Your browser is old and dusty. Try Google Chrome!

Details for sll1797

ORF sll1797
Accession NP_440671.1
Symbol ycf21
Category hypothetical protein YCF21
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -335 -349 18.1908 0.0786
NP_441061.1_2 Forward -290 -276 21.7307 0.00612
NP_441061.1_2 Reverse -283 -297 0.294584 0.213
NP_440795.1_7 Forward -290 -283 14.6904 0.0123
NP_440795.1_7 Reverse -283 -290 14.6904 0.0123
NP_440795.1_7 Reverse -277 -284 8.8889 0.188
NP_441418.1_6 Reverse -282 -301 7.27595 0.00614
NP_441418.1_6 Reverse -276 -295 -21.7317 0.159
NP_440815.1_5 Reverse -143 -162 7.07928 0.259
NP_442291.1_5 Reverse -281 -297 9.7933 0.0487
NP_442291.1_5 Forward -292 -276 -0.924775 0.19
NP_440897.1_6 Forward -291 -272 2.6536 0.164
NP_441453.1_1 Forward -133 -115 4.63995 0.258
NP_441453.1_4 Reverse -282 -290 16.539 0.00633
NP_441453.1_4 Forward -291 -283 16.539 0.00633
NP_441453.1_4 Forward -344 -336 5.0343 0.209
NP_441453.1_7 Forward -337 -330 12.9205 0.23
NP_441623.1_1 Forward -389 -371 -4.01242 0.274
NP_441623.1_1 Forward -58 -40 -5.68405 0.297
NP_443041.1_1 Forward -31 -12 7.66927 0.0663
NP_442151.1_6 Forward -291 -277 16.8142 0.0138
NP_442151.1_6 Forward -285 -271 7.17775 0.206
NP_440561.1_8 Reverse -337 -356 12.1925 0.261
NP_441818.1_1 Forward -290 -279 15.8894 0.0244
NP_441818.1_1 Reverse -283 -294 9.69459 0.232
NP_441818.1_9 Reverse -24 -43 -1.7705 0.2
NP_441818.1_9 Reverse -295 -314 -8.65367 0.279
NP_440226.1_1 Reverse -282 -301 18.9773 0.0124
NP_442744.1_9 Forward -297 -283 14.6775 0.266
NP_442287.1_1 Forward -356 -346 13.6475 0.277
NP_442655.1_2 Reverse -336 -355 0.687771 0.291
NP_442173.1_1 Forward -290 -282 15.4574 0.00633
NP_442173.1_1 Reverse -283 -291 15.4574 0.00633
NP_442752.1_4 Reverse -335 -342 15.0838 0.0199
NP_442752.1_4 Forward -291 -284 13.8055 0.0199
NP_442752.1_4 Reverse -282 -289 13.8055 0.0199
NP_442752.1_4 Forward -54 -47 12.1338 0.0546
NP_442752.1_4 Forward -126 -119 5.54565 0.194
NP_443027.1_4 Forward -293 -283 14.828 0.0437
NP_443027.1_4 Reverse -280 -290 14.0414 0.0452
NP_443027.1_4 Reverse -298 -308 7.45319 0.24
NP_441812.1_3 Reverse -281 -295 17.8958 0.0479
NP_442975.1_10 Forward -295 -281 22.32 0.000414
NP_442975.1_10 Reverse -278 -292 4.03056 0.249
NP_440784.1_7 Forward -290 -283 15.9687 0.0123
NP_440784.1_7 Reverse -283 -290 15.9687 0.0123
NP_442909.1_7 Forward -290 -276 13.6669 0.12
NP_442909.1_7 Reverse -277 -291 9.53707 0.145
NP_440061.1_9 Forward -293 -279 8.16044 0.18
NP_440061.1_9 Forward -56 -42 4.91554 0.3
NP_440110.1_4 Reverse -271 -290 4.52268 0.186
NP_441054.1_2 Reverse -336 -355 19.0757 0.0953
NP_439979.1_7 Forward -348 -331 14.2968 0.267
NP_442062.1_3 Forward -231 -212 -1.18052 0.256
NP_442062.1_8 Reverse -282 -292 19.4496 0.000558
NP_442062.1_8 Forward -291 -281 17.3846 0.00193
NP_442062.1_8 Reverse -335 -345 6.37155 0.127
NP_441859.1_3 Reverse -281 -300 1.86696 0.272
NP_440304.1_4 Forward -293 -283 10.8948 0.051
NP_440304.1_4 Reverse -280 -290 10.8948 0.051
NP_442242.1_4 Forward -290 -283 14.3954 0.0124
NP_442242.1_4 Reverse -283 -290 14.3954 0.0124
NP_440044.1_8 Reverse -283 -302 4.71934 0.11
NP_441781.1_7 Forward -291 -272 4.22769 0.187
NP_441781.1_7 Reverse -39 -58 0.884433 0.24
NP_441781.1_7 Reverse -92 -111 -3.3438 0.296
NP_440011.1_1 Reverse -339 -358 17.699 0.153
NP_439918.1_2 Reverse -57 -76 -2.45882 0.244
NP_441210.1_3 Forward -69 -50 13.2741 0.259
NP_441200.1_4 Reverse -330 -349 7.57094 0.272
NP_440132.1_1 Reverse -258 -276 10.7372 0.218
NP_442110.1_7 Forward -291 -277 10.816 0.0644
NP_442726.1_1 Reverse -277 -296 12.8808 0.164
