Your browser is old and dusty. Try Google Chrome!

Details for sll1801

ORF sll1801
Accession NP_440667.1
Symbol rpl23
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L23
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -40 -26 13.1759 0.0417
NP_441061.1_2 Reverse -282 -296 9.93102 0.0668
NP_441061.1_2 Reverse -195 -209 -0.492064 0.231
NP_440795.1_7 Forward -289 -282 14.6904 0.0123
NP_440795.1_7 Reverse -282 -289 14.6904 0.0123
NP_440795.1_7 Reverse -33 -40 10.2655 0.154
NP_441418.1_6 Forward -290 -271 -11.9969 0.0586
NP_441418.1_6 Reverse -281 -300 -19.7651 0.0955
NP_441418.1_6 Reverse -20 -39 -28.2215 0.203
NP_441418.1_6 Forward -272 -253 -29.1065 0.216
NP_441418.1_6 Reverse -32 -51 -29.4015 0.224
NP_441418.1_6 Reverse -206 -225 -29.6965 0.234
NP_441418.1_6 Forward -41 -22 -30.1882 0.262
NP_440815.1_5 Reverse -281 -300 3.53937 0.286
NP_442291.1_5 Reverse -280 -296 5.95839 0.0727
NP_442291.1_5 Forward -291 -275 -0.924775 0.19
NP_440897.1_6 Forward -35 -16 3.24359 0.149
NP_441453.1_4 Reverse -281 -289 16.539 0.00633
NP_441453.1_4 Forward -290 -282 16.539 0.00633
NP_441453.1_4 Forward -41 -33 4.05099 0.268
NP_442151.1_6 Forward -290 -276 9.14437 0.157
NP_442151.1_6 Reverse -200 -214 6.29277 0.24
NP_442151.1_6 Forward -41 -27 5.89945 0.256
NP_442151.1_6 Reverse -32 -46 5.40779 0.278
NP_442838.1_7 Reverse -276 -295 -11.5053 0.289
NP_441818.1_1 Reverse -282 -293 9.69459 0.232
NP_440226.1_1 Forward -290 -271 18.584 0.0142
NP_440226.1_1 Reverse -281 -300 3.93269 0.209
NP_442655.1_10 Forward -269 -250 -2.55715 0.19
NP_442173.1_1 Forward -289 -281 15.4574 0.00633
NP_442173.1_1 Reverse -282 -290 15.4574 0.00633
NP_442752.1_4 Forward -290 -283 13.8055 0.0199
NP_442752.1_4 Reverse -281 -288 13.8055 0.0199
NP_443027.1_4 Reverse -279 -289 15.3197 0.0437
NP_443027.1_4 Forward -292 -282 14.828 0.0437
NP_442975.1_10 Forward -294 -280 13.8636 0.0459
NP_442975.1_10 Reverse -277 -291 2.75226 0.269
NP_440784.1_7 Forward -289 -282 15.9687 0.0123
NP_440784.1_7 Reverse -282 -289 15.9687 0.0123
NP_440061.1_9 Forward -292 -278 12.2903 0.0985
NP_441054.1_3 Forward -179 -161 15.4589 0.244
NP_441054.1_4 Reverse -271 -289 2.18243 0.169
NP_441145.1_1 Reverse -277 -296 5.211 0.254
NP_439979.1_2 Reverse -20 -39 8.25926 0.258
NP_442062.1_8 Reverse -281 -291 19.4496 0.000558
NP_442062.1_8 Forward -290 -280 10.3048 0.0493
NP_442062.1_8 Forward -41 -31 4.50326 0.212
NP_441900.1_2 Reverse -247 -265 -0.6699 0.27
NP_441900.1_2 Reverse -244 -262 -0.964891 0.27
NP_440304.1_4 Reverse -279 -289 18.9579 0.00406
NP_440304.1_4 Forward -292 -282 10.8948 0.051
NP_440304.1_4 Reverse -24 -34 5.68323 0.196
NP_440304.1_7 Forward -195 -177 18.5054 0.201
NP_442242.1_4 Forward -289 -282 14.3954 0.0124
NP_442242.1_4 Reverse -282 -289 14.3954 0.0124
NP_440044.1_8 Forward -289 -270 11.7008 0.0486
NP_440044.1_8 Reverse -282 -301 -1.67217 0.248
NP_441781.1_7 Reverse -200 -219 5.11266 0.186
NP_442762.1_3 Forward -262 -243 19.3707 0.0555
NP_440011.1_1 Reverse -264 -283 13.1758 0.258
NP_441161.1_3 Forward -296 -278 17.5221 0.0605
NP_441619.1_8 Forward -296 -282 6.98048 0.295
NP_441208.1_9 Reverse -278 -292 14.1593 0.103
NP_441594.1_6 Reverse -23 -42 3.6377 0.226
NP_441594.1_6 Reverse -29 -48 2.45773 0.251
NP_441594.1_6 Forward -44 -25 2.26107 0.254
NP_440370.1_10 Reverse -272 -291 19.469 0.0433
NP_442110.1_7 Forward -290 -276 9.14437 0.0755
NP_442110.1_7 Forward -41 -27 6.6861 0.136
NP_442726.1_7 Forward -48 -30 7.78729 0.192
NP_441925.1_4 Reverse -354 -373 0.195343 0.155
NP_441925.1_4 Reverse -244 -263 -7.47443 0.195
NP_441925.1_4 Reverse -359 -378 -17.5041 0.296
NP_440856.1_4 Reverse -274 -293 -4.72043 0.265
NP_440856.1_7 Reverse -32 -51 -9.44032 0.29
NP_441083.1_3 Reverse -31 -41 15.2208 0.138
NP_441083.1_5 Reverse -281 -291 11.3864 0.0159
NP_441083.1_5 Forward -290 -280 11.2881 0.0159
NP_441083.1_5 Reverse -32 -42 1.16001 0.215
NP_441083.1_5 Forward -41 -31 0.963343 0.218
NP_442115.2_7 Reverse -365 -382 13.4119 0.149
NP_441738.1_2 Forward -288 -281 15.28 0.0102
NP_441738.1_2 Reverse -283 -290 15.28 0.0102
NP_441558.1_5 Reverse -198 -217 12.0942 0.0717
NP_441558.1_5 Forward -43 -24 10.8159 0.0912
NP_441558.1_5 Forward -217 -198 9.73422 0.115
NP_440209.1_1 Reverse -281 -289 18.1123 0.00295
NP_440209.1_1 Forward -290 -282 18.1123 0.00295
NP_442889.1_8 Forward -293 -279 3.93223 0.27
NP_441713.1_1 Reverse -275 -294 -5.40875 0.113
NP_441713.1_1 Forward -296 -277 -13.6686 0.257
NP_441713.1_5 Reverse -22 -41 6.4893 0.265
NP_441770.1_1 Reverse -241 -260 18.2882 0.156
NP_440178.1_7 Forward -291 -272 -12.4886 0.121
NP_442570.1_3 Reverse -215 -234 -4.91709 0.237
NP_441025.1_5 Forward -34 -20 19.0758 0.179
NP_441716.1_1 Forward -290 -276 4.52282 0.255
NP_441716.1_1 Reverse -281 -295 3.73617 0.259
NP_442111.1_4 Forward -291 -277 9.04604 0.0655
NP_442111.1_4 Reverse -280 -294 6.19444 0.134
NP_441624.1_6 Reverse -359 -378 13.6666 0.221
NP_441163.1_1 Forward -42 -25 5.24966 0.277
NP_441533.1_6 Forward -51 -32 18.1907 0.167
NP_440343.1_9 Reverse -271 -290 9.73422 0.248
NP_440906.1_5 Forward -289 -282 15.8704 0.0124
NP_440906.1_5 Reverse -282 -289 15.8704 0.0124
NP_442442.1_5 Reverse -83 -102 10.5209 0.205
NP_440747.1_10 Reverse -278 -290 -1.92764 0.0192
NP_440747.1_10 Forward -293 -281 -2.02597 0.0196
NP_440747.1_10 Reverse -29 -41 -11.6624 0.131
NP_440747.1_10 Reverse -203 -215 -11.8591 0.161
NP_440747.1_10 Forward -44 -32 -11.9574 0.178
NP_441130.1_10 Forward -292 -278 19.0758 0.0119
NP_442973.1_5 Forward -299 -280 12.4875 0.206
NP_441486.1_1 Forward -293 -279 4.81781 0.0406
NP_441486.1_1 Reverse -278 -292 2.35953 0.0844
NP_442330.1_9 Reverse -359 -378 16.2241 0.106
NP_442634.1_4 Reverse -279 -293 5.50613 0.0561
NP_442634.1_4 Forward -292 -278 -3.24533 0.161
NP_442634.1_4 Reverse -204 -218 -5.50694 0.258
NP_441265.1_3 Reverse -275 -289 3.34284 0.181
NP_440842.1_6 Forward -292 -273 9.53674 0.298
NP_441014.1_8 Reverse -362 -381 3.44104 0.214
NP_442848.1_1 Forward -296 -282 4.71948 0.0968
NP_442848.1_1 Reverse -275 -289 -3.63866 0.268
NP_442848.1_1 Reverse -26 -40 -4.52363 0.294
NP_442848.1_5 Forward -42 -24 6.90232 0.232
NP_441012.1_4 Forward -207 -194 9.16406 0.272
NP_441012.1_4 Reverse -196 -209 7.98409 0.272
NP_441012.1_4 Forward -39 -26 5.62415 0.291
NP_443018.1_3 Forward -289 -282 14.8871 0.0123
NP_443018.1_3 Reverse -282 -289 14.8871 0.0123
