395 -381 13.1759 0.0417
NP_440795.1_7 Reverse -388 -395 10.2655 0.154
NP_441418.1_6 Forward -215 -196 -11.6036 0.0538
NP_441418.1_6 Reverse -206 -225 -22.8133 0.186
NP_441418.1_6 Reverse -375 -394 -28.2215 0.203
NP_441418.1_6 Forward -227 -208 -29.5982 0.23
NP_441418.1_6 Forward -396 -377 -30.1882 0.262
NP_442291.1_5 Forward -216 -200 1.5335 0.144
NP_440897.1_6 Forward -390 -371 3.24359 0.149
NP_441453.1_4 Forward -215 -207 6.80426 0.121
NP_441453.1_4 Forward -396 -388 4.05099 0.268
NP_442151.1_6 Forward -396 -382 5.89945 0.256
NP_442838.1_7 Forward -220 -201 -2.0655 0.166
NP_440226.1_1 Reverse -206 -225 6.58763 0.125
NP_440226.1_1 Forward -215 -196 6.09597 0.137
NP_442173.1_1 Reverse -207 -215 5.72262 0.203
NP_442173.1_1 Forward -214 -206 4.54265 0.27
NP_442752.1_4 Forward -215 -208 13.8055 0.0199
NP_443027.1_4 Forward -217 -207 10.1081 0.144
NP_441812.1_3 Reverse -267 -281 13.2743 0.167
NP_441812.1_3 Forward -216 -202 7.17775 0.286
NP_440784.1_7 Forward -214 -207 6.23397 0.241
NP_440784.1_7 Reverse -207 -214 6.13563 0.241
NP_439979.1_2 Reverse -375 -394 8.25926 0.258
NP_442062.1_8 Forward -215 -205 14.533 0.0128
NP_442062.1_8 Forward -396 -386 4.50326 0.212
NP_441859.1_3 Forward -228 -209 6.78348 0.171
NP_441859.1_3 Forward -216 -197 5.99684 0.185
NP_441859.1_3 Forward -309 -290 5.30853 0.204
NP_440304.1_4 Reverse -379 -389 5.68323 0.196
NP_442242.1_4 Reverse -207 -214 10.8555 0.127
NP_441781.1_7 Reverse -73 -92 0.491109 0.242
NP_441594.1_6 Reverse -378 -397 3.6377 0.226
NP_441594.1_6 Forward -399 -380 2.26107 0.254
NP_440132.1_1 Forward -217 -199 8.27895 0.277
NP_442110.1_7 Forward -396 -382 6.6861 0.136
NP_441083.1_3 Reverse -386 -396 15.2208 0.138
NP_441083.1_5 Reverse -387 -397 1.16001 0.215
NP_441083.1_5 Forward -396 -386 0.963343 0.218
NP_441083.1_5 Forward -215 -205 0.0783647 0.245
NP_441738.1_2 Reverse -208 -215 15.28 0.0102
NP_441558.1_5 Forward -398 -379 10.8159 0.0912
NP_440209.1_1 Forward -215 -207 8.57422 0.0425
NP_440209.1_1 Reverse -206 -214 5.23096 0.145
NP_442889.1_8 Forward -218 -204 9.83206 0.0943
NP_441713.1_5 Reverse -377 -396 6.4893 0.265
NP_440178.1_5 Reverse -212 -221 18.3876 0.137
NP_441025.1_5 Forward -389 -375 19.0758 0.179
NP_441716.1_1 Forward -104 -90 4.42448 0.256
NP_441327.1_5 Forward -182 -173 13.9627 0.261
NP_441598.1_1 Forward -170 -151 7.47261 0.295
NP_441163.1_1 Forward -397 -380 5.24966 0.277
NP_440906.1_5 Forward -214 -207 6.23397 0.234
NP_440906.1_5 Reverse -207 -214 6.13563 0.241
NP_440747.1_10 Reverse -384 -396 -11.6624 0.131
NP_440747.1_10 Forward -399 -387 -11.9574 0.178
NP_441130.1_10 Forward -105 -91 7.27608 0.164
NP_441486.1_1 Forward -218 -204 -5.70361 0.254
NP_440403.1_10 Reverse -92 -111 0.982764 0.293
NP_441014.1_10 Reverse -217 -236 -2.06626 0.27
NP_442848.1_1 Reverse -381 -395 -4.52363 0.294
NP_442848.1_5 Forward -397 -379 6.90232 0.232
NP_442848.1_5 Forward -297 -279 -2.73412 0.286
NP_441012.1_4 Forward -394 -381 5.62415 0.291
NP_443018.1_3 Forward -214 -207 12.6255 0.0471
NP_443018.1_3 Reverse -207 -214 5.25066 0.214
NP_443018.1_3 Reverse -388 -395 4.36568 0.254
NP_443018.1_3 Forward -395 -388 4.07068 0.299