NP_442726.1_7 Forward -276 -258 -1.45582 0.296
NP_441925.1_4 Forward -355 -336 -5.60616 0.179
NP_441925.1_4 Forward -354 -335 -7.76943 0.2
NP_441925.1_4 Forward -96 -77 -10.8177 0.243
NP_441925.1_4 Forward -353 -334 -15.4392 0.264
NP_440856.1_7 Forward -383 -364 -1.57384 0.182
NP_440856.1_7 Forward -275 -256 -7.76869 0.256
NP_441083.1_3 Reverse -25 -35 13.1559 0.22
NP_441083.1_5 Forward -291 -281 20.3345 0.00053
NP_441083.1_5 Reverse -282 -292 11.3864 0.0159
NP_441083.1_5 Forward -344 -334 6.56821 0.0819
NP_441083.1_5 Forward -70 -60 4.3066 0.148
NP_442827.1_8 Reverse -274 -293 8.4551 0.0807
NP_442827.1_8 Reverse -252 -271 -0.984623 0.238
NP_441434.1_7 Reverse -284 -298 5.99778 0.225
NP_441738.1_2 Forward -289 -282 15.28 0.0102
NP_441738.1_2 Reverse -284 -291 15.28 0.0102
NP_441738.1_2 Forward -342 -335 11.7401 0.0647
NP_441558.1_5 Reverse -280 -299 3.93269 0.294
NP_440209.1_1 Reverse -282 -290 18.1123 0.00295
NP_440209.1_1 Forward -291 -283 18.1123 0.00295
NP_442136.1_1 Reverse -203 -222 8.45592 0.226
NP_442889.1_8 Forward -294 -280 20.9434 0.00339
NP_440447.1_5 Reverse -327 -337 14.4347 0.277
NP_441713.1_1 Reverse -270 -289 -13.3736 0.255
NP_441770.1_4 Reverse -315 -334 -5.21209 0.204
NP_440178.1_7 Forward -292 -273 -22.3217 0.261
NP_440178.1_7 Reverse -281 -300 -22.42 0.265
NP_442570.1_3 Forward -160 -141 -4.72043 0.235
NP_441716.1_1 Forward -291 -277 6.09611 0.207
NP_441716.1_1 Reverse -276 -290 3.44117 0.265
NP_441716.1_1 Reverse -117 -131 3.34284 0.268
NP_441327.1_6 Reverse -293 -306 17.6205 0.24
NP_442111.1_4 Forward -292 -278 1.96621 0.292
NP_441163.1_1 Reverse -159 -176 4.46302 0.287
NP_440343.1_3 Forward -354 -336 4.04996 0.266
NP_440906.1_5 Forward -290 -283 15.8704 0.0124
NP_440906.1_5 Reverse -283 -290 15.8704 0.0124
NP_440747.1_10 Reverse -279 -291 7.4138 0.00422
NP_440747.1_10 Forward -294 -282 -2.02597 0.0196
NP_440747.1_10 Reverse -114 -126 -12.2524 0.254
NP_440747.1_10 Forward -347 -335 -12.3507 0.27
NP_441130.1_10 Reverse -280 -294 8.65272 0.133
NP_442973.1_7 Reverse -277 -296 14.5524 0.209
NP_441486.1_1 Forward -294 -280 19.9608 0.00312
NP_441486.1_1 Reverse -279 -293 10.9143 0.018
NP_441486.1_1 Forward -288 -274 2.35953 0.0844
NP_440842.1_1 Forward -291 -272 12.0942 0.243
NP_440842.1_6 Reverse -351 -370 10.7167 0.278
NP_440842.1_10 Reverse -344 -358 4.52282 0.254
NP_443017.1_1 Reverse -205 -224 21.4061 0.0263
NP_441014.1_5 Reverse -271 -289 10.8356 0.263
NP_441014.1_5 Forward -75 -57 9.85225 0.272
NP_441014.1_10 Reverse -281 -300 11.995 0.118
NP_441014.1_10 Forward -170 -151 3.14526 0.215
NP_442848.1_1 Reverse -276 -290 7.37441 0.0791
NP_442848.1_1 Forward -297 -283 6.58777 0.0791
NP_442848.1_9 Forward -107 -88 6.39097 0.189
NP_441012.1_4 Forward -267 -254 12.0157 0.249
NP_443018.1_3 Forward -290 -283 14.8871 0.0123
NP_443018.1_3 Reverse -283 -290 14.8871 0.0123
NP_443018.1_3 Reverse -69 -76 10.2655 0.107
NP_443018.1_3 Forward -284 -277 4.56234 0.241
NP_443018.1_3 Reverse -277 -284 4.46401 0.244
NP_441634.1_8 Reverse -280 -294 11.8976 0.0529
NP_440376.1_1 Forward -291 -282 19.4693 0.000692
NP_440376.1_1 Reverse -282 -291 19.4693 0.000692
NP_440376.1_1 Reverse -335 -344 3.34298 0.206
NP_440376.1_1 Reverse -260 -269 3.34298 0.206
NP_440376.1_1 Forward -114 -105 2.26134 0.228
NP_441588.1_4 Reverse -284 -294 6.96153 0.178
NP_441588.1_4 Forward -289 -279 6.37155 0.2
NP_440580.1_1 Reverse -258 -277 8.55425 0.19
NP_442687.1_7 Forward -292 -282 15.8113 0.0125
NP_442687.1_7 Reverse -281 -291 8.92815 0.0994
NP_442687.1_7 Reverse -334 -344 6.27322 0.175