NP_443018.1_3 Reverse -33 -40 4.36568 0.254
NP_443018.1_3 Forward -40 -33 4.07068 0.299
NP_441316.1_7 Forward -292 -277 6.07642 0.107
NP_441316.1_7 Reverse -382 -397 5.09311 0.121
NP_441634.1_8 Forward -292 -278 3.04785 0.157
NP_441634.1_8 Forward -262 -248 2.94952 0.158
NP_441634.1_8 Reverse -30 -44 -3.54032 0.295
NP_441634.1_8 Reverse -279 -293 -4.22864 0.295
NP_440376.1_1 Forward -290 -281 19.4693 0.000692
NP_440376.1_1 Reverse -281 -290 19.4693 0.000692
NP_440376.1_1 Forward -41 -32 7.37455 0.0786
NP_440376.1_1 Reverse -32 -41 7.07956 0.0869
NP_440376.1_1 Forward -215 -206 4.81794 0.149
NP_440376.1_1 Forward -209 -200 4.12963 0.173
NP_440376.1_1 Forward -309 -300 0.589713 0.267
NP_441857.1_5 Reverse -274 -292 2.37909 0.268
NP_441588.1_4 Reverse -283 -293 6.96153 0.178
NP_442687.1_7 Forward -291 -281 15.8113 0.0125
NP_442687.1_7 Reverse -280 -290 9.02648 0.0994
NP_442687.1_7 Forward -42 -32 5.09324 0.221
NP_442485.1_3 Forward -214 -195 -1.86883 0.261
NP_442485.1_3 Forward -301 -282 -4.42544 0.28
NP_442485.1_3 Forward -40 -21 -4.81876 0.285
NP_442088.1_9 Reverse -248 -267 15.6341 0.209
NP_442958.1_3 Forward -326 -307 -0.590531 0.268
NP_441422.1_7 Forward -292 -275 -4.87771 0.247
NP_440533.1_9 Forward -209 -190 6.09597 0.19
NP_441746.1_2 Forward -303 -284 16.8141 0.248
NP_440667.1_1 Forward -325 -306 34.9069 0.00000756
NP_440667.1_2 Forward -373 -354 31.8587 0.000138
NP_440667.1_2 Forward -263 -244 -7.4737 0.275
NP_440667.1_3 Forward -19 -1 33.3533 0.00000613
NP_440667.1_4 Forward -397 -378 33.2353 0.00000187
NP_440667.1_5 Forward -79 -60 25.0739 0.0132
NP_440667.1_6 Forward -304 -285 27.0405 0.00339
NP_440667.1_7 Forward -226 -207 28.6129 0.000387
NP_440667.1_8 Forward -352 -333 26.1546 0.00546
NP_440667.1_9 Forward -202 -183 25.5655 0.00846
NP_440667.1_10 Forward -262 -243 25.2705 0.0115
NP_441950.1_7 Forward -373 -354 -7.4737 0.278
NP_441950.1_7 Reverse -20 -39 -9.24366 0.293
NP_442296.1_9 Reverse -282 -301 8.35759 0.0981
NP_442296.1_9 Forward -28 -9 0.786102 0.197
NP_441763.1_10 Forward -301 -282 5.11187 0.294
NP_441763.1_10 Reverse -195 -214 4.71854 0.3
NP_440360.1_10 Reverse -244 -258 2.16287 0.27
NP_442658.1_1 Reverse -279 -289 15.9091 0.00966
NP_442658.1_1 Forward -292 -282 15.9091 0.00966
NP_440446.1_6 Forward -253 -234 11.6025 0.298
NP_440141.1_4 Reverse -284 -303 -8.65367 0.298
NP_440141.1_4 Reverse -23 -42 -12.0953 0.298
NP_442782.1_2 Reverse -26 -40 6.19444 0.229
NP_442782.1_2 Reverse -195 -209 0.196253 0.293
NP_442205.1_9 Reverse -275 -291 -1.02311 0.264
NP_442205.1_9 Forward -296 -280 -2.39974 0.268
NP_441414.1_9 Reverse -281 -300 0.786102 0.0789
NP_441414.1_9 Reverse -32 -51 -5.9004 0.182
NP_440800.1_7 Forward -221 -207 19.3708 0.166
NP_440800.1_7 Forward -145 -131 12.7826 0.241
NP_441487.1_9 Forward -291 -272 7.27595 0.119
NP_441256.1_1 Reverse -251 -270 -5.11376 0.233
NP_442937.1_5 Reverse -27 -46 16.7157 0.0411
NP_442937.1_5 Forward -268 -249 6.09597 0.288
NP_441958.1_5 Reverse -280 -290 21.2195 0.000805
NP_441958.1_5 Forward -291 -281 12.2714 0.00183
NP_441958.1_5 Reverse -31 -41 -6.90313 0.293
NP_441127.1_1 Reverse -32 -46 8.84938 0.284
NP_442836.1_5 Reverse -275 -294 1.67108 0.276
NP_439905.1_1 Forward -289 -276 9.85238 0.216
NP_439905.1_1 Forward -49 -36 6.21414 0.295
NP_440984.1_7 Reverse -276 -290 13.3726 0.113
NP_440984.1_7 Forward -46 -32 8.06273 0.158
NP_442911.1_2 Forward -300 -281 -1.18052 0.082
NP_442911.1_2 Forward -51 -32 -4.91709 0.145
NP_441580.1_6 Reverse -270 -289 4.22769 0.117
NP_441580.1_6 Forward -301 -282 -5.70374 0.235
NP_440153.1_5 Forward -289 -275 15.0442 0.0551
NP_440153.1_5 Reverse -282 -296 6.98109 0.174
NP_440153.1_8 Forward -41 -28 6.60746 0.17
NP_443055.1_6 Forward -49 -31 -0.866561 0.268
NP_440993.1_2 Reverse -276 -292 13.1366 0.0657
NP_440993.1_2 Forward -295 -279 7.92501 0.157
NP_440602.1_8 Reverse -281 -295 16.6175 0.115
NP_441099.1_5 Reverse -196 -215 -10.7186 0.261
NP_441099.1_5 Forward -33 -14 -10.817 0.262
NP_441099.1_5 Reverse -22 -41 -11.8986 0.291
NP_442002.1_9 Forward -291 -284 10.7572 0.185
NP_440809.1_9 Reverse -272 -290 -7.25734 0.225
NP_441294.1_7 Forward -294 -280 14.626 0.0391
NP_441294.1_7 Reverse -277 -291 8.86667 0.274
NP_441646.1_1 Forward -297 -278 5.211 0.182
NP_441646.1_1 Reverse -25 -44 -1.47551 0.287
NP_442438.1_10 Reverse -276 -290 13.2743 0.0355
NP_442438.1_10 Forward -295 -281 11.3077 0.0463
NP_442438.1_10 Reverse -27 -41 11.111 0.0463
NP_442438.1_10 Forward -91 -77 -0.590395 0.269
NP_441000.1_6 Reverse -280 -294 5.40779 0.0933
NP_441000.1_6 Forward -291 -277 3.04785 0.12
NP_442771.1_1 Reverse -279 -297 -6.96235 0.169
NP_440147.1_4 Forward -292 -279 12.2123 0.0326
NP_440147.1_4 Reverse -279 -292 2.37923 0.208
NP_440147.1_4 Forward -43 -30 -0.275709 0.279
NP_441550.1_8 Reverse -279 -289 17.4824 0.00754
NP_441550.1_8 Forward -292 -282 6.0761 0.214
NP_441916.1_7 Forward -290 -280 18.9579 0.00144
NP_441916.1_7 Reverse -281 -291 18.4663 0.00144
NP_441916.1_7 Forward -209 -199 4.89658 0.154
NP_441916.1_10 Reverse -24 -43 10.4225 0.148
NP_441916.1_10 Forward -223 -204 10.3242 0.15
NP_440206.1_4 Reverse -196 -215 7.17681 0.209
NP_440206.1_4 Forward -39 -20 2.9486 0.284
NP_440465.1_10 Reverse -278 -297 -0.4922 0.29
NP_441041.1_4 Forward -215 -196 -5.9004 0.16
NP_441041.1_4 Reverse -20 -39 -6.78538 0.174
NP_441041.1_4 Reverse -26 -45 -7.86702 0.194
NP_441041.1_4 Reverse -281 -300 -11.2103 0.242
NP_441041.1_4 Reverse -200 -219 -12.4886 0.266
NP_441041.1_7 Forward -293 -281 10.916 0.0864
NP_441041.1_7 Reverse -278 -290 8.97244 0.125
NP_442396.1_5 Forward -294 -281 5.91914 0.26
NP_442004.1_6 Forward -290 -276 6.6861 0.171
NP_440703.1_3 Forward -317 -298 16.7602 0.279
NP_441725.1_5 Reverse -282 -292 11.2881 0.0247
NP_441725.1_5 Forward -289 -279 8.92815 0.0553
NP_441725.1_5 Forward -34 -24 7.35486 0.101
NP_439966.1_7 Forward -292 -282 18.4657 0.00473
NP_439966.1_7 Reverse -279 -289 13.8442 0.0234
NP_439966.1_9 Forward -292 -283 0.983037 0.253
NP_439966.1_9 Reverse -279 -288 0.983037 0.253
NP_440736.1_3 Reverse -279 -298 -1.18052 0.282
NP_442941.1_3 Reverse -282 -292 11.4848 0.0116
NP_442941.1_3 Forward -289 -279 10.9931 0.0116
NP_440289.1_2 Forward -293 -280 14.5723 0.0107
NP_440289.1_2 Reverse -278 -291 -4.40561 0.288
NP_440983.1_5 Reverse -364 -383 -3.3438 0.237
NP_440983.1_5 Forward -287 -268 -4.72043 0.261
NP_440983.1_5 Forward -41 -22 -7.08038 0.284