NP_441634.1_8 Reverse -204 -218 0.88457 0.215
NP_441634.1_8 Reverse -385 -399 -3.54032 0.295
NP_440376.1_1 Forward -396 -387 7.37455 0.0786
NP_440376.1_1 Reverse -387 -396 7.07956 0.0869
NP_440376.1_1 Forward -82 -73 3.04799 0.21
NP_440376.1_1 Forward -333 -324 0.589713 0.267
NP_440376.1_1 Forward -215 -206 0.0980582 0.285
NP_440376.1_1 Reverse -206 -215 -0.196935 0.285
NP_441588.1_4 Reverse -208 -218 6.96153 0.178
NP_442687.1_7 Forward -397 -387 5.09324 0.221
NP_442485.1_3 Forward -395 -376 -4.81876 0.285
NP_440667.1_3 Forward -374 -356 33.3533 0.00000613
NP_441950.1_7 Reverse -375 -394 -9.24366 0.293
NP_442296.1_9 Forward -383 -364 0.786102 0.197
NP_442658.1_1 Forward -217 -207 9.02601 0.169
NP_440141.1_4 Reverse -378 -397 -12.0953 0.298
NP_442782.1_2 Reverse -381 -395 6.19444 0.229
NP_442782.1_2 Reverse -60 -74 2.5562 0.275
NP_441487.1_9 Forward -80 -61 0.294447 0.235
NP_441487.1_9 Reverse -62 -81 -3.04881 0.298
NP_441958.1_5 Reverse -205 -215 0.865012 0.12
NP_441958.1_5 Forward -216 -206 -6.31315 0.28
NP_441958.1_5 Reverse -386 -396 -6.90313 0.293
NP_442911.1_2 Reverse -196 -215 -9.24366 0.252
NP_442911.1_2 Forward -225 -206 -10.817 0.289
NP_440153.1_5 Forward -342 -328 4.12949 0.199
NP_440153.1_8 Forward -396 -383 6.60746 0.17
NP_443055.1_6 Forward -244 -226 1.88669 0.224
NP_443055.1_6 Reverse -198 -216 0.411736 0.243
NP_441099.1_5 Forward -388 -369 -10.817 0.262
NP_441099.1_5 Reverse -377 -396 -11.8986 0.291
NP_442002.1_9 Forward -216 -209 10.7572 0.185
NP_441294.1_7 Forward -219 -205 9.15464 0.256
NP_441646.1_1 Reverse -380 -399 -1.47551 0.287
NP_442438.1_10 Reverse -382 -396 11.111 0.0463
NP_441000.1_6 Reverse -205 -219 5.40779 0.0933
NP_440147.1_4 Forward -398 -385 -0.275709 0.279
NP_441916.1_7 Reverse -206 -216 6.96153 0.0784
NP_441916.1_10 Reverse -379 -398 10.4225 0.148
NP_440206.1_4 Forward -394 -375 2.9486 0.284
NP_440465.1_7 Forward -103 -85 10.8348 0.262
NP_441041.1_4 Reverse -375 -394 -6.78538 0.174
NP_441041.1_4 Reverse -381 -400 -7.86702 0.194
NP_441568.1_7 Reverse -77 -96 13.2741 0.155
NP_441725.1_5 Forward -214 -204 10.0098 0.0381
NP_441725.1_5 Forward -389 -379 7.35486 0.101
NP_441725.1_5 Reverse -207 -217 -0.806614 0.271
NP_439966.1_7 Forward -217 -207 7.74772 0.15
NP_439966.1_7 Reverse -204 -214 4.30615 0.279
NP_439966.1_9 Forward -217 -208 10.7178 0.0863
NP_440674.1_7 Forward -106 -87 10.9134 0.276
NP_440289.1_2 Forward -218 -205 3.5592 0.0767
NP_440289.1_2 Reverse -203 -216 -2.93064 0.262
NP_440983.1_5 Forward -396 -377 -7.08038 0.284
NP_440260.1_8 Reverse -378 -396 -6.56903 0.293
NP_442281.1_1 Forward -220 -206 12.6836 0.035
NP_442281.1_1 Reverse -201 -215 3.53891 0.228
NP_442575.1_8 Forward -308 -289 -3.44213 0.251
NP_440437.1_1 Reverse -200 -219 5.211 0.0887
NP_442012.1_5 Reverse -380 -399 0.294447 0.288
NP_442012.1_5 Reverse -374 -393 -0.787193 0.288
NP_441457.1_7 Reverse -90 -109 1.0811 0.276
NP_440723.1_8 Reverse -380 -394 13.2743 0.178
NP_441556.1_4 Forward -227 -208 9.90869 0.292
NP_443030.1_4 Forward -396 -377 -6.09707 0.272
NP_441644.1_6 Reverse -387 -397 13.0576 0.0244
NP_441644.1_6 Forward -396 -386 6.0761 0.167
NP_441644.1_6 Forward -104 -94 4.69947 0.228