NP_442687.1_7 Reverse -164 -174 4.79825 0.234
NP_442687.1_7 Reverse -313 -323 3.91327 0.278
NP_442191.1_7 Reverse -336 -355 14.0608 0.206
NP_442485.1_3 Forward -302 -283 -0.885524 0.254
NP_442485.1_3 Forward -88 -69 -5.01543 0.287
NP_441846.1_10 Reverse -335 -354 -12.5869 0.191
NP_441846.1_10 Reverse -334 -353 -13.8652 0.212
NP_441846.1_10 Reverse -78 -97 -13.8652 0.212
NP_442583.1_8 Reverse -271 -290 8.55425 0.248
NP_441013.1_2 Forward -349 -331 2.18243 0.242
NP_441013.1_3 Reverse -264 -283 10.1275 0.219
NP_441422.1_7 Forward -293 -276 -2.3211 0.21
NP_442658.1_1 Forward -293 -283 15.9091 0.00966
NP_442658.1_1 Reverse -280 -290 6.76441 0.214
NP_442198.1_3 Reverse -302 -321 2.75272 0.297
NP_442782.1_2 Reverse -335 -349 7.66941 0.202
NP_442782.1_2 Reverse -254 -268 1.27789 0.281
NP_440656.1_8 Forward -302 -283 6.58763 0.0791
NP_441414.1_9 Forward -291 -272 -0.000545616 0.0856
NP_440184.1_5 Reverse -335 -354 8.25926 0.201
NP_440184.1_5 Reverse -272 -291 3.44104 0.271
NP_441256.1_2 Reverse -331 -350 9.3409 0.198
NP_442937.1_2 Forward -284 -265 19.4681 0.105
NP_442937.1_5 Reverse -277 -296 9.53756 0.187
NP_442937.1_5 Forward -296 -277 8.84924 0.209
NP_441958.1_5 Forward -292 -282 12.2714 0.00183
NP_441958.1_5 Reverse -281 -291 12.2714 0.00183
NP_441958.1_5 Reverse -334 -344 7.25653 0.0347
NP_440950.1_1 Forward -53 -34 14.4541 0.0368
NP_440950.1_8 Forward -242 -223 13.7918 0.148
NP_440203.1_5 Forward -341 -331 13.6475 0.112
NP_440203.1_5 Reverse -120 -130 10.0093 0.242
NP_441097.1_2 Reverse -331 -348 5.9387 0.257
NP_439990.1_5 Reverse -277 -290 11.0324 0.128
NP_442376.1_2 Reverse -40 -59 -12.2919 0.286
NP_442911.1_2 Reverse -272 -291 4.22769 0.0392
NP_442911.1_2 Reverse -325 -344 -8.45701 0.235
NP_442911.1_2 Forward -301 -282 -10.7186 0.286
NP_441580.1_6 Forward -302 -283 -1.08219 0.183
NP_441580.1_6 Forward -355 -336 -7.08038 0.236
NP_440153.1_5 Reverse -283 -297 6.78443 0.176
NP_440153.1_5 Forward -184 -170 2.16287 0.237
NP_440153.1_8 Reverse -356 -369 -2.24233 0.235
NP_442064.1_4 Reverse -272 -291 4.22689 0.294
NP_443055.1_6 Forward -299 -281 -1.84987 0.284
NP_443055.1_6 Reverse -37 -55 -2.53818 0.296
NP_440602.1_8 Reverse -282 -296 15.9292 0.115
NP_440602.1_8 Reverse -260 -274 11.406 0.238
NP_440138.1_6 Forward -290 -271 0.883656 0.291
NP_441099.1_5 Forward -354 -335 -6.98204 0.168
NP_441099.1_5 Reverse -272 -291 -9.93197 0.237
NP_441099.1_5 Reverse -107 -126 -10.817 0.262
NP_442002.1_1 Reverse -251 -269 -5.48739 0.239
NP_442002.1_1 Reverse -70 -88 -9.12563 0.272
NP_442002.1_9 Forward -292 -285 10.7572 0.185
NP_441294.1_7 Forward -295 -281 16.6418 0.0133
NP_441646.1_1 Reverse -275 -294 5.11266 0.184
NP_441646.1_1 Reverse -346 -365 3.53937 0.206
NP_442438.1_10 Reverse -277 -291 9.04604 0.0692
NP_442438.1_10 Reverse -382 -396 1.96621 0.188
NP_442438.1_10 Forward -296 -282 1.76955 0.188
NP_442438.1_10 Forward -349 -335 -1.18038 0.296
NP_441000.1_6 Reverse -281 -295 5.01447 0.0933
NP_442771.1_1 Forward -293 -275 8.86894 0.0338
NP_440147.1_4 Forward -293 -280 3.36254 0.188
NP_440147.1_4 Reverse -280 -293 0.805932 0.244
NP_440147.1_4 Forward -154 -141 0.510939 0.252
NP_441295.1_4 Reverse -277 -296 -1.96717 0.29
NP_441550.1_8 Reverse -280 -290 12.3692 0.0336
NP_441550.1_8 Forward -293 -283 6.0761 0.214
NP_441550.1_8 Reverse -333 -343 4.69947 0.291
NP_441916.1_7 Reverse -282 -292 18.4663 0.00144
NP_441916.1_7 Forward -291 -281 10.3048 0.0261
NP_440206.1_4 Forward -349 -330 9.34008 0.191
NP_441041.1_4 Reverse -335 -354 -3.04881 0.119
NP_441041.1_4 Forward -291 -272 -6.39206 0.167