NP_440260.1_8 Reverse -284 -302 1.69077 0.183
NP_440260.1_8 Reverse -23 -41 -6.56903 0.293
NP_442281.1_1 Forward -295 -281 12.3887 0.0379
NP_441334.1_7 Forward -292 -273 -4.52377 0.12
NP_441334.1_7 Forward -395 -376 -13.3736 0.208
NP_440437.1_1 Forward -296 -277 1.76941 0.143
NP_440437.1_1 Reverse -242 -261 -4.81876 0.269
NP_442500.1_8 Forward -330 -316 12.1065 0.243
NP_442012.1_5 Reverse -25 -44 0.294447 0.288
NP_442012.1_5 Reverse -19 -38 -0.787193 0.288
NP_441457.1_7 Forward -292 -273 5.80098 0.186
NP_441457.1_7 Reverse -279 -298 -0.590531 0.293
NP_440723.1_8 Reverse -25 -39 13.2743 0.178
NP_442288.1_3 Reverse -205 -222 20.4917 0.0404
NP_441556.1_4 Forward -302 -283 12.2225 0.223
NP_441556.1_7 Forward -196 -177 2.6536 0.265
NP_440498.1_1 Reverse -272 -290 -0.7675 0.219
NP_440498.1_1 Forward -299 -281 -2.14413 0.235
NP_443030.1_4 Forward -41 -22 -6.09707 0.272
NP_441644.1_6 Forward -290 -280 19.0557 0.000803
NP_441644.1_6 Reverse -32 -42 13.0576 0.0244
NP_441644.1_6 Reverse -200 -210 11.2876 0.0524
NP_441644.1_6 Reverse -281 -291 10.1076 0.0628
NP_441644.1_6 Forward -209 -199 6.0761 0.167
NP_441644.1_6 Forward -41 -31 6.0761 0.167
NP_440867.1_10 Forward -204 -185 1.27776 0.298
NP_442215.1_2 Forward -43 -27 1.92682 0.125
NP_442215.1_2 Reverse -279 -295 -6.92296 0.281
NP_442215.1_2 Forward -259 -243 -7.11963 0.286
NP_442177.1_5 Reverse -23 -37 7.86607 0.291
NP_440929.1_8 Forward -290 -281 19.2726 0.000701
NP_440929.1_8 Reverse -281 -290 19.2726 0.000701
NP_442933.1_10 Forward -290 -281 17.601 0.00325
NP_442933.1_10 Reverse -281 -290 17.601 0.00325
NP_442933.1_10 Reverse -32 -41 5.11294 0.204
NP_440891.1_8 Forward -345 -326 15.5145 0.233
NP_441751.2_8 Reverse -282 -296 16.7159 0.00876
NP_441751.2_8 Forward -289 -275 -2.26202 0.132
NP_441751.2_8 Forward -40 -26 -6.68692 0.277
NP_442926.1_1 Reverse -20 -39 -5.21209 0.278
NP_442926.1_1 Reverse -266 -285 -6.39206 0.285
NP_442554.1_8 Forward -289 -279 19.1546 0.00369
NP_442554.1_8 Reverse -282 -292 13.8447 0.0145
NP_442554.1_8 Reverse -33 -43 7.55152 0.0893
NP_442554.1_8 Forward -40 -30 7.45319 0.092
NP_442554.1_8 Forward -208 -198 5.28991 0.153
NP_442554.1_8 Forward -214 -204 4.79825 0.173
NP_442554.1_8 Reverse -201 -211 3.71661 0.215
NP_441762.1_7 Forward -291 -279 11.7404 0.0142
NP_441762.1_7 Reverse -280 -292 2.98891 0.0676
NP_442142.1_4 Forward -293 -280 16.4399 0.0264
NP_442142.1_4 Reverse -278 -291 6.31189 0.169
NP_442142.1_4 Reverse -197 -210 3.95196 0.239
NP_442292.1_1 Forward -289 -280 17.5026 0.00435
NP_442292.1_1 Reverse -282 -291 9.63616 0.0183
NP_442292.1_1 Forward -40 -31 5.99792 0.125
NP_442292.1_1 Reverse -33 -42 -0.68859 0.268
NP_442292.1_5 Reverse -277 -296 0.687771 0.257
NP_442292.1_5 Reverse -21 -40 -1.47551 0.265
NP_442476.1_6 Forward -289 -275 14.3559 0.0401
NP_443009.1_5 Reverse -280 -291 19.626 0.00102
NP_443009.1_5 Forward -291 -280 7.82632 0.118
NP_441726.1_4 Forward -160 -146 16.6175 0.249
NP_442301.1_2 Reverse -244 -263 12.29 0.159
NP_441715.1_4 Reverse -282 -292 16.303 0.0117
NP_441715.1_4 Forward -289 -279 7.25653 0.108
NP_440279.1_2 Forward -354 -335 6.4893 0.25
NP_440015.1_9 Reverse -281 -299 0.21581 0.255
NP_440730.1_4 Reverse -107 -126 -4.72043 0.298
NP_441448.1_1 Reverse -30 -49 12.8808 0.165
NP_441448.1_1 Forward -262 -243 4.03102 0.28
NP_441448.1_2 Forward -39 -20 11.405 0.0815
NP_441448.1_7 Reverse -369 -388 6.78429 0.26
NP_440183.1_9 Forward -288 -269 -20.5517 0.287
NP_441198.1_8 Reverse -279 -289 15.4199 0.0427
NP_440379.1_5 Forward -38 -19 -11.5053 0.297
NP_441468.1_1 Forward -289 -282 15.8704 0.0124
NP_441468.1_1 Reverse -282 -289 15.8704 0.0124
NP_441468.1_1 Reverse -33 -40 4.46401 0.224
NP_441468.1_9 Reverse -208 -222 18.5841 0.142
NP_441020.2_6 Reverse -279 -296 10.9536 0.131
NP_441020.2_6 Reverse -30 -47 9.67528 0.165
NP_441015.1_10 Reverse -288 -307 1.67108 0.158
NP_441015.1_10 Reverse -27 -46 -3.63879 0.19
NP_441015.1_10 Reverse -195 -214 -8.26035 0.272
NP_441015.1_10 Forward -262 -243 -11.1119 0.291
NP_441673.1_1 Forward -290 -281 20.8459 0.000698
NP_441673.1_1 Reverse -281 -290 20.8459 0.000698
NP_441673.1_1 Reverse -32 -41 1.67135 0.0404
NP_441673.1_1 Forward -41 -32 1.47469 0.0936
NP_440286.1_2 Reverse -164 -177 15.5556 0.296
NP_441826.1_2 Forward -296 -282 18.4858 0.0121
NP_441826.1_2 Reverse -275 -289 3.93283 0.105
NP_441826.1_2 Forward -41 -27 -0.688726 0.22
NP_441826.1_2 Reverse -26 -40 -3.147 0.283
NP_441826.1_2 Reverse -200 -214 -3.54032 0.286
NP_442868.1_6 Reverse -279 -289 8.63316 0.0555
NP_442868.1_6 Forward -43 -33 8.4365 0.057
NP_442868.1_6 Forward -292 -282 0.963343 0.205
NP_442227.1_2 Reverse -366 -385 1.0811 0.25
NP_441944.1_2 Reverse -288 -306 16.8472 0.262
NP_442808.1_1 Forward -291 -281 18.4657 0.00201
NP_442808.1_1 Reverse -280 -290 8.73102 0.0481
NP_441101.1_1 Reverse -30 -48 10.0489 0.286
NP_442542.1_2 Reverse -279 -292 4.64084 0.299
NP_442113.1_10 Reverse -247 -266 9.53756 0.119
NP_442113.1_10 Reverse -357 -376 2.26107 0.182
NP_442113.1_10 Reverse -199 -218 -9.34199 0.295
NP_442050.1_5 Reverse -279 -289 17.1874 0.00812
NP_442050.1_5 Forward -292 -282 9.12434 0.193
NP_440630.1_1 Reverse -210 -229 2.65439 0.263
NP_440558.1_2 Forward -44 -25 -1.67217 0.217
NP_440558.1_2 Forward -38 -19 -3.73712 0.238
NP_440558.1_2 Reverse -38 -57 -7.4737 0.294
NP_442789.1_4 Reverse -33 -52 3.83436 0.162
NP_441518.1_3 Forward -51 -32 -14.6519 0.279
NP_441518.1_4 Reverse -357 -376 6.29183 0.288
NP_441878.1_6 Reverse -280 -290 10.5014 0.0176
NP_441878.1_6 Forward -291 -281 10.4031 0.0176
NP_441878.1_6 Reverse -31 -41 2.53664 0.0363
NP_441878.1_6 Reverse -199 -209 1.65166 0.0795
NP_441878.1_6 Forward -210 -200 0.865012 0.132
NP_441878.1_6 Forward -42 -32 -0.118297 0.167
NP_441878.1_6 Reverse -25 -35 -6.50981 0.191
NP_441878.1_6 Forward -216 -206 -7.19813 0.21
NP_441878.1_6 Forward -355 -345 -7.29646 0.217
NP_441036.1_8 Forward -291 -281 17.7779 0.000554
NP_441036.1_8 Reverse -280 -290 15.713 0.00724
NP_441557.1_5 Forward -290 -281 19.9609 0.000699
NP_441557.1_5 Reverse -281 -290 19.9609 0.000699
NP_441557.1_5 Reverse -32 -41 0.786375 0.106
NP_441557.1_5 Forward -41 -32 0.589713 0.134
NP_441445.1_1 Reverse -272 -291 3.24438 0.218
NP_441590.1_4 Reverse -243 -262 2.6536 0.293
NP_442066.2_4 Forward -290 -271 -2.55715 0.212
NP_442066.2_4 Reverse -281 -300 -3.44213 0.218
NP_442066.2_9 Forward -45 -32 8.86907 0.185