NP_441644.1_6 Forward -215 -205 3.61784 0.272
NP_443049.1_6 Forward -216 -206 11.0554 0.282
NP_442215.1_2 Forward -398 -382 1.92682 0.125
NP_442177.1_5 Reverse -378 -392 7.86607 0.291
NP_440253.1_2 Reverse -206 -224 6.80398 0.0772
NP_440929.1_8 Reverse -206 -215 7.76787 0.0533
NP_440929.1_8 Forward -215 -206 7.66954 0.0624
NP_442933.1_5 Reverse -144 -163 19.2723 0.0806
NP_442933.1_5 Reverse -80 -99 8.94757 0.289
NP_442933.1_10 Reverse -206 -215 6.48957 0.119
NP_442933.1_10 Reverse -387 -396 5.11294 0.204
NP_441751.2_8 Reverse -207 -221 -6.19526 0.255
NP_441751.2_8 Forward -395 -381 -6.68692 0.277
NP_442926.1_1 Reverse -375 -394 -5.21209 0.278
NP_442926.1_3 Forward -307 -288 6.09597 0.209
NP_442554.1_8 Reverse -388 -398 7.55152 0.0893
NP_442554.1_8 Forward -395 -385 7.45319 0.092
NP_442554.1_8 Reverse -207 -217 6.17489 0.125
NP_442554.1_8 Forward -214 -204 2.04498 0.285
NP_441762.1_7 Reverse -205 -217 3.67722 0.0676
NP_442292.1_1 Forward -395 -386 5.99792 0.125
NP_442292.1_1 Reverse -207 -216 -0.196935 0.239
NP_442292.1_1 Reverse -388 -397 -0.68859 0.268
NP_442292.1_1 Forward -214 -205 -0.786921 0.287
NP_442292.1_5 Reverse -376 -395 -1.47551 0.265
NP_441525.1_1 Reverse -91 -104 14.8673 0.21
NP_442381.1_8 Forward -218 -199 -12.0953 0.266
NP_441448.1_2 Forward -394 -375 11.405 0.0815
NP_440379.1_5 Forward -393 -374 -11.5053 0.297
NP_441468.1_1 Forward -214 -207 6.13563 0.209
NP_441468.1_1 Reverse -207 -214 6.0373 0.223
NP_441468.1_1 Reverse -388 -395 4.46401 0.224
NP_441020.2_6 Forward -217 -200 17.2468 0.0206
NP_441673.1_1 Reverse -387 -396 1.67135 0.0404
NP_441673.1_1 Forward -396 -387 1.47469 0.0936
NP_441673.1_1 Forward -215 -206 1.37636 0.114
NP_441673.1_1 Reverse -206 -215 1.1797 0.163
NP_441826.1_2 Forward -396 -382 -0.688726 0.22
NP_441826.1_2 Reverse -381 -395 -3.147 0.283
NP_441637.1_8 Forward -108 -91 14.1985 0.197
NP_442490.1_9 Forward -227 -208 -6.88371 0.275
NP_442868.1_6 Forward -398 -388 8.4365 0.057
NP_442719.1_2 Reverse -170 -188 -11.5846 0.292
NP_442427.1_8 Forward -317 -298 11.4058 0.152
NP_441944.1_3 Forward -225 -206 11.7008 0.264
NP_442808.1_1 Reverse -135 -145 1.06124 0.296
NP_442113.1_10 Reverse -202 -221 -4.52377 0.225
NP_442050.1_5 Reverse -204 -214 11.1893 0.105
NP_440558.1_2 Forward -399 -380 -1.67217 0.217
NP_440558.1_2 Forward -393 -374 -3.73712 0.238
NP_441518.1_3 Forward -225 -206 4.03102 0.05
NP_441878.1_6 Reverse -386 -396 2.53664 0.0363
NP_441878.1_6 Reverse -205 -215 0.57002 0.14
NP_441878.1_6 Forward -397 -387 -0.118297 0.167
NP_441878.1_6 Reverse -380 -390 -6.50981 0.191
NP_441878.1_6 Forward -105 -95 -7.68978 0.255
NP_441036.1_8 Forward -216 -206 7.05986 0.21
NP_441557.1_5 Reverse -206 -215 7.57121 0.049
NP_441557.1_5 Forward -215 -206 1.08137 0.0794
NP_441557.1_5 Reverse -387 -396 0.786375 0.106
NP_441557.1_5 Forward -396 -387 0.589713 0.134
NP_442066.2_9 Forward -400 -387 8.86907 0.185
NP_441433.1_8 Forward -389 -370 12.8808 0.147
NP_442183.1_1 Forward -215 -201 15.0442 0.0248
NP_442183.1_6 Reverse -84 -103 18.7798 0.188
NP_441574.1_1 Forward -227 -208 -4.32711 0.252
NP_442170.1_5 Forward -215 -196 -1.86883 0.254