NP_441041.1_4 Forward -269 -250 -10.4236 0.232
NP_441041.1_4 Reverse -282 -301 -12.2919 0.262
NP_441041.1_7 Forward -294 -282 10.916 0.0864
NP_442396.1_5 Reverse -278 -291 9.55739 0.129
NP_442004.1_6 Forward -54 -40 12.586 0.104
NP_442004.1_6 Forward -291 -277 11.701 0.115
NP_442004.1_6 Reverse -117 -131 6.3911 0.174
NP_442004.1_6 Forward -108 -94 4.32615 0.218
NP_441725.1_4 Forward -349 -335 2.8506 0.279
NP_441725.1_5 Forward -290 -280 11.2881 0.0247
NP_441725.1_5 Reverse -283 -293 11.2881 0.0247
NP_441725.1_5 Forward -343 -333 1.35667 0.137
NP_441725.1_5 Forward -284 -274 -0.0199663 0.223
NP_439966.1_7 Forward -293 -283 18.4657 0.00473
NP_439966.1_7 Reverse -280 -290 15.8108 0.0124
NP_439966.1_7 Forward -346 -336 6.17443 0.191
NP_439966.1_9 Forward -293 -284 0.983037 0.253
NP_442941.1_3 Forward -290 -280 19.9412 0.00262
NP_442941.1_3 Reverse -283 -293 11.4848 0.0116
NP_442941.1_3 Reverse -301 -311 2.04498 0.146
NP_440289.1_2 Forward -294 -281 21.3571 0.00262
NP_440289.1_2 Forward -279 -266 -2.83231 0.262
NP_440289.1_2 Reverse -279 -292 -2.93064 0.262
NP_440983.1_5 Forward -309 -290 -2.36049 0.231
NP_440983.1_5 Forward -244 -225 -2.45882 0.231
NP_440983.1_5 Forward -291 -272 -3.3438 0.237
NP_442281.1_1 Forward -296 -282 20.7467 0.00192
NP_442281.1_1 Forward -349 -335 13.5686 0.0256
NP_442281.1_1 Reverse -277 -291 6.88214 0.113
NP_440177.1_9 Reverse -252 -271 12.6841 0.229
NP_440437.1_1 Forward -207 -188 -5.70374 0.292
NP_440647.1_9 Reverse -174 -192 2.87075 0.283
NP_440498.1_1 Forward -300 -282 -3.22577 0.259
NP_441644.1_6 Forward -291 -281 17.3841 0.00127
NP_441644.1_6 Reverse -282 -292 10.1076 0.0628
NP_441644.1_6 Reverse -260 -270 5.09279 0.21
NP_441644.1_6 Forward -344 -334 3.42118 0.282
NP_443049.1_6 Reverse -275 -285 11.6409 0.24
NP_442215.1_2 Forward -293 -277 -3.28472 0.213
NP_442029.1_1 Reverse -264 -283 -12.6852 0.254
NP_442029.1_6 Reverse -347 -366 3.34271 0.282
NP_442247.1_5 Reverse -210 -224 16.4927 0.234
NP_440253.1_2 Reverse -282 -300 20.472 0.00505
NP_440929.1_8 Forward -291 -282 19.2726 0.000701
NP_440929.1_8 Reverse -282 -291 19.2726 0.000701
NP_441346.1_5 Reverse -348 -367 17.8957 0.217
NP_442933.1_10 Forward -291 -282 17.601 0.00325
NP_442933.1_10 Reverse -282 -291 17.601 0.00325
NP_441751.2_8 Forward -290 -276 6.88276 0.0348
NP_441751.2_8 Reverse -283 -297 -2.65535 0.133
NP_441751.2_8 Reverse -118 -132 -6.68692 0.277
NP_442554.1_8 Forward -290 -280 15.9097 0.00747
NP_442554.1_8 Reverse -283 -293 13.8447 0.0145
NP_442554.1_8 Reverse -261 -271 4.10993 0.198
NP_442554.1_8 Forward -284 -274 4.0116 0.2
NP_441762.1_7 Reverse -281 -293 2.89058 0.0676
NP_441762.1_7 Forward -292 -280 2.30059 0.0676
NP_442313.1_5 Reverse -277 -296 4.916 0.263
NP_442142.1_4 Forward -294 -281 15.85 0.0264
NP_442142.1_4 Reverse -279 -292 8.77016 0.108
NP_442292.1_1 Forward -290 -281 18.486 0.00229
NP_442292.1_1 Reverse -283 -292 9.63616 0.0183
NP_441525.1_1 Reverse -41 -54 18.8988 0.0967
NP_440895.1_10 Forward -267 -250 -5.07437 0.272
NP_442381.1_8 Forward -294 -275 -5.80207 0.15
NP_443009.1_5 Reverse -281 -292 18.3477 0.00265
NP_443009.1_5 Reverse -44 -55 10.2846 0.0792
NP_443009.1_5 Reverse -334 -345 7.92465 0.118
NP_442406.1_9 Reverse -61 -80 3.04771 0.271
NP_442301.1_2 Forward -279 -260 4.32522 0.281
NP_442408.2_1 Forward -344 -325 5.40766 0.143
NP_441715.1_4 Reverse -283 -293 16.303 0.0117
NP_441715.1_4 Forward -290 -280 14.828 0.0268
NP_440015.1_9 Forward -291 -273 8.7706 0.101
NP_440158.1_1 Reverse -206 -225 22.0105 0.0124
NP_440379.1_5 Forward -86 -67 -10.522 0.28
NP_441468.1_1 Forward -290 -283 15.8704 0.0124