NP_441433.1_8 Forward -34 -15 12.8808 0.147
NP_442419.1_2 Reverse -201 -220 -3.54046 0.265
NP_440084.1_8 Forward -107 -93 9.17885 0.29
NP_441739.1_2 Forward -149 -133 2.22115 0.288
NP_441308.1_8 Reverse -279 -289 12.4681 0.218
NP_441308.1_8 Forward -292 -282 10.1081 0.22
NP_440101.1_3 Reverse -276 -295 3.73603 0.224
NP_440101.1_10 Forward -215 -196 4.916 0.208
NP_440101.1_10 Forward -250 -231 2.45773 0.254
NP_441458.1_10 Reverse -191 -210 2.85105 0.261
NP_442183.1_1 Reverse -281 -295 13.6676 0.0415
NP_442183.1_1 Reverse -70 -84 7.47274 0.141
NP_441459.1_6 Reverse -244 -262 9.85225 0.259
NP_439980.1_1 Forward -208 -189 16.1162 0.263
NP_441574.1_1 Forward -263 -244 -3.73712 0.243
NP_441574.1_1 Forward -244 -225 -4.13045 0.251
NP_441574.1_1 Reverse -29 -48 -4.91709 0.255
NP_441574.1_1 Forward -53 -34 -7.86702 0.297
NP_441549.1_9 Forward -294 -276 -0.472507 0.143
NP_441549.1_9 Forward -261 -243 -10.0106 0.268
NP_442347.1_2 Reverse -282 -291 11.1111 0.056
NP_442347.1_2 Reverse -236 -245 8.1612 0.108
NP_442347.1_2 Forward -289 -280 3.34298 0.284
NP_442645.1_2 Reverse -273 -292 -19.9617 0.288
NP_441037.1_4 Reverse -279 -289 16.5761 0.0168
NP_441037.1_4 Forward -292 -282 7.02532 0.237
NP_441037.1_4 Forward -355 -345 6.14821 0.278
NP_441633.1_3 Forward -292 -279 5.91914 0.0481
NP_441633.1_3 Reverse -279 -292 -5.88057 0.236
NP_440136.1_2 Forward -289 -282 15.9687 0.0123
NP_440136.1_2 Reverse -282 -289 15.9687 0.0123
NP_442590.1_10 Forward -263 -244 6.19431 0.249
NP_442590.1_10 Reverse -281 -300 3.53937 0.29
NP_442998.1_10 Forward -288 -281 15.5754 0.0102
NP_442998.1_10 Reverse -283 -290 15.5754 0.0102
NP_440299.1_1 Reverse -202 -215 8.37683 0.0945
NP_440299.1_1 Forward -294 -281 8.18017 0.0964
NP_440299.1_1 Forward -45 -32 7.78685 0.105
NP_440299.1_1 Reverse -277 -290 6.60689 0.136
NP_441799.1_1 Reverse -277 -291 19.0751 0.00735
NP_441799.1_1 Forward -294 -280 11.012 0.0629
NP_441799.1_4 Forward -49 -30 -2.65548 0.203
NP_441007.1_10 Reverse -276 -289 11.229 0.0646
NP_441007.1_10 Reverse -27 -40 10.7374 0.0646
NP_441007.1_10 Reverse -195 -208 1.39592 0.203
NP_441435.1_5 Forward -261 -242 7.57094 0.183
NP_440256.1_1 Forward -293 -274 7.37428 0.0259
NP_440256.1_1 Reverse -278 -297 -0.688862 0.0954
NP_440087.1_1 Reverse -272 -291 -3.14714 0.219
NP_441559.1_8 Reverse -276 -290 -1.08205 0.18
NP_441270.1_5 Forward -383 -364 10.8472 0.296
NP_440915.1_6 Forward -294 -280 12.6843 0.0208
NP_440915.1_6 Reverse -28 -42 3.93283 0.1
NP_440915.1_6 Reverse -277 -291 2.85119 0.111
NP_441261.1_4 Forward -20 -10 17.7779 0.201
NP_442866.1_1 Reverse -276 -295 3.24438 0.151
NP_440748.1_5 Reverse -284 -303 3.04771 0.21
NP_441494.1_6 Reverse -276 -289 7.09911 0.267
NP_442993.1_1 Reverse -281 -297 2.32015 0.0502
NP_442993.1_1 Forward -209 -193 -6.33298 0.146
NP_442993.1_1 Forward -41 -25 -9.97122 0.201
NP_440677.1_1 Forward -50 -31 10.8159 0.163
NP_442386.1_9 Forward -291 -282 15.7322 0.0144
NP_442386.1_9 Reverse -280 -289 6.39082 0.219
NP_442386.1_9 Reverse -241 -250 5.0142 0.27
NP_440570.1_5 Reverse -22 -41 6.19431 0.185
NP_440570.1_5 Forward -225 -206 3.6377 0.234
NP_440570.1_5 Forward -273 -254 -0.197208 0.262
NP_441750.1_1 Reverse -272 -291 -7.27704 0.259
NP_441750.1_1 Forward -269 -250 -11.7019 0.3
NP_441340.1_5 Forward -289 -282 15.6737 0.0124
NP_441340.1_5 Reverse -282 -289 15.6737 0.0124
NP_441340.1_5 Forward -40 -33 3.97235 0.274
NP_442484.1_2 Forward -389 -370 1.67108 0.227
NP_440168.1_8 Forward -221 -202 10.6192 0.179
NP_440168.1_9 Reverse -30 -49 0.196116 0.273
NP_441776.1_5 Forward -219 -200 13.5691 0.229
NP_440161.1_3 Forward -118 -99 9.14423 0.255
NP_440161.1_3 Reverse -279 -298 7.47261 0.299
NP_440586.1_1 Reverse -28 -47 -1.86883 0.244
NP_440586.1_1 Reverse -271 -290 -5.50708 0.285
NP_440586.1_1 Reverse -274 -293 -6.39206 0.299
NP_440586.1_8 Forward -289 -282 13.2151 0.026
NP_440586.1_8 Reverse -282 -289 13.2151 0.026
NP_440586.1_9 Forward -261 -242 5.50599 0.288
NP_442251.1_6 Forward -289 -282 15.2804 0.0124
NP_442251.1_6 Reverse -282 -289 15.2804 0.0124
NP_442251.1_6 Reverse -357 -364 8.20058 0.23
NP_442251.1_6 Forward -342 -335 8.10225 0.245
NP_440192.1_5 Forward -380 -361 3.73603 0.271
NP_442959.1_5 Reverse -2 -21 15.1424 0.217
NP_440684.1_9 Forward -296 -282 16.5192 0.0691
NP_441262.1_3 Reverse -281 -288 14.7888 0.0223
NP_441262.1_3 Forward -290 -283 14.7888 0.0223
NP_440027.1_3 Forward -290 -272 6.90155 0.22
NP_440027.1_3 Forward -41 -23 5.72158 0.237
NP_440027.1_3 Reverse -190 -208 5.62325 0.239
NP_440027.1_3 Reverse -271 -289 5.22993 0.245
NP_440027.1_3 Reverse -25 -43 2.08335 0.293
NP_443051.1_1 Reverse -280 -289 19.5676 0.00335
NP_443051.1_1 Forward -291 -282 10.4228 0.00754
NP_440451.1_10 Reverse -365 -384 10.4217 0.264
NP_439996.1_6 Forward -380 -361 9.46814 0.233
NP_441232.1_10 Reverse -270 -289 17.699 0.0296
NP_441232.1_10 Forward -301 -282 5.80098 0.173
NP_439937.1_9 Forward -291 -274 3.08639 0.0798
NP_439937.1_9 Forward -36 -19 -3.9934 0.157
NP_439937.1_9 Reverse -280 -297 -16.678 0.287
NP_441595.1_3 Reverse -28 -38 16.598 0.202
NP_440926.1_5 Forward -214 -195 14.4541 0.23
NP_440439.1_1 Reverse -278 -291 19.7838 0.0105
NP_440439.1_1 Forward -293 -280 8.08242 0.0559
NP_440372.1_2 Forward -289 -282 16.3621 0.0124
NP_440372.1_2 Reverse -282 -289 16.3621 0.0124
NP_440316.1_10 Reverse -25 -35 16.008 0.153
NP_440316.1_10 Reverse -199 -209 5.5849 0.291
NP_441803.1_2 Forward -46 -27 7.37428 0.139
NP_441803.1_2 Forward -40 -21 2.94938 0.2
NP_441803.1_2 Reverse -195 -214 0.491109 0.251
NP_439977.1_5 Forward -47 -28 1.86774 0.184
NP_439977.1_5 Reverse -200 -219 -0.787193 0.236
NP_440139.1_1 Reverse -275 -294 5.30853 0.161
NP_440139.1_1 Forward -296 -277 1.17865 0.269
NP_441572.1_7 Reverse -275 -294 5.80098 0.0863
NP_441572.1_7 Forward -296 -277 5.40766 0.0876
NP_440267.1_2 Forward -295 -281 8.45543 0.162
NP_442384.1_10 Forward -290 -277 9.95071 0.047
NP_442384.1_10 Reverse -281 -294 7.39411 0.0822
NP_442384.1_10 Reverse -235 -248 3.36254 0.193
NP_442384.1_10 Reverse -194 -207 0.215946 0.297
NP_440364.1_6 Forward -35 -22 13.6867 0.275
NP_441877.1_3 Forward -306 -288 23.4219 0.0277
NP_441018.1_7 Reverse -213 -232 8.84924 0.239
NP_442790.1_4 Forward -299 -280 -6.98204 0.149
NP_442262.1_10 Forward -289 -282 14.1988 0.0123
NP_442262.1_10 Reverse -282 -289 14.1988 0.0123
NP_441689.1_5 Forward -292 -282 8.53436 0.132