NP_442347.1_2 Reverse -207 -216 10.9145 0.0571
NP_442347.1_2 Reverse -120 -129 3.83464 0.284
NP_440547.1_1 Reverse -174 -193 9.7334 0.237
NP_441037.1_4 Forward -217 -207 7.22024 0.237
NP_441633.1_3 Reverse -204 -217 -4.11062 0.181
NP_441633.1_3 Reverse -322 -335 -7.06055 0.288
NP_440136.1_2 Forward -214 -207 6.23397 0.171
NP_440136.1_2 Reverse -207 -214 6.13563 0.193
NP_442468.1_8 Reverse -141 -160 19.174 0.111
NP_442998.1_10 Reverse -208 -215 15.5754 0.0102
NP_440899.1_1 Forward -156 -137 9.48095 0.212
NP_440299.1_1 Forward -400 -387 7.78685 0.105
NP_441007.1_10 Reverse -382 -395 10.7374 0.0646
NP_441229.1_10 Reverse -278 -297 7.7676 0.288
NP_440915.1_6 Reverse -383 -397 3.93283 0.1
NP_440717.1_2 Forward -305 -286 -2.36049 0.238
NP_441261.1_4 Forward -375 -365 17.7779 0.201
NP_442993.1_1 Forward -396 -380 -9.97122 0.201
NP_442386.1_9 Forward -216 -207 5.9975 0.23
NP_440570.1_5 Reverse -377 -396 6.19431 0.185
NP_441340.1_5 Forward -214 -207 6.23397 0.132
NP_441340.1_5 Reverse -207 -214 5.84064 0.208
NP_441340.1_5 Forward -395 -388 3.97235 0.274
NP_442791.1_10 Reverse -72 -91 17.5024 0.296
NP_440168.1_5 Reverse -81 -100 14.5524 0.185
NP_440327.1_6 Reverse -215 -234 11.5042 0.182
NP_440597.1_1 Forward -180 -161 20.059 0.0637
NP_440161.1_3 Reverse -297 -316 7.96426 0.282
NP_440586.1_8 Forward -214 -207 14.69 0.026
NP_442251.1_6 Reverse -207 -214 12.0355 0.0627
NP_442959.1_5 Reverse -357 -376 15.1424 0.217
NP_441262.1_3 Forward -215 -208 14.7888 0.0223
NP_440027.1_3 Forward -396 -378 5.72158 0.237
NP_440027.1_3 Reverse -380 -398 2.08335 0.293
NP_443051.1_1 Reverse -205 -214 6.19458 0.0849
NP_443051.1_1 Forward -216 -207 0.884706 0.125
NP_439937.1_8 Forward -229 -210 -1.57384 0.249
NP_439937.1_9 Forward -391 -374 -3.9934 0.157
NP_439937.1_9 Forward -169 -152 -9.59824 0.196
NP_441595.1_3 Reverse -383 -393 16.598 0.202
NP_440626.1_1 Reverse -207 -226 9.7334 0.256
NP_440372.1_2 Forward -214 -207 6.82395 0.0854
NP_440372.1_2 Reverse -207 -214 6.52896 0.188
NP_440316.1_10 Reverse -380 -390 16.008 0.153
NP_441803.1_2 Forward -395 -376 2.94938 0.2
NP_440267.1_2 Reverse -201 -215 13.372 0.125
NP_442114.1_4 Reverse -206 -217 8.81013 0.182
NP_440364.1_6 Forward -390 -377 13.6867 0.275
NP_441877.1_7 Forward -232 -213 6.29183 0.218
NP_442262.1_10 Forward -214 -207 12.9205 0.0422
NP_440344.1_10 Forward -222 -205 -11.3676 0.212
NP_440344.1_10 Reverse -199 -216 -12.6459 0.261
NP_440282.1_10 Forward -394 -375 -9.73531 0.288
NP_440189.1_10 Reverse -364 -383 13.9625 0.13
NP_442641.1_1 Forward -381 -362 -7.37537 0.192
NP_441640.1_8 Forward -307 -288 -4.72043 0.266
NP_440297.1_9 Forward -214 -204 9.61647 0.0917
NP_440297.1_9 Forward -389 -379 7.35486 0.126
NP_442280.1_5 Forward -135 -116 18.6028 0.187
NP_441592.1_4 Forward -384 -365 -4.22878 0.297
NP_440999.1_9 Forward -400 -386 -0.000409212 0.195
NP_440999.1_9 Forward -394 -380 -0.885388 0.22
NP_440999.1_9 Reverse -353 -367 -3.54032 0.296
NP_440888.1_2 Forward -396 -382 16.8135 0.00536
NP_440888.1_2 Reverse -287 -301 7.27547 0.202
NP_442033.1_10 Forward -247 -228 -14.1602 0.297
NP_441543.1_2 Reverse -207 -216 8.65285 0.0968
NP_441543.1_2 Forward -395 -386 5.11294 0.209