NP_441468.1_1 Reverse -283 -290 15.8704 0.0124
NP_441468.1_1 Reverse -277 -284 3.97235 0.277
NP_441020.2_6 Reverse -280 -297 12.9202 0.0824
NP_441020.2_6 Reverse -258 -275 9.97027 0.156
NP_441020.2_6 Reverse -76 -93 8.29864 0.203
NP_441020.2_6 Reverse -333 -350 6.52869 0.262
NP_441015.1_10 Reverse -69 -88 5.70265 0.112
NP_441673.1_1 Forward -291 -282 20.8459 0.000698
NP_441673.1_1 Reverse -282 -291 20.8459 0.000698
NP_441673.1_1 Reverse -260 -269 -8.06341 0.254
NP_441096.1_5 Forward -180 -162 15.1613 0.297
NP_441956.1_9 Forward -351 -332 6.39097 0.274
NP_441826.1_2 Forward -297 -283 8.84938 0.068
NP_441826.1_2 Reverse -276 -290 6.98109 0.0899
NP_441826.1_2 Forward -291 -277 2.75286 0.12
NP_441826.1_2 Forward -269 -255 2.45787 0.127
NP_441826.1_2 Reverse -329 -343 -4.52363 0.296
NP_442490.1_9 Reverse -270 -289 -6.78538 0.275
NP_442868.1_6 Reverse -280 -290 9.91146 0.038
NP_442868.1_6 Forward -293 -283 0.963343 0.205
NP_441612.1_2 Forward -126 -116 15.1326 0.21
NP_441612.1_2 Forward -291 -281 8.54929 0.21
NP_442227.1_2 Forward -348 -329 -2.16383 0.271
NP_442427.1_8 Forward -300 -281 10.9142 0.156
NP_441944.1_3 Reverse -325 -344 14.7491 0.142
NP_442808.1_1 Forward -292 -282 18.4657 0.00201
NP_442808.1_1 Reverse -281 -291 8.63269 0.0481
NP_442808.1_1 Forward -345 -335 7.94438 0.0634
NP_442808.1_1 Forward -277 -267 7.0594 0.0892
NP_442808.1_1 Forward -286 -276 4.89613 0.185
NP_441882.1_6 Forward -170 -151 -1.47551 0.232
NP_441906.1_2 Forward -357 -338 3.04693 0.286
NP_442542.1_2 Forward -293 -280 11.4257 0.114
NP_442542.1_2 Reverse -274 -287 8.18076 0.16
NP_442113.1_10 Forward -351 -332 -7.27704 0.265
NP_442113.1_10 Forward -90 -71 -8.55534 0.282
NP_442050.1_5 Reverse -280 -290 16.4991 0.00812
NP_442050.1_5 Forward -293 -283 9.12434 0.193
NP_441114.1_3 Forward -283 -274 7.66954 0.231
NP_440558.1_2 Forward -111 -92 1.86774 0.175
NP_440558.1_2 Reverse -273 -292 0.884433 0.185
NP_440558.1_2 Forward -369 -350 -0.4922 0.203
NP_440111.2_2 Forward -349 -330 -1.18052 0.226
NP_440923.1_1 Reverse -203 -221 12.8997 0.208
NP_441518.1_3 Forward -301 -282 -5.70374 0.126
NP_441878.1_6 Forward -292 -282 10.4031 0.0176
NP_441878.1_6 Reverse -281 -291 10.4031 0.0176
NP_441878.1_6 Reverse -275 -285 2.24165 0.0462
NP_441878.1_6 Reverse -259 -269 -7.19813 0.21
NP_441878.1_6 Reverse -165 -175 -7.19813 0.21
NP_441036.1_4 Forward -281 -262 16.2241 0.0728
NP_441036.1_8 Forward -292 -282 17.7779 0.000554
NP_441036.1_8 Reverse -281 -291 8.33817 0.174
NP_441036.1_8 Reverse -259 -269 5.28991 0.295
NP_442650.1_2 Forward -291 -277 6.98109 0.13
NP_441557.1_5 Forward -291 -282 19.9609 0.000699
NP_441557.1_5 Reverse -282 -291 19.9609 0.000699
NP_441557.1_5 Reverse -335 -344 -0.786921 0.239
NP_441557.1_8 Forward -184 -174 10.796 0.275
NP_441445.1_1 Reverse -267 -286 12.0942 0.0754
NP_441445.1_1 Forward -300 -281 7.86593 0.124
NP_441445.1_1 Forward -256 -237 0.294447 0.278
NP_441590.1_4 Forward -355 -336 7.17681 0.25
NP_442962.1_5 Reverse -295 -314 6.68596 0.242
NP_442419.1_2 Reverse -277 -296 -0.000545616 0.243
NP_440084.1_8 Forward -224 -210 11.4707 0.247
NP_440084.1_8 Forward -225 -211 8.79688 0.299
NP_441308.1_8 Forward -293 -283 10.1081 0.22
NP_441458.1_10 Forward -86 -67 1.27776 0.292
NP_442830.1_5 Forward -356 -342 2.94893 0.25
NP_442830.1_5 Forward -41 -27 0.392333 0.294
NP_442192.1_8 Forward -366 -347 9.24257 0.294
NP_442183.1_1 Reverse -282 -296 19.4691 0.00583
NP_442183.1_1 Forward -291 -277 16.6175 0.0139
NP_442397.1_9 Forward -291 -272 19.174 0.114
NP_441549.1_9 Reverse -36 -54 -6.07737 0.198