NP_441689.1_5 Reverse -279 -289 8.43603 0.132
NP_440163.1_10 Forward -293 -283 15.2213 0.0762
NP_440163.1_10 Reverse -197 -207 8.92815 0.256
NP_440344.1_10 Forward -297 -280 2.10379 0.0288
NP_440344.1_10 Reverse -145 -162 -9.79426 0.156
NP_440344.1_10 Reverse -274 -291 -10.5809 0.185
NP_440282.1_10 Forward -39 -20 -9.73531 0.288
NP_440531.1_6 Reverse -273 -292 -2.36049 0.249
NP_440189.1_10 Reverse -9 -28 13.9625 0.13
NP_442641.1_1 Forward -26 -7 -7.37537 0.192
NP_441640.1_6 Forward -121 -102 8.84924 0.288
NP_442750.1_1 Forward -338 -319 6.48849 0.267
NP_442529.1_4 Forward -299 -280 8.25926 0.278
NP_440297.1_9 Reverse -282 -292 9.32148 0.0917
NP_440297.1_9 Forward -34 -24 7.35486 0.126
NP_440297.1_9 Forward -208 -198 -0.216628 0.282
NP_440297.1_9 Forward -289 -279 -0.314959 0.282
NP_441592.1_4 Forward -29 -10 -4.22878 0.297
NP_441896.1_5 Reverse -176 -183 15.3787 0.268
YP_680420.1_1 Forward -395 -376 6.88262 0.279
NP_442067.1_4 Reverse -189 -208 6.39097 0.213
NP_440999.1_9 Reverse -330 -344 4.32615 0.116
NP_440999.1_9 Forward -294 -280 2.06454 0.154
NP_440999.1_9 Forward -45 -31 -0.000409212 0.195
NP_440999.1_9 Forward -39 -25 -0.885388 0.22
NP_440999.1_9 Forward -291 -277 -3.44199 0.293
NP_440999.1_9 Reverse -202 -216 -3.44199 0.293
NP_440888.1_2 Forward -290 -276 18.8785 0.00178
NP_440888.1_2 Forward -41 -27 16.8135 0.00536
NP_440888.1_2 Reverse -281 -295 16.4202 0.00685
NP_439969.1_1 Forward -57 -38 2.3594 0.184
NP_442033.1_10 Forward -292 -273 -9.44032 0.215
NP_441543.1_2 Reverse -282 -291 18.486 0.00236
NP_441543.1_2 Forward -289 -280 15.9293 0.00518
NP_441543.1_2 Forward -40 -31 5.11294 0.209
NP_442845.1_2 Reverse -275 -289 13.4709 0.0955
NP_442845.1_2 Reverse -26 -40 6.88276 0.201
NP_442845.1_2 Forward -296 -282 5.89945 0.22
NP_442845.1_2 Forward -215 -201 5.21113 0.24
NP_441551.1_5 Forward -294 -278 8.80929 0.228
NP_441319.1_5 Forward -289 -270 10.7175 0.25
NP_440982.1_1 Forward -391 -372 8.55343 0.29
NP_440982.1_1 Reverse -364 -383 4.42355 0.294
NP_441469.1_8 Forward -291 -282 16.126 0.00797
NP_441469.1_8 Reverse -25 -34 7.86621 0.227
NP_441469.1_8 Reverse -280 -289 6.5879 0.227
NP_442315.1_3 Forward -256 -237 8.55425 0.204
NP_443064.1_6 Forward -290 -280 10.8217 0.13
NP_442337.1_8 Reverse -170 -189 0.0977854 0.258
NP_442578.1_7 Forward -289 -282 14.5921 0.026
NP_442578.1_7 Reverse -282 -289 14.5921 0.026
NP_441462.1_2 Forward -290 -280 20.2362 0.000805
NP_441462.1_2 Reverse -281 -291 11.5831 0.00406
NP_441462.1_2 Forward -41 -31 0.275027 0.159
NP_441462.1_2 Forward -209 -199 -0.806614 0.254
NP_441621.1_7 Forward -292 -278 4.22782 0.0934
NP_441621.1_7 Reverse -279 -293 -3.34366 0.188
NP_441621.1_7 Forward -43 -29 -5.80194 0.263
NP_443062.1_1 Reverse -281 -299 21.0269 0.0208
NP_443062.1_6 Reverse -18 -37 7.66927 0.162
NP_443062.1_6 Forward -298 -279 3.6377 0.231
NP_443062.1_6 Reverse -72 -91 1.37609 0.276
NP_441601.1_4 Forward -207 -188 -2.95047 0.293
NP_441601.1_4 Forward -39 -20 -3.63879 0.293
NP_441601.1_4 Reverse -366 -385 -4.22878 0.293
NP_440519.1_8 Forward -256 -240 1.92682 0.273
NP_442204.1_1 Forward -219 -208 7.82682 0.112
NP_442204.1_1 Reverse -277 -288 0.451995 0.281
NP_442204.1_2 Forward -391 -372 6.29264 0.287
NP_441560.1_10 Forward -298 -279 5.80098 0.292
NP_441351.1_8 Forward -43 -24 -0.295539 0.297
NP_440516.1_2 Forward -296 -278 -2.3408 0.299
NP_440516.1_8 Forward -290 -281 16.9127 0.00442
NP_440516.1_8 Reverse -281 -290 16.9127 0.00442
NP_442428.1_5 Forward -289 -282 15.8704 0.0124
NP_442428.1_5 Reverse -282 -289 15.8704 0.0124
NP_442428.1_5 Reverse -33 -40 4.759 0.223
NP_442428.1_8 Forward -380 -361 -1.08219 0.28
NP_441443.1_1 Reverse -380 -399 -5.99873 0.3
NP_441443.1_7 Forward -272 -253 12.4875 0.0924
NP_442120.1_10 Reverse -200 -219 -4.6221 0.199
NP_442120.1_10 Forward -215 -196 -9.24366 0.242
NP_442120.1_10 Forward -41 -22 -12.7836 0.276
NP_440673.1_2 Reverse -271 -290 15.4623 0.0888
NP_440673.1_3 Forward -288 -281 12.4288 0.0426
NP_440673.1_3 Reverse -283 -290 12.4288 0.0426
NP_441052.1_2 Reverse -281 -291 10.5014 0.0285
NP_441052.1_2 Forward -290 -280 10.4031 0.0285
NP_441052.1_2 Reverse -32 -42 7.35486 0.0742
NP_441052.1_2 Forward -41 -31 7.35486 0.0742
NP_441052.1_2 Reverse -200 -210 4.3066 0.161
NP_442219.1_9 Reverse -282 -291 8.35786 0.0681
NP_442219.1_9 Forward -289 -280 8.25953 0.0681
NP_440436.1_4 Reverse -282 -291 18.1905 0.00233
NP_440436.1_4 Forward -289 -280 9.24241 0.0871
NP_440436.1_4 Forward -40 -31 4.7192 0.244
NP_441884.1_8 Forward -291 -272 -12.9802 0.275
NP_441884.1_9 Forward -293 -274 -3.04881 0.0594
NP_441884.1_9 Reverse -29 -48 -3.93378 0.0594
NP_442086.1_3 Forward -289 -270 7.96426 0.248
NP_440314.1_9 Forward -87 -68 -3.73712 0.191
NP_442907.1_9 Reverse -195 -214 -1.96717 0.243
NP_441719.1_4 Forward -289 -282 16.3621 0.0124
NP_441719.1_4 Reverse -282 -289 16.3621 0.0124
NP_441733.1_10 Reverse -278 -291 9.06573 0.127
NP_441004.1_1 Reverse -272 -291 -11.1119 0.234
NP_441004.1_1 Forward -382 -363 -12.5869 0.247
NP_441004.1_1 Reverse -20 -39 -14.1602 0.265
NP_441004.1_1 Reverse -14 -33 -15.6352 0.276
NP_441004.1_2 Reverse -30 -49 2.94938 0.212
NP_441004.1_5 Forward -380 -366 9.34103 0.261
NP_442366.1_3 Reverse -280 -298 0.510803 0.169
NP_442366.1_3 Forward -310 -292 -5.58572 0.289
NP_442139.1_7 Reverse -15 -34 7.37428 0.287
NP_440129.1_10 Forward -297 -283 3.53951 0.194
NP_442873.1_9 Reverse -22 -41 7.76679 0.236
NP_440296.1_4 Forward -262 -243 15.922 0.247
NP_440296.1_10 Reverse -29 -48 -14.8485 0.276
NP_441115.1_4 Reverse -280 -298 9.55647 0.21
NP_442854.1_6 Reverse -206 -225 7.07928 0.229
NP_443054.1_2 Reverse -279 -293 3.34284 0.24
NP_443054.1_2 Forward -292 -278 2.94952 0.24
NP_441851.1_10 Forward -291 -281 16.008 0.00552
NP_441851.1_10 Reverse -280 -290 8.53483 0.114
NP_441851.1_10 Reverse -31 -41 4.89658 0.24
NP_442208.1_5 Forward -259 -240 -9.63698 0.295
NP_442622.1_5 Forward -292 -273 -4.72043 0.206
NP_442622.1_8 Reverse -281 -299 -18.8604 0.285
NP_442011.1_1 Forward -291 -272 -0.885524 0.268
NP_442856.1_7 Reverse -23 -42 -2.55715 0.236
NP_441668.1_4 Forward -254 -235 5.01433 0.173
NP_442515.1_1 Reverse -31 -45 4.22782 0.108
NP_442515.1_1 Forward -291 -277 -4.22864 0.298
NP_440593.1_3 Reverse -27 -46 1.86774 0.183
NP_440593.1_3 Forward -307 -288 -0.787193 0.209
NP_440165.1_5 Reverse -280 -299 -7.76869 0.276
NP_441046.1_2 Forward -268 -249 -1.67217 0.292