NP_442845.1_2 Reverse -381 -395 6.88276 0.201
NP_441469.1_8 Reverse -380 -389 7.86621 0.227
NP_441469.1_8 Forward -216 -207 6.39124 0.227
NP_442315.1_1 Forward -112 -94 4.9357 0.256
NP_442578.1_7 Forward -214 -207 14.6904 0.026
NP_441462.1_2 Forward -215 -205 1.94665 0.0807
NP_441462.1_2 Forward -396 -386 0.275027 0.159
NP_441621.1_4 Forward -344 -331 17.4239 0.246
NP_441621.1_7 Reverse -204 -218 -4.62196 0.238
NP_441621.1_7 Forward -398 -384 -5.80194 0.263
NP_443062.1_1 Reverse -206 -224 7.47334 0.175
NP_443062.1_6 Reverse -373 -392 7.66927 0.162
NP_441601.1_4 Forward -394 -375 -3.63879 0.293
NP_441410.1_3 Forward -224 -205 4.03102 0.293
NP_441351.1_8 Forward -398 -379 -0.295539 0.297
NP_440516.1_8 Forward -215 -206 1.08137 0.129
NP_442428.1_5 Forward -214 -207 6.13563 0.209
NP_442428.1_5 Reverse -207 -214 6.0373 0.212
NP_442428.1_5 Reverse -388 -395 4.759 0.223
NP_442120.1_10 Forward -396 -377 -12.7836 0.276
NP_440673.1_3 Reverse -208 -215 12.4288 0.0426
NP_441052.1_2 Reverse -387 -397 7.35486 0.0742
NP_441052.1_2 Forward -396 -386 7.35486 0.0742
NP_440436.1_4 Reverse -207 -216 8.55409 0.0997
NP_440436.1_4 Forward -395 -386 4.7192 0.244
NP_441719.1_4 Forward -214 -207 13.5105 0.026
NP_441719.1_4 Reverse -207 -214 6.52896 0.188
NP_441733.1_10 Forward -218 -205 8.77074 0.135
NP_441004.1_1 Reverse -375 -394 -14.1602 0.265
NP_441004.1_1 Reverse -369 -388 -15.6352 0.276
NP_442813.1_4 Forward -341 -322 -6.98204 0.299
NP_442813.1_4 Reverse -139 -158 -8.752 0.299
NP_442366.1_3 Reverse -205 -223 -0.865831 0.201
NP_442139.1_7 Reverse -370 -389 7.37428 0.287
NP_440129.1_10 Forward -222 -208 4.12949 0.185
NP_442873.1_9 Reverse -377 -396 7.76679 0.236
NP_443054.1_2 Reverse -322 -336 8.06273 0.13
NP_443054.1_2 Reverse -204 -218 4.52282 0.24
NP_441851.1_10 Forward -216 -206 11.8781 0.0602
NP_441851.1_10 Reverse -205 -215 6.07655 0.187
NP_441851.1_10 Reverse -386 -396 4.89658 0.24
NP_440495.1_1 Reverse -116 -135 7.37428 0.198
NP_442856.1_7 Reverse -378 -397 -2.55715 0.236
NP_442515.1_1 Reverse -386 -400 4.22782 0.108
NP_442515.1_1 Reverse -94 -108 -1.96703 0.268
NP_442689.1_2 Forward -226 -207 15.2408 0.212
NP_440432.1_9 Reverse -207 -222 0.471552 0.159
NP_440432.1_9 Forward -214 -199 -1.69173 0.167
NP_440474.1_8 Reverse -207 -221 14.7486 0.0595
NP_442450.1_5 Reverse -204 -214 8.4365 0.13
NP_440588.1_2 Forward -256 -237 0.196116 0.148
NP_440588.1_2 Forward -399 -380 -7.08038 0.299
NP_442006.1_2 Forward -224 -207 -16.6774 0.261
NP_442006.1_2 Reverse -55 -72 -16.7758 0.264
NP_441570.1_1 Reverse -73 -91 -16.7954 0.254
NP_440078.1_10 Forward -396 -377 3.14605 0.269
NP_441078.1_4 Reverse -387 -396 7.96454 0.0404
NP_441078.1_4 Forward -396 -387 0.786375 0.157
NP_441078.1_4 Forward -215 -206 0.196389 0.205
NP_441078.1_4 Reverse -206 -215 -0.000272808 0.205
NP_442729.1_8 Forward -400 -387 7.19745 0.161
NP_440526.1_3 Forward -395 -384 10.4812 0.0646
NP_440526.1_3 Reverse -207 -218 2.12315 0.267
NP_441432.1_8 Reverse -386 -395 4.81794 0.196
NP_442320.1_8 Forward -221 -207 4.42448 0.0504
NP_442320.1_8 Reverse -381 -395 -3.63866 0.126
NP_441732.1_2 Forward -86 -70 -16.5594 0.174