NP_441549.1_9 Reverse -113 -131 -6.4707 0.2
NP_442347.1_2 Forward -290 -281 12.4878 0.056
NP_442347.1_2 Reverse -283 -292 11.1111 0.056
NP_442347.1_2 Reverse -118 -127 8.65285 0.0792
NP_442347.1_2 Forward -308 -299 7.07956 0.134
NP_442347.1_2 Forward -343 -334 4.42462 0.284
NP_442347.1_10 Forward -354 -340 14.9452 0.294
NP_442645.1_2 Reverse -274 -293 -6.78538 0.0946
NP_442645.1_2 Forward -293 -274 -18.8801 0.28
NP_442965.1_2 Reverse -330 -349 0.982764 0.19
NP_442965.1_2 Reverse -160 -179 -7.27704 0.268
NP_441037.1_4 Reverse -274 -284 11.8007 0.13
NP_441037.1_4 Forward -293 -283 7.02532 0.237
NP_442594.1_8 Reverse -157 -176 5.40766 0.247
NP_441633.1_3 Reverse -280 -293 1.29759 0.109
NP_441633.1_3 Forward -293 -280 -3.81562 0.177
NP_440136.1_2 Forward -290 -283 15.9687 0.0123
NP_440136.1_2 Reverse -283 -290 15.9687 0.0123
NP_440136.1_2 Reverse -336 -343 3.97235 0.288
NP_442590.1_9 Reverse -259 -278 8.65258 0.231
NP_442998.1_10 Forward -289 -282 15.5754 0.0102
NP_442998.1_10 Reverse -284 -291 15.5754 0.0102
NP_442998.1_10 Forward -342 -335 5.74231 0.255
NP_440299.1_1 Reverse -278 -291 22.7331 0.000547
NP_440299.1_1 Forward -289 -276 6.60689 0.136
NP_440299.1_1 Forward -295 -282 2.28034 0.292
NP_441799.1_1 Forward -156 -142 9.24208 0.0966
NP_441799.1_1 Forward -295 -281 8.75042 0.106
NP_441799.1_1 Reverse -278 -292 5.99717 0.187
NP_441799.1_4 Forward -312 -293 -5.9004 0.245
NP_440640.1_6 Reverse -25 -44 1.0811 0.266
NP_442802.1_3 Forward -370 -351 16.4207 0.223
NP_441007.1_10 Reverse -277 -290 1.10092 0.209
NP_442201.1_10 Reverse -165 -184 -14.7502 0.288
NP_440256.1_1 Reverse -279 -298 15.3391 0.00687
NP_440256.1_1 Forward -272 -253 -4.72043 0.164
NP_440256.1_1 Forward -155 -136 -6.09707 0.201
NP_440256.1_1 Forward -294 -275 -10.1286 0.295
NP_440709.1_1 Reverse -202 -221 9.24175 0.0794
NP_441559.1_8 Forward -205 -191 5.30946 0.0934
NP_441559.1_8 Forward -349 -335 -5.01529 0.245
NP_440915.1_6 Forward -348 -334 5.80112 0.0879
NP_440915.1_6 Reverse -256 -270 4.32615 0.097
NP_440915.1_6 Reverse -278 -292 3.53951 0.101
NP_440915.1_6 Forward -295 -281 -3.147 0.29
NP_441296.1_9 Forward -173 -160 11.3267 0.232
NP_441296.1_9 Reverse -118 -131 8.96682 0.287
NP_440717.1_3 Forward -341 -327 8.06211 0.27
NP_442785.1_9 Forward -58 -39 14.3549 0.261
NP_441704.1_8 Reverse -271 -290 5.2102 0.3
NP_440134.1_2 Reverse -343 -362 -1.08219 0.298
NP_441464.1_8 Forward -175 -161 11.7993 0.178
NP_441113.1_3 Forward -16 -2 14.6503 0.27
NP_440695.1_6 Reverse -244 -258 14.6775 0.213
NP_441199.1_6 Forward -295 -276 0.392778 0.243
NP_441199.1_7 Forward -224 -205 8.35759 0.159
NP_441494.1_6 Forward -367 -354 8.27909 0.23
NP_442993.1_1 Reverse -282 -298 1.63183 0.0504
NP_442993.1_1 Forward -291 -275 1.23851 0.056
NP_442993.1_1 Forward -181 -165 -12.8228 0.281
NP_442386.1_9 Forward -292 -283 15.7322 0.0144
NP_442386.1_9 Reverse -281 -290 13.8639 0.0289
NP_442386.1_9 Forward -345 -336 10.1274 0.139
NP_442386.1_9 Forward -286 -277 4.91586 0.276
NP_442386.1_10 Reverse -30 -43 4.8375 0.262
NP_442386.1_10 Reverse -345 -358 4.54251 0.262
NP_440570.1_5 Reverse -272 -291 0.392778 0.254
NP_441750.1_4 Forward -348 -329 6.4893 0.168
NP_441340.1_5 Forward -290 -283 15.6737 0.0124
NP_441340.1_5 Reverse -283 -290 15.6737 0.0124
NP_441340.1_5 Forward -284 -277 11.0522 0.0749
NP_441271.1_8 Forward -336 -326 13.648 0.272
NP_441947.1_10 Forward -293 -275 1.69077 0.276
NP_443028.1_5 Reverse -37 -50 20.4721 0.21
NP_442791.1_4 Reverse -336 -355 11.9958 0.292
NP_440168.1_4 Reverse -272 -291 -6.58872 0.26
NP_442240.1_2 Reverse -336 -355 -10.522 0.137