NP_442689.1_8 Reverse -132 -149 -7.33598 0.292
NP_441349.1_10 Forward -300 -281 10.5209 0.0232
NP_441349.1_10 Reverse -271 -290 -6.88371 0.238
NP_440432.1_9 Forward -289 -274 5.97809 0.0486
NP_442843.1_1 Reverse -282 -301 -11.6036 0.291
NP_440474.1_8 Reverse -282 -296 17.5018 0.0432
NP_440474.1_8 Forward -289 -275 12.5853 0.0853
NP_441124.1_5 Forward -104 -94 16.5414 0.168
NP_442450.1_5 Forward -292 -282 9.32148 0.115
NP_440588.1_2 Forward -299 -280 -0.000545616 0.149
NP_440588.1_2 Forward -44 -25 -7.08038 0.299
NP_440588.1_5 Forward -223 -209 16.1563 0.208
NP_440023.1_2 Forward -256 -237 7.07928 0.245
NP_442006.1_2 Reverse -375 -392 -10.0892 0.197
NP_442006.1_2 Reverse -272 -289 -14.9075 0.211
NP_442006.1_2 Forward -269 -252 -15.5958 0.228
NP_441003.1_9 Forward -224 -205 10.4225 0.213
NP_441003.1_9 Reverse -336 -355 4.22769 0.285
NP_442243.1_1 Forward -62 -44 1.19838 0.219
NP_442243.1_1 Reverse -275 -293 -0.0799167 0.239
NP_442243.1_1 Reverse -339 -357 -1.55487 0.279
NP_441570.1_1 Reverse -281 -299 3.26407 0.0221
NP_441570.1_1 Forward -290 -272 1.19912 0.0325
NP_440078.1_10 Forward -215 -196 10.2259 0.182
NP_440078.1_10 Forward -41 -22 3.14605 0.269
NP_441078.1_4 Forward -290 -281 19.6659 0.0007
NP_441078.1_4 Reverse -281 -290 19.6659 0.0007
NP_441078.1_4 Reverse -32 -41 7.96454 0.0404
NP_441078.1_4 Forward -41 -32 0.786375 0.157
NP_441078.1_4 Reverse -200 -209 -1.37691 0.254
NP_441078.1_4 Forward -209 -200 -1.47524 0.266
NP_441078.1_4 Forward -215 -206 -1.86856 0.272
NP_442729.1_7 Reverse -75 -93 6.41066 0.286
NP_442729.1_8 Forward -45 -32 7.19745 0.161
NP_440707.1_9 Forward -259 -240 8.75091 0.219
NP_440526.1_3 Forward -40 -29 10.4812 0.0646
NP_440526.1_3 Forward -289 -278 2.31981 0.267
NP_440526.1_3 Reverse -282 -293 1.92649 0.267
NP_441432.1_8 Reverse -280 -289 16.8143 0.00595
NP_441432.1_8 Forward -291 -282 8.25953 0.0755
NP_441432.1_8 Reverse -31 -40 4.81794 0.196
NP_442320.1_8 Forward -296 -282 4.52282 0.0482
NP_442320.1_8 Reverse -275 -289 -2.06536 0.0851
NP_442320.1_8 Reverse -26 -40 -3.63866 0.126
NP_441732.1_2 Forward -219 -203 2.71347 0.0186
NP_441732.1_2 Forward -294 -278 -6.52964 0.0495
NP_441732.1_2 Reverse -277 -293 -16.2644 0.165
NP_441732.1_2 Reverse -244 -260 -16.3627 0.165
NP_441732.1_2 Reverse -196 -212 -16.5594 0.174
NP_441732.1_2 Reverse -354 -370 -17.5427 0.27
NP_440760.1_1 Reverse -32 -51 -15.4385 0.147
NP_440199.1_10 Forward -293 -283 14.533 0.0861
NP_441945.1_10 Reverse -31 -50 9.73422 0.258
NP_440913.1_3 Forward -41 -28 14.1789 0.248
NP_442751.1_1 Reverse -359 -378 15.2663 0.248
NP_442751.1_10 Reverse -33 -52 18.9773 0.242
NP_441072.1_2 Reverse -277 -296 5.80098 0.296
NP_442400.1_1 Reverse -278 -297 -5.80207 0.299
NP_442400.1_10 Forward -328 -315 7.51014 0.284
NP_440713.1_4 Reverse -271 -290 7.7676 0.174
NP_440713.1_4 Reverse -22 -41 2.75272 0.257
NP_442489.1_1 Reverse -353 -372 17.8948 0.232
NP_442489.1_7 Forward -290 -281 20.1576 0.000695
NP_442489.1_7 Reverse -281 -290 20.1576 0.000695
NP_442489.1_7 Reverse -32 -41 8.45619 0.0206
NP_442489.1_7 Forward -41 -32 0.786375 0.152
NP_442489.1_7 Forward -215 -206 -1.37691 0.195
NP_442489.1_7 Reverse -200 -209 -1.37691 0.195
NP_442489.1_7 Forward -209 -200 -1.47524 0.203
NP_440757.1_4 Forward -218 -199 1.27776 0.288
NP_440757.1_7 Reverse -27 -45 2.37909 0.269
NP_440941.1_1 Forward -377 -367 15.3197 0.278
NP_441452.1_1 Reverse -364 -383 15.0441 0.267
NP_442079.1_6 Reverse -18 -37 14.5524 0.273
NP_442079.1_7 Reverse -33 -52 9.83255 0.111
NP_442079.1_7 Reverse -282 -301 -0.0988766 0.29
NP_440559.1_1 Reverse -282 -291 8.75118 0.0586
NP_440559.1_1 Forward -289 -280 8.65285 0.0586
NP_441659.2_8 Forward -290 -280 20.9245 0.000805
NP_441659.2_8 Forward -41 -31 13.1564 0.0129
NP_441659.2_8 Reverse -281 -291 11.9764 0.0147
NP_441659.2_8 Forward -209 -199 6.17489 0.084
NP_441659.2_8 Reverse -206 -216 -0.314959 0.298
NP_442913.1_10 Reverse -272 -291 0.294447 0.155
NP_441040.1_2 Reverse -24 -43 -15.3402 0.286
NP_441800.1_7 Reverse -246 -264 5.03403 0.181
NP_441807.1_9 Forward -67 -48 20.944 0.089
NP_442776.1_1 Forward -40 -21 6.09597 0.234
NP_442346.1_5 Reverse -280 -290 16.303 0.00248
NP_442346.1_5 Forward -42 -32 11.6814 0.0606
NP_442346.1_5 Forward -210 -200 10.8948 0.0813
NP_442346.1_5 Forward -291 -281 9.02648 0.118
NP_442346.1_5 Reverse -31 -41 6.46988 0.201
NP_442346.1_5 Reverse -199 -209 4.89658 0.269
NP_440545.1_3 Reverse -277 -294 14.4935 0.0152
NP_440545.1_3 Forward -213 -196 11.3469 0.0266
NP_440545.1_3 Reverse -202 -219 1.8088 0.112
NP_440545.1_3 Forward -294 -277 0.530496 0.137
NP_440545.1_3 Reverse -177 -194 -5.95935 0.265
NP_441856.1_3 Forward -293 -274 -0.000545616 0.216
NP_440025.1_3 Forward -357 -343 10.1267 0.29
NP_440459.1_2 Forward -218 -201 14.0018 0.119
NP_440459.1_2 Reverse -233 -250 9.18362 0.233
NP_440010.1_4 Forward -51 -32 2.35861 0.225
NP_440010.1_10 Reverse -269 -288 1.67108 0.295
NP_441943.1_8 Forward -31 -12 3.6377 0.164
NP_442551.1_4 Reverse -29 -44 -3.75668 0.295
NP_441888.1_7 Forward -295 -281 2.35953 0.225
NP_440449.1_6 Forward -265 -247 6.99141 0.236
NP_441948.1_4 Forward -297 -279 -1.06249 0.14
NP_442754.1_5 Forward -261 -242 15.2399 0.228
NP_441833.1_4 Forward -289 -282 15.9687 0.0124
NP_441833.1_4 Reverse -282 -289 15.9687 0.0124
NP_442162.1_9 Forward -289 -282 16.2637 0.0124
NP_442162.1_9 Reverse -282 -289 16.2637 0.0124
NP_440671.1_4 Forward -296 -282 17.9942 0.0156
NP_440671.1_4 Forward -41 -27 8.25939 0.202
NP_440671.1_4 Reverse -26 -40 7.37441 0.219
NP_440224.1_1 Reverse -270 -289 1.0811 0.132
NP_442140.1_3 Reverse -282 -292 8.33817 0.119
NP_442140.1_3 Forward -289 -279 7.94484 0.124
NP_442021.1_3 Forward -215 -196 -7.37537 0.268
NP_441671.1_10 Reverse -270 -289 9.3409 0.183
NP_440875.1_9 Forward -288 -278 14.5042 0.0411
NP_440875.1_9 Reverse -283 -293 8.37203 0.233
NP_442547.1_7 Forward -219 -200 15.5758 0.155
NP_441813.1_5 Forward -292 -282 17.188 0.00979
NP_441813.1_5 Reverse -279 -289 8.73149 0.0367
NP_440594.1_8 Forward -289 -276 9.45847 0.186
NP_441259.1_7 Reverse -27 -45 14.0805 0.233
NP_440590.1_4 Forward -289 -276 3.16588 0.0756
NP_440590.1_4 Forward -40 -27 1.69091 0.115
NP_440590.1_4 Reverse -282 -295 -3.81562 0.255
NP_440567.1_1 Forward -289 -275 22.2224 0.012
NP_440567.1_1 Reverse -282 -296 14.3559 0.0187
NP_440567.1_1 Forward -392 -378 1.17956 0.214
NP_442497.1_10 Forward -289 -280 17.601 0.00813