NP_440913.1_3 Forward -396 -383 14.1789 0.248
NP_440713.1_4 Reverse -377 -396 2.75272 0.257
NP_442489.1_7 Reverse -387 -396 8.45619 0.0206
NP_442489.1_7 Reverse -206 -215 7.47288 0.0613
NP_442489.1_7 Forward -396 -387 0.786375 0.152
NP_442489.1_7 Forward -215 -206 0.688044 0.152
NP_440757.1_7 Reverse -382 -400 2.37909 0.269
NP_442079.1_6 Reverse -373 -392 14.5524 0.273
NP_442079.1_7 Reverse -207 -226 2.16274 0.234
NP_440559.1_1 Forward -214 -205 13.3727 0.0401
NP_441659.2_8 Forward -396 -386 13.1564 0.0129
NP_441659.2_8 Forward -215 -205 6.46988 0.0744
NP_441040.1_2 Reverse -379 -398 -15.3402 0.286
NP_442776.1_1 Forward -395 -376 6.09597 0.234
NP_440779.1_5 Reverse -206 -223 -6.35267 0.177
NP_442346.1_5 Forward -397 -387 11.6814 0.0606
NP_442346.1_5 Reverse -386 -396 6.46988 0.201
NP_440545.1_3 Forward -86 -69 3.28376 0.0859
NP_440545.1_3 Reverse -91 -108 -7.04099 0.295
NP_440025.1_1 Reverse -202 -221 6.09597 0.271
NP_441629.1_3 Reverse -126 -145 0.0970122 0.236
NP_441653.1_2 Forward -226 -207 3.72288 0.264
NP_441943.1_8 Forward -386 -367 3.6377 0.164
NP_442551.1_4 Reverse -285 -300 -2.08505 0.256
NP_442551.1_4 Reverse -384 -399 -3.75668 0.295
NP_441948.1_4 Reverse -199 -217 -2.53746 0.169
NP_441833.1_4 Reverse -207 -214 6.52896 0.0924
NP_441833.1_4 Forward -214 -207 6.23397 0.163
NP_442162.1_9 Forward -214 -207 6.62729 0.142
NP_442162.1_9 Reverse -207 -214 6.52896 0.178
NP_440671.1_4 Forward -396 -382 8.25939 0.202
NP_440671.1_4 Reverse -381 -395 7.37441 0.219
NP_442140.1_3 Reverse -207 -217 7.94484 0.124
NP_442021.1_3 Reverse -215 -234 1.96607 0.176
NP_440875.1_9 Reverse -208 -218 17.619 0.0104
NP_441813.1_5 Reverse -204 -214 5.68323 0.113
NP_441813.1_5 Forward -217 -207 0.275027 0.206
NP_441259.1_7 Reverse -382 -400 14.0805 0.233
NP_440590.1_4 Forward -395 -382 1.69091 0.115
NP_440590.1_4 Reverse -207 -220 -4.79893 0.267
NP_440567.1_1 Reverse -207 -221 5.70279 0.0984
NP_442497.1_10 Forward -214 -205 8.25953 0.047
NP_442497.1_10 Reverse -207 -216 0.589713 0.153
NP_440821.1_4 Reverse -204 -214 9.41981 0.0286
NP_440821.1_4 Forward -217 -207 9.02648 0.0364
NP_441239.1_9 Forward -217 -205 5.74217 0.21
NP_441239.1_9 Reverse -204 -216 4.95553 0.234
NP_441727.1_3 Reverse -380 -399 2.45773 0.3
NP_441892.1_1 Forward -224 -207 -1.82945 0.214
NP_440665.1_1 Forward -98 -79 -14.1602 0.261
NP_442044.1_9 Forward -215 -196 9.14423 0.146
NP_442270.1_9 Reverse -376 -395 -11.9969 0.285
NP_440949.1_7 Forward -223 -204 8.65176 0.278
NP_440462.1_6 Forward -217 -207 14.7297 0.0186
NP_442565.1_7 Forward -353 -339 19.3708 0.0961
NP_440868.1_4 Forward -219 -207 0.23564 0.224
NP_441848.1_4 Forward -186 -170 9.07854 0.288
NP_440753.1_5 Forward -79 -60 15.0441 0.122
NP_442837.1_3 Reverse -207 -214 12.1338 0.0702
NP_442837.1_3 Forward -214 -207 6.0373 0.25
NP_442053.1_1 Reverse -206 -215 6.78456 0.115
NP_440505.1_3 Forward -217 -207 5.28991 0.236
NP_440505.1_3 Reverse -385 -395 4.50326 0.284
NP_441959.1_10 Reverse -77 -95 13.7419 0.186
NP_440013.1_1 Reverse -173 -192 7.66846 0.284
NP_441576.1_8 Forward -169 -151 13.2938 0.287
NP_440914.1_1 Reverse -387 -397 6.95605 0.257
NP_441011.1_8 Reverse -207 -216 7.07956 0.179