NP_440161.1_3 Reverse -280 -299 9.43923 0.247
NP_442714.1_7 Forward -284 -265 -1.08219 0.281
NP_440586.1_1 Reverse -77 -96 -4.42544 0.278
NP_440586.1_8 Forward -290 -283 13.2151 0.026
NP_440586.1_8 Reverse -283 -290 13.2151 0.026
NP_440586.1_8 Reverse -69 -76 9.08521 0.178
NP_442251.1_6 Forward -290 -283 15.2804 0.0124
NP_442251.1_6 Reverse -283 -290 15.2804 0.0124
NP_440684.1_9 Reverse -276 -290 14.8476 0.11
NP_440684.1_9 Forward -297 -283 9.04604 0.221
NP_441262.1_3 Reverse -282 -289 14.7888 0.0223
NP_441262.1_3 Forward -291 -284 14.7888 0.0223
NP_440027.1_3 Forward -354 -336 17.1279 0.0835
NP_440027.1_3 Forward -355 -337 4.14829 0.262
NP_440027.1_8 Forward -347 -328 8.55343 0.246
NP_440027.1_8 Forward -294 -275 6.29183 0.275
NP_443051.1_1 Reverse -281 -290 10.4228 0.00754
NP_443051.1_1 Forward -292 -283 10.4228 0.00754
NP_443051.1_1 Reverse -334 -343 5.40793 0.0926
NP_439937.1_8 Reverse -66 -85 -1.08219 0.248
NP_439937.1_9 Forward -202 -185 -13.5315 0.287
NP_440926.1_9 Forward -142 -123 8.25926 0.275
NP_441167.1_1 Forward -224 -205 8.45592 0.213
NP_440408.1_7 Reverse -153 -172 12.4875 0.21
NP_440439.1_1 Reverse -332 -345 6.80412 0.0722
NP_440439.1_1 Forward -294 -281 1.19926 0.159
NP_440439.1_1 Reverse -279 -292 0.0192843 0.203
NP_440439.1_6 Forward -224 -205 1.47442 0.286
NP_442239.1_8 Reverse -329 -348 5.01433 0.287
NP_440372.1_2 Forward -290 -283 16.3621 0.0124
NP_440372.1_2 Reverse -283 -290 16.3621 0.0124
NP_440372.1_2 Reverse -336 -343 4.07068 0.262
NP_440271.1_2 Reverse -150 -169 -0.39387 0.292
NP_441138.1_5 Reverse -232 -245 3.02202 0.297
NP_440574.1_2 Forward -70 -51 8.25926 0.242
NP_441789.1_7 Forward -353 -334 6.98015 0.193
NP_441789.1_7 Forward -82 -63 -4.91784 0.292
NP_441789.1_7 Forward -321 -302 -5.60616 0.299
NP_440819.1_5 Forward -16 -8 7.98423 0.228
NP_440819.1_5 Reverse -174 -182 6.41093 0.285
NP_440316.1_10 Reverse -275 -285 17.6796 0.153
NP_440316.1_10 Reverse -86 -96 5.97822 0.275
NP_439977.1_5 Forward -350 -331 10.4225 0.0831
NP_440139.1_1 Forward -297 -278 7.66846 0.127
NP_440210.1_9 Reverse -205 -224 16.8998 0.127
NP_440267.1_2 Forward -296 -282 9.43874 0.156
NP_442384.1_10 Forward -291 -278 17.7189 0.00567
NP_442384.1_10 Forward -344 -331 12.409 0.0283
NP_442384.1_10 Reverse -117 -130 4.44418 0.157
NP_442384.1_10 Reverse -143 -156 2.37923 0.228
NP_440693.1_8 Reverse -153 -172 11.8975 0.283
NP_441877.1_7 Forward -296 -277 7.27514 0.218
NP_441877.1_9 Forward -223 -206 16.4601 0.0735
NP_441018.1_7 Reverse -272 -291 7.17762 0.276
NP_442790.1_4 Reverse -273 -292 -6.39206 0.144
NP_442262.1_10 Forward -290 -283 14.1988 0.0123
NP_442262.1_10 Reverse -283 -290 14.1988 0.0123
NP_442262.1_10 Reverse -69 -76 9.18389 0.211
NP_442262.1_10 Forward -284 -277 7.90559 0.266
NP_441689.1_5 Reverse -280 -290 15.3192 0.0403
NP_441689.1_5 Forward -293 -283 8.53436 0.132
NP_441689.1_5 Reverse -333 -343 3.8145 0.291
NP_440163.1_10 Reverse -257 -267 16.303 0.0762
NP_440163.1_10 Forward -294 -284 15.2213 0.0762
NP_440163.1_10 Reverse -279 -289 10.4031 0.201
NP_440344.1_10 Forward -298 -281 9.57695 0.00836
NP_440344.1_10 Reverse -275 -292 -7.63097 0.118
NP_440344.1_10 Forward -133 -116 -12.8425 0.267
NP_440344.1_10 Reverse -184 -201 -12.9408 0.269
NP_440344.1_10 Forward -77 -60 -13.6292 0.29
NP_440344.1_10 Reverse -328 -345 -13.8258 0.296
NP_440531.1_6 Forward -193 -174 -1.18052 0.229
NP_440531.1_6 Reverse -268 -287 -1.37718 0.231
NP_440531.1_8 Forward -142 -123 6.4893 0.241
NP_442917.1_3 Forward -73 -54 6.29264 0.206
NP_440189.1_2 Reverse -274 -293 0.0977854 0.279