NP_442497.1_10 Reverse -282 -291 10.4228 0.0087
NP_440821.1_4 Forward -292 -282 19.0562 0.00399
NP_440821.1_4 Reverse -279 -289 10.7964 0.0146
NP_441239.1_9 Reverse -279 -291 17.4436 0.0146
NP_441239.1_9 Forward -292 -280 13.3137 0.037
NP_441239.1_9 Reverse -198 -210 3.2839 0.289
NP_441009.1_7 Reverse -280 -299 11.2092 0.238
NP_441727.1_3 Reverse -25 -44 2.45773 0.3
NP_441892.1_1 Forward -299 -282 -1.43612 0.205
NP_441892.1_1 Reverse -272 -289 -4.09106 0.255
NP_440665.1_1 Reverse -254 -273 -5.31042 0.194
NP_440665.1_1 Forward -275 -256 -14.4552 0.262
NP_440665.1_1 Reverse -364 -383 -16.9135 0.295
NP_442193.1_8 Reverse -278 -297 9.63507 0.292
NP_442270.1_9 Reverse -21 -40 -11.9969 0.285
NP_440949.1_7 Forward -298 -279 8.06178 0.298
NP_440354.1_7 Reverse -275 -293 6.01734 0.294
NP_440546.1_4 Forward -290 -280 13.5365 0.0459
NP_440546.1_4 Reverse -281 -291 11.8882 0.0679
NP_442041.1_2 Reverse -265 -283 11.4255 0.283
NP_441509.1_2 Reverse -208 -226 16.7354 0.124
NP_440462.1_6 Reverse -279 -289 19.4496 0.00371
NP_440462.1_6 Forward -292 -282 15.418 0.0142
NP_440868.1_4 Reverse -277 -289 17.0502 0.0124
NP_440868.1_4 Forward -294 -282 8.79043 0.0582
NP_441868.1_4 Forward -191 -177 14.0609 0.282
NP_442402.1_4 Reverse -239 -258 1.17865 0.173
NP_441848.1_4 Forward -147 -131 11.1794 0.232
NP_441084.1_6 Reverse -279 -293 9.05325 0.295
NP_440653.1_10 Reverse -236 -255 2.26107 0.289
NP_442023.1_1 Forward -284 -265 14.7483 0.276
NP_442039.1_4 Forward -289 -282 15.1821 0.0124
NP_442039.1_4 Reverse -282 -289 15.1821 0.0124
NP_441811.1_8 Forward -167 -153 7.66941 0.241
NP_442829.1_2 Forward -150 -134 10.4603 0.287
NP_441926.1_3 Reverse -281 -297 7.04003 0.17
NP_442837.1_3 Forward -289 -282 15.7721 0.0124
NP_442837.1_3 Reverse -282 -289 15.7721 0.0124
NP_440160.1_2 Forward -186 -167 -9.24366 0.293
NP_440160.1_3 Reverse -364 -383 13.0766 0.209
NP_442053.1_1 Forward -290 -281 18.3876 0.0007
NP_442053.1_1 Reverse -281 -290 18.3876 0.0007
NP_440505.1_3 Reverse -279 -289 15.418 0.0114
NP_440505.1_3 Forward -292 -282 13.8447 0.0247
NP_440505.1_3 Reverse -30 -40 4.50326 0.284
NP_442255.1_3 Reverse -239 -258 12.9791 0.19
NP_441408.2_7 Reverse -192 -211 -5.31042 0.292
NP_440914.1_1 Forward -290 -280 16.3248 0.00196
NP_440914.1_1 Reverse -281 -291 8.6151 0.186
NP_440914.1_1 Reverse -32 -42 6.95605 0.257
NP_441011.1_8 Reverse -282 -291 16.9127 0.00602
NP_441011.1_8 Forward -289 -280 16.6177 0.00602
NP_442533.1_6 Forward -290 -281 17.2076 0.00137
NP_442533.1_6 Reverse -281 -290 17.2076 0.00137
NP_442533.1_6 Reverse -200 -209 13.8644 0.0178
NP_442533.1_6 Reverse -32 -41 13.5694 0.021
NP_442533.1_6 Forward -41 -32 8.1612 0.0807
NP_442533.1_6 Forward -209 -200 7.17789 0.0948
NP_442533.1_6 Forward -203 -194 2.55633 0.25
NP_442541.1_10 Reverse -200 -214 4.62054 0.251
NP_440263.1_5 Reverse -134 -148 9.14437 0.294
NP_442232.1_3 Forward -298 -279 -15.7335 0.296
NP_442229.1_1 Reverse -279 -293 8.94708 0.184
NP_441482.1_7 Forward -221 -207 -3.73699 0.138
NP_441482.1_7 Forward -296 -282 -10.8168 0.216
NP_441482.1_7 Reverse -194 -208 -11.7018 0.281
NP_439944.1_9 Forward -289 -279 17.7779 0.00341
NP_439944.1_9 Reverse -282 -292 10.3048 0.0887
NP_439944.1_9 Reverse -33 -43 7.45319 0.141
NP_442202.1_4 Forward -40 -26 14.1927 0.224
NP_440116.1_8 Forward -289 -270 -1.86883 0.122
NP_441527.1_4 Forward -340 -321 -9.78835 0.262
NP_440115.1_6 Reverse -278 -288 16.008 0.0325
NP_440007.1_9 Reverse -197 -211 10.1277 0.163
NP_440007.1_9 Forward -294 -280 1.57289 0.285
NP_440007.1_9 Forward -219 -205 0.88457 0.29
NP_439965.1_1 Reverse -272 -291 -4.81876 0.197
NP_439965.1_1 Forward -306 -287 -5.21209 0.205
NP_441680.1_4 Reverse -368 -387 -2.65548 0.27
NP_441961.1_4 Reverse -24 -43 5.211 0.27
NP_441602.1_3 Forward -46 -27 -3.3438 0.245
NP_441170.1_4 Forward -50 -32 3.16574 0.283
NP_441972.1_5 Reverse -33 -52 -1.18052 0.175
NP_441972.1_5 Forward -301 -282 -5.40875 0.22
NP_441972.1_5 Forward -289 -270 -8.35868 0.263
NP_441106.1_1 Reverse -280 -289 18.486 0.0028
NP_441106.1_1 Forward -291 -282 18.191 0.0028
NP_440429.1_2 Forward -40 -21 13.3725 0.177
NP_440429.1_2 Forward -289 -270 8.84924 0.272
NP_442306.1_10 Reverse -276 -295 -20.8467 0.231
NP_441286.1_1 Forward -291 -279 5.15219 0.0259
NP_441286.1_1 Reverse -280 -292 5.05386 0.0259
NP_441286.1_1 Reverse -31 -43 2.49725 0.06
NP_441286.1_1 Forward -42 -30 2.30059 0.0669
NP_440670.1_8 Forward -290 -281 18.3876 0.000699
NP_440670.1_8 Reverse -281 -290 18.3876 0.000699
NP_441930.1_2 Reverse -25 -35 11.1898 0.298
NP_440886.1_7 Forward -291 -281 17.7774 0.0011
NP_440886.1_7 Reverse -280 -290 8.04271 0.0805
NP_440886.1_7 Reverse -253 -263 6.66608 0.115
NP_440886.1_7 Forward -42 -32 6.66608 0.115
NP_440886.1_7 Forward -36 -26 6.66608 0.115
NP_440886.1_7 Reverse -366 -376 3.32285 0.287
NP_440828.1_1 Forward -288 -269 3.63691 0.219
NP_440828.1_4 Reverse -360 -379 -6.58946 0.276
NP_440828.1_4 Forward -45 -26 -7.47443 0.286
NP_442614.1_2 Forward -290 -276 5.70279 0.298
NP_442072.1_9 Forward -291 -273 -11.4856 0.0789
NP_442072.1_9 Reverse -280 -298 -12.9605 0.095
NP_442072.1_9 Forward -355 -337 -21.8103 0.212
NP_442072.1_9 Forward -42 -24 -22.4003 0.234
NP_442401.1_2 Forward -291 -272 14.2566 0.125
NP_442213.1_5 Reverse -18 -37 0.982764 0.257
NP_441753.1_10 Reverse -272 -291 3.44104 0.216
NP_440028.1_6 Forward -384 -366 10.3439 0.282
NP_440907.2_8 Forward -289 -279 19.1541 0.00362
NP_440907.2_8 Reverse -282 -292 7.84605 0.117
NP_442264.1_2 Forward -45 -28 6.52869 0.254
NP_439967.1_7 Forward -291 -273 10.2456 0.223
NP_441021.1_1 Forward -40 -21 11.0125 0.0299
NP_441021.1_8 Forward -295 -277 2.0841 0.253
NP_440326.1_9 Reverse -322 -341 17.3048 0.2
NP_441463.1_3 Forward -300 -281 15.2408 0.0215
NP_441463.1_3 Reverse -271 -290 -4.42544 0.205
NP_441463.1_6 Forward -217 -203 11.5375 0.224
NP_441626.1_2 Forward -289 -282 15.7721 0.0124
NP_441626.1_2 Reverse -282 -289 15.7721 0.0124
NP_442211.1_3 Reverse -20 -39 10.9735 0.257
NP_441901.1_1 Forward -218 -199 7.07928 0.133
NP_440107.1_5 Forward -297 -278 -6.68705 0.262
NP_442615.1_1 Reverse -272 -290 -0.472507 0.116
NP_442615.1_1 Reverse -23 -41 -5.29072 0.209
NP_441962.1_4 Reverse -27 -46 18.879 0.0137
NP_441962.1_4 Forward -46 -27 -4.13045 0.156
NP_441962.1_4 Reverse -276 -295 -8.35868 0.199
NP_441962.1_4 Reverse -201 -220 -10.6203 0.232