NP_442533.1_6 Reverse -387 -396 13.5694 0.021
NP_442533.1_6 Forward -396 -387 8.1612 0.0807
NP_442541.1_10 Forward -104 -90 1.37564 0.287
NP_439944.1_9 Reverse -388 -398 7.45319 0.141
NP_439944.1_9 Forward -214 -204 5.78156 0.221
NP_441028.1_6 Reverse -174 -184 12.6642 0.183
NP_442202.1_4 Forward -395 -381 14.1927 0.224
NP_441961.1_4 Reverse -379 -398 5.211 0.27
NP_443045.1_5 Reverse -154 -167 14.727 0.253
NP_441106.1_1 Forward -216 -207 8.45619 0.0548
NP_441106.1_3 Reverse -293 -312 12.2908 0.217
NP_440429.1_2 Forward -395 -376 13.3725 0.177
NP_441286.1_1 Reverse -386 -398 2.49725 0.06
NP_441286.1_1 Forward -397 -385 2.30059 0.0669
NP_441286.1_1 Forward -216 -204 -4.18925 0.152
NP_441286.1_1 Reverse -205 -217 -5.76255 0.223
NP_440670.1_8 Forward -215 -206 7.47288 0.0773
NP_440670.1_8 Reverse -206 -215 5.89959 0.131
NP_441930.1_2 Reverse -380 -390 11.1898 0.298
NP_440886.1_7 Forward -397 -387 6.66608 0.115
NP_440886.1_7 Forward -391 -381 6.66608 0.115
NP_440828.1_4 Forward -400 -381 -7.47443 0.286
NP_442072.1_9 Reverse -91 -109 -14.3372 0.142
NP_442072.1_9 Reverse -205 -223 -22.007 0.216
NP_442072.1_9 Forward -397 -379 -22.4003 0.234
NP_442213.1_5 Reverse -373 -392 0.982764 0.257
NP_440028.1_6 Forward -307 -289 10.2456 0.282
NP_440907.2_8 Reverse -207 -217 8.04271 0.117
NP_440907.2_8 Forward -214 -204 4.69947 0.25
NP_442264.1_2 Forward -400 -383 6.52869 0.254
NP_441021.1_1 Forward -395 -376 11.0125 0.0299
NP_441021.1_1 Forward -214 -195 -11.1119 0.257
NP_441021.1_8 Reverse -201 -219 6.41066 0.206
NP_440666.1_1 Forward -232 -213 30.1871 0.000433
NP_440666.1_2 Forward -307 -288 26.4505 0.00372
NP_440666.1_3 Forward -76 -57 29.3021 0.000493
NP_440666.1_4 Forward -268 -249 30.9737 0.000172
NP_440666.1_5 Forward -145 -126 25.9588 0.00689
NP_440666.1_6 Forward -374 -355 35.2019 0.00000783
NP_440666.1_7 Forward -109 -90 29.6954 0.0000529
NP_440666.1_8 Forward -211 -192 23.3039 0.0406
NP_441463.1_3 Reverse -208 -227 -5.50708 0.229
NP_441463.1_3 Reverse -196 -215 -7.17871 0.255
NP_441463.1_3 Forward -225 -206 -8.752 0.273
NP_441626.1_2 Forward -214 -207 6.13563 0.177
NP_441626.1_2 Reverse -207 -214 5.93897 0.231
NP_442211.1_3 Reverse -375 -394 10.9735 0.257
NP_442615.1_1 Reverse -378 -396 -5.29072 0.209
NP_440387.1_1 Forward -396 -380 -3.28472 0.157
NP_441836.1_2 Reverse -381 -400 0.884433 0.197
NP_441993.1_1 Reverse -381 -400 10.1331 0.13
NP_440143.1_1 Forward -127 -108 12.5858 0.284
NP_440114.1_10 Forward -215 -201 7.27608 0.239
NP_440114.1_10 Reverse -299 -313 6.19444 0.282
NP_442437.1_8 Reverse -207 -226 4.22769 0.264
NP_440293.1_3 Forward -146 -127 -4.81876 0.265
NP_440293.1_3 Reverse -280 -299 -6.78538 0.293
NP_440293.1_9 Reverse -382 -396 14.1466 0.206
NP_440293.1_10 Reverse -378 -397 -1.86883 0.271
NP_440766.1_4 Reverse -202 -216 7.47274 0.0917
NP_441979.1_5 Forward -396 -377 -10.817 0.228
NP_439910.1_2 Reverse -198 -215 -12.4492 0.0863
NP_440502.1_3 Reverse -75 -85 15.6405 0.195
NP_440457.1_1 Reverse -377 -389 4.16888 0.171
NP_440457.1_1 Reverse -383 -395 0.530633 0.25
NP_440801.1_8 Reverse -330 -349 -1.67217 0.282
NP_440801.1_9 Reverse -279 -293 12.1566 0.294