NP_440387.1_1 Reverse -281 -297 8.515 0.0282
NP_440387.1_1 Reverse -32 -48 2.51681 0.0784
NP_440387.1_1 Forward -290 -274 0.255197 0.129
NP_440387.1_1 Forward -41 -25 -3.28472 0.157
NP_440387.1_1 Forward -215 -199 -5.84132 0.254
NP_441431.1_2 Reverse -278 -292 7.47213 0.241
NP_441431.1_2 Forward -293 -279 6.0955 0.28
NP_441431.1_3 Forward -269 -250 2.16274 0.292
NP_441836.1_2 Reverse -26 -45 0.884433 0.197
NP_441836.1_2 Forward -47 -28 -2.45882 0.23
NP_441993.1_1 Reverse -26 -45 10.1331 0.13
NP_441993.1_1 Forward -215 -196 5.45515 0.201
NP_441993.1_1 Reverse -200 -219 2.33652 0.26
NP_441174.1_2 Reverse -278 -292 11.5043 0.296
NP_440114.1_10 Forward -290 -276 15.5359 0.0249
NP_440114.1_10 Reverse -281 -295 14.4542 0.0401
NP_440737.1_1 Reverse -300 -319 8.94757 0.251
NP_442437.1_8 Forward -301 -282 6.68596 0.242
NP_442698.1_10 Reverse -28 -47 3.14605 0.279
NP_441552.1_3 Reverse -274 -293 14.2566 0.235
NP_441720.1_2 Reverse -277 -296 9.04509 0.213
NP_440293.1_9 Reverse -27 -41 14.1466 0.206
NP_440293.1_10 Reverse -23 -42 -1.86883 0.271
NP_440766.1_4 Reverse -277 -291 6.6861 0.0991
NP_441979.1_5 Forward -41 -22 -10.817 0.228
NP_442743.1_5 Reverse -282 -301 7.86593 0.162
NP_441133.1_1 Forward -376 -357 15.1424 0.2
NP_441133.1_1 Forward -384 -365 13.2741 0.243
NP_439910.1_2 Forward -298 -281 -21.2006 0.183
NP_442867.1_8 Forward -391 -372 7.57094 0.242
NP_440457.1_1 Reverse -277 -289 9.87208 0.092
NP_440457.1_1 Forward -294 -282 9.57708 0.092
NP_440457.1_1 Reverse -22 -34 4.16888 0.171
NP_440457.1_1 Reverse -28 -40 0.530633 0.25
NP_440798.1_6 Forward -289 -276 20.2755 0.0203
NP_440942.1_3 Forward -249 -230 1.67108 0.298
NP_441984.1_3 Forward -45 -27 9.85225 0.199
NP_441984.1_3 Reverse -365 -383 5.03403 0.295
NP_442509.1_9 Reverse -281 -291 16.2041 0.00739
NP_442509.1_9 Forward -290 -280 8.04271 0.192
NP_442509.1_9 Forward -297 -287 6.17443 0.286
NP_441253.1_1 Reverse -256 -275 8.55425 0.205
NP_442514.1_5 Reverse -285 -304 2.9486 0.159
NP_440554.1_4 Forward -289 -279 15.418 0.0199
NP_440554.1_4 Reverse -282 -292 14.6313 0.02
NP_442862.1_3 Forward -214 -197 5.15205 0.28
NP_441885.1_5 Reverse -281 -291 11.4848 0.00668
NP_441885.1_5 Forward -290 -280 11.3864 0.00668
NP_441885.1_5 Forward -41 -31 2.14332 0.0827
NP_441885.1_5 Reverse -32 -42 1.74999 0.0991
NP_440628.1_1 Forward -180 -170 13.8734 0.279
NP_441428.1_8 Forward -49 -30 5.211 0.228
NP_441428.1_8 Forward -298 -279 2.3594 0.273
NP_442341.1_7 Forward -42 -28 10.521 0.0625
NP_442341.1_7 Forward -291 -277 2.65453 0.249
NP_442341.1_7 Reverse -280 -294 1.57289 0.286
NP_441173.1_9 Forward -235 -227 10.9338 0.242
NP_442395.2_4 Reverse -287 -306 3.9319 0.19
NP_442395.2_4 Reverse -280 -299 3.44025 0.202
NP_440409.1_1 Reverse -273 -292 2.75272 0.18
NP_443000.1_7 Reverse -279 -289 10.7964 0.0345
NP_443000.1_7 Forward -292 -282 8.73149 0.0437
NP_440507.2_3 Reverse -23 -42 12.585 0.15
NP_441842.1_1 Forward -288 -275 20.2748 0.0111
NP_441842.1_10 Reverse -274 -288 15.7325 0.0381
NP_441842.1_10 Forward -297 -283 6.88276 0.271
NP_440275.1_3 Reverse -279 -289 18.6629 0.0082
NP_440275.1_3 Forward -292 -282 8.4365 0.0602
NP_440275.1_3 Forward -43 -33 6.8632 0.0962
NP_440091.1_1 Forward -294 -282 20.1968 0.00953
NP_440091.1_1 Reverse -277 -289 10.2654 0.0498
NP_440679.1_10 Reverse -34 -53 -20.3551 0.284
NP_440679.1_10 Reverse -22 -41 -21.535 0.294
NP_443010.1_10 Reverse -278 -295 17.749 0.0367
NP_443010.1_10 Forward -293 -276 5.57317 0.203
NP_440175.1_7 Reverse -213 -231 11.2174 0.235
NP_441105.1_3 Reverse -224 -243 -7.96535 0.263
NP_441105.1_3 Forward -214 -195 -8.45701 0.272
NP_442373.1_2 Reverse -17 -36 -11.3086 0.293
NP_440216.1_1 Forward -290 -276 17.4042 0.00188
NP_440216.1_1 Reverse -281 -295 7.57108 0.00935
NP_440172.1_1 Forward -290 -280 17.5813 0.00421
NP_440172.1_1 Reverse -281 -291 8.73149 0.0586
NP_440172.1_1 Reverse -32 -42 2.83163 0.264
NP_442371.1_1 Forward -25 -15 14.8275 0.183
NP_442015.1_10 Forward -294 -281 0.904263 0.216
NP_441226.1_7 Forward -289 -282 14.4934 0.0123
NP_441226.1_7 Reverse -282 -289 14.4934 0.0123
NP_442034.1_7 Reverse -37 -55 14.9655 0.131
NP_441111.1_7 Forward -289 -281 18.7023 0.00294
NP_441111.1_7 Reverse -282 -290 18.7023 0.00294
NP_441111.1_7 Reverse -33 -41 -0.472234 0.131
NP_441111.1_7 Forward -40 -32 -0.668896 0.274
NP_442379.1_10 Forward -297 -280 4.6604 0.141
NP_442379.1_10 Reverse -274 -291 0.530496 0.223
NP_442379.1_10 Reverse -199 -216 -2.3211 0.228
NP_441766.1_2 Forward -290 -281 17.5026 0.00297
NP_441766.1_2 Reverse -281 -290 17.5026 0.00297
NP_441766.1_2 Reverse -32 -41 4.52295 0.179
NP_440416.1_9 Forward -210 -191 -6.58872 0.0913
NP_440416.1_9 Forward -42 -23 -13.1769 0.163
NP_440416.1_9 Forward -297 -278 -14.4552 0.176
NP_440416.1_9 Reverse -270 -289 -16.5201 0.216
NP_440416.1_9 Forward -304 -285 -17.1101 0.231
NP_443052.1_8 Reverse -271 -290 -7.17871 0.154
NP_440072.1_5 Forward -382 -364 2.96908 0.236
NP_442116.1_6 Forward -147 -130 8.16895 0.254
NP_442403.1_8 Reverse -283 -302 8.94757 0.142
NP_440591.1_9 Reverse -25 -43 13.3922 0.0931
NP_440591.1_9 Forward -297 -279 6.80398 0.215
NP_442154.1_1 Reverse -24 -42 -14.4355 0.218
NP_442154.1_1 Forward -268 -250 -15.3205 0.218
NP_442154.1_1 Forward -271 -253 -16.9921 0.247
NP_442226.1_8 Reverse -325 -335 18.0729 0.129
NP_440261.1_5 Forward -289 -276 6.60746 0.0318
NP_440261.1_5 Reverse -33 -46 -11.9771 0.268
NP_440988.1_10 Reverse -198 -212 10.998 0.187
NP_440988.1_10 Reverse -30 -44 10.6108 0.187
NP_440988.1_10 Forward -43 -29 10.4172 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTCGATTCGTTCTCCCCTCTGGCGGGGTGGTGGTGTGATCTTTGGGCCTAAGCCTCGAGATTACAGCCAAAAAATGAACCGCAAGGAACGTCGTTTGGCCCTGAGAACGGCGATCGCCTCCCGAGCCGACAACATGGTGGTGGTGGAAGCCTTTGGTGATCAATTCAGCCAACCTAAAACCAAGGAGTTGGCCACGGCCTTGACTCGCTGGGGTGCCAAACCAGAAAAACGGGTGTTGTTGATCCTTGATGAAATTCCAGAAAATGTCTTTCTTTCTGGGCGCAACATTCCCTATTTGAAAATTTTACGGGCAGATAACCTCAATATCTACGACGTTCTCGTTGCAGACACCATTGTGGCCACCGCCACTGCCCTCGAGAAAATCCAGGAGGTTTACG

CDS

GTGAGTAAGGTAATTGATCAGCGTCGTTTGGCGGACTTAATTATTAAACCGATTGTGACGGAAAAGGCCACGCTACAACTCGAAGACAACAAATACGTCTTTGATGTGCGCCCTGAAGCCACCAAACCGGAAATCAAAGCGGCGATCGAACTTTTGTTTGACGTCAAAGTAACAGGGGTAAATACTGCCCGTATGCCCCGCAGAAAGAAACGGGTTGGTCGTTTCATGGGTTTCAAAGCTCAAGTGAAGCGGGCCGTTGTCACCCTCAAGGAAGGGGACAGCATCCAACTCTTCCCTGACGTGTAA

Protein

MSKVIDQRRLADLIIKPIVTEKATLQLEDNKYVFDVRPEATKPEIKAAIELLFDVKVTGVNTARMPRRKKRVGRFMGFKAQVKRAVVTLKEGDSIQLFPDV