NP_441984.1_3 Forward -400 -382 9.85225 0.199
NP_442514.1_5 Forward -169 -150 -5.99948 0.263
NP_440554.1_4 Reverse -207 -217 4.3066 0.195
NP_441885.1_5 Forward -396 -386 2.14332 0.0827
NP_441885.1_5 Reverse -387 -397 1.74999 0.0991
NP_442703.1_9 Forward -190 -172 5.03403 0.244
NP_442341.1_7 Forward -397 -383 10.521 0.0625
NP_442341.1_7 Reverse -205 -219 1.86788 0.278
NP_442341.1_7 Reverse -323 -337 1.37622 0.292
NP_440507.2_3 Reverse -378 -397 12.585 0.15
NP_441842.1_10 Forward -222 -208 16.9125 0.0273
NP_440275.1_3 Forward -217 -207 8.4365 0.0602
NP_440275.1_3 Forward -398 -388 6.8632 0.0962
NP_440091.1_1 Forward -219 -207 10.4621 0.0487
NP_440091.1_1 Reverse -202 -214 -0.74767 0.286
NP_440679.1_10 Reverse -377 -396 -21.535 0.294
NP_442373.1_2 Reverse -372 -391 -11.3086 0.293
NP_440172.1_1 Reverse -387 -397 2.83163 0.264
NP_442371.1_1 Forward -380 -370 14.8275 0.183
NP_442329.1_5 Reverse -142 -161 15.0441 0.281
NP_441111.1_7 Reverse -207 -215 8.86921 0.0589
NP_441111.1_7 Reverse -388 -396 -0.472234 0.131
NP_441111.1_7 Forward -395 -387 -0.668896 0.274
NP_440244.1_1 Forward -127 -108 -9.24366 0.287
NP_441766.1_2 Reverse -206 -215 6.48957 0.096
NP_441766.1_2 Reverse -387 -396 4.52295 0.179
NP_442252.1_3 Forward -222 -204 11.5239 0.171
NP_440416.1_9 Forward -397 -378 -13.1769 0.163
NP_440416.1_9 Reverse -211 -230 -21.9284 0.298
NP_443052.1_8 Reverse -196 -215 -2.0655 0.0864
NP_440591.1_9 Reverse -380 -398 13.3922 0.0931
NP_442154.1_1 Reverse -379 -397 -14.4355 0.218
NP_440988.1_10 Reverse -385 -399 10.6108 0.187
NP_440988.1_10 Forward -398 -384 10.4172 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGTGGCCACCGCCACTGCCCTCGAGAAAATCCAGGAGGTTTACGGTGAGTAAGGTAATTGATCAGCGTCGTTTGGCGGACTTAATTATTAAACCGATTGTGACGGAAAAGGCCACGCTACAACTCGAAGACAACAAATACGTCTTTGATGTGCGCCCTGAAGCCACCAAACCGGAAATCAAAGCGGCGATCGAACTTTTGTTTGACGTCAAAGTAACAGGGGTAAATACTGCCCGTATGCCCCGCAGAAAGAAACGGGTTGGTCGTTTCATGGGTTTCAAAGCTCAAGTGAAGCGGGCCGTTGTCACCCTCAAGGAAGGGGACAGCATCCAACTCTTCCCTGACGTGTAAGTCACGTTTAGACCACCACTGAATACTGAATTAACTGTTATCTAAACCC

CDS

ATGGGTATTCGTAATTATCGGCCAATGACCCCAGGAACTCGGCAGGCAAGTGTCTCCGATTTCACTGAAATTACCAAGAGTAAGCCGGAGAAGTCATTAACCACTAACCGCCATGACCAAAAAGGTCGCAACAACCGTGGGGTGATCACCAGTCGTCACCGGGGGGGCGGCCATAAAAAGCTCTACCGGATTATCGACTTCAAACGTAACAAGCAAAATATTCCGGCCCGGGTAGCGGCGATCGAATACGATCCCAACCGCAATGCCCGCATTGCCCTGCTGTTCTACACCGACGGGGAAAAGCGTTATATTCTTGCTCCCGCTGGATTACAGGTAGGCATGACCGTTATTGCTGGGGAAGAAGCCCCCTTTGAAATTGGCAACACCTTACCCCTGAGCCGCATTCCCCTTGGTAGTGAAATACACAACGTGGAATTGGTAGCAGGGCGGGGCGGCCAAATGGTGCGTTCTGCTGGAGCTTTTGCCCAGGTGGTGGCTAAGGAAGGAGATTACGTGACCATCAAACTGCCGTCCAAGGAAGTGCGTATGGTTCGTAAAGAGTGTGTGGCTACCCTGGGTCGAGTTAGTAATGCCGAATTCCGTAACCTTAAGCTAGGAAAAGCCGGTCGTAAGCGTCACTTAGGTCGTCGTCCCCATGTCCGGGGTAGTGTGATGAACCCCTGTGATCACCCCCATGGTGGTGGTGAAGGCCGGGCCCCCATCGGTCGTTCCGGGCCTGTGTCTCCCTGGGGTAAACCAGCTTTGGGTGCCAAGACCCGCAACAAGAAGAAACGCAGTAGCGCTCTGATTGTCCGCCGTCGCACCAAATAA

Protein

MGIRNYRPMTPGTRQASVSDFTEITKSKPEKSLTTNRHDQKGRNNRGVITSRHRGGGHKKLYRIIDFKRNKQNIPARVAAIEYDPNRNARIALLFYTDGEKRYILAPAGLQVGMTVIAGEEAPFEIGNTLPLSRIPLGSEIHNVELVAGRGGQMVRSAGAFAQVVAKEGDYVTIKLPSKEVRMVRKECVATLGRVSNAEFRNLKLGKAGRKRHLGRRPHVRGSVMNPCDHPHGGGEGRAPIGRSGPVSPWGKPALGAKTRNKKKRSSALIVRRRTK