NP_441335.1_8 Reverse -265 -284 8.35759 0.264
NP_441965.1_3 Reverse -272 -291 -1.86883 0.297
NP_440297.1_9 Forward -290 -280 9.32148 0.0917
NP_440297.1_9 Reverse -283 -293 9.32148 0.0917
NP_440297.1_9 Forward -284 -274 1.16001 0.282
NP_440297.1_9 Forward -343 -333 -0.609952 0.292
NP_442280.1_10 Forward -167 -149 10.3244 0.223
NP_442280.1_10 Forward -162 -144 5.94143 0.28
NP_442280.1_10 Forward -172 -154 4.67522 0.296
NP_441592.1_4 Forward -291 -272 19.2723 0.0469
NP_441103.1_9 Forward -171 -161 12.8802 0.278
NP_440999.1_9 Forward -295 -281 4.62115 0.116
NP_440999.1_9 Forward -40 -26 -1.27871 0.232
NP_440999.1_9 Forward -348 -334 -1.47537 0.239
NP_440888.1_2 Forward -291 -277 19.3701 0.00153
NP_440888.1_2 Reverse -282 -296 14.5519 0.0168
NP_440888.1_2 Forward -269 -255 13.2736 0.0307
NP_440888.1_2 Forward -102 -88 5.50552 0.276
NP_440491.1_1 Forward -294 -275 9.84073 0.206
NP_442033.1_10 Forward -356 -337 -7.96535 0.188
NP_441543.1_2 Reverse -283 -292 18.486 0.00236
NP_441543.1_2 Forward -290 -281 16.9127 0.00359
NP_441543.1_2 Forward -284 -275 4.0313 0.293
NP_442845.1_2 Reverse -276 -290 18.6825 0.0608
NP_442845.1_2 Forward -291 -277 7.66941 0.195
NP_442845.1_2 Forward -114 -100 4.22782 0.264
NP_442845.1_2 Reverse -93 -107 3.44117 0.29
NP_441918.1_7 Reverse -281 -300 -3.73712 0.297
NP_442710.1_7 Forward -228 -209 1.23492 0.175
NP_441469.1_8 Forward -292 -283 16.126 0.00797
NP_441469.1_8 Reverse -191 -200 7.57121 0.227
NP_441469.1_8 Reverse -281 -290 6.48957 0.227
NP_442315.1_5 Reverse -75 -85 17.3846 0.277
NP_443064.1_6 Forward -291 -281 12.5669 0.0796
NP_443064.1_6 Forward -344 -334 10.4338 0.153
NP_443064.1_6 Forward -50 -40 8.59164 0.278
NP_442578.1_7 Forward -290 -283 14.5921 0.026
NP_442578.1_7 Reverse -283 -290 14.5921 0.026
NP_440710.1_1 Forward -277 -259 0.0191479 0.163
NP_440220.1_4 Forward -357 -338 -3.24622 0.285
NP_441462.1_2 Forward -291 -281 11.5831 0.00406
NP_441462.1_2 Reverse -282 -292 11.5831 0.00406
NP_441462.1_2 Reverse -260 -270 -0.708283 0.245
NP_441462.1_2 Reverse -335 -345 -0.904945 0.265
NP_443062.1_1 Forward -344 -326 3.47554 0.297
NP_443062.1_6 Forward -299 -280 4.03102 0.224
NP_443062.1_6 Forward -62 -43 3.83436 0.228
NP_440277.1_5 Forward -131 -113 12.8022 0.295
NP_442204.1_1 Reverse -331 -342 0.648657 0.281
NP_442204.1_1 Forward -58 -47 0.550326 0.281
NP_442204.1_1 Reverse -278 -289 0.255333 0.282
NP_442204.1_5 Reverse -272 -291 6.4893 0.142
NP_441560.1_8 Reverse -277 -296 15.2135 0.119
NP_440516.1_8 Forward -291 -282 16.9127 0.00442
NP_440516.1_8 Reverse -282 -291 16.9127 0.00442
NP_440516.1_8 Reverse -335 -344 -0.295266 0.232
NP_440516.1_8 Reverse -276 -285 -0.590259 0.283
NP_441785.1_1 Reverse -282 -296 14.3866 0.161
NP_442428.1_4 Forward -292 -273 12.3892 0.131
NP_442428.1_5 Forward -290 -283 15.8704 0.0124
NP_442428.1_5 Reverse -283 -290 15.8704 0.0124
NP_442428.1_5 Reverse -277 -284 4.36568 0.271
NP_442859.1_2 Reverse -336 -355 6.19431 0.199
NP_440673.1_3 Forward -289 -282 12.4288 0.0426
NP_440673.1_3 Reverse -284 -291 12.4288 0.0426
NP_440673.1_7 Reverse -271 -290 5.11266 0.183
NP_441052.1_2 Forward -291 -281 19.9412 0.00106
NP_441052.1_2 Reverse -282 -292 10.5014 0.0285
NP_441052.1_2 Forward -126 -116 4.10993 0.166
NP_441052.1_2 Reverse -276 -286 3.81494 0.173
NP_442219.1_8 Forward -295 -276 12.2257 0.165
NP_442219.1_9 Forward -290 -281 17.7976 0.00718
NP_442219.1_9 Reverse -283 -292 8.35786 0.0681
NP_440436.1_4 Reverse -283 -292 18.1905 0.00233
NP_440436.1_4 Forward -290 -281 17.2072 0.00233
NP_440436.1_4 Reverse -46 -55 9.04574 0.092
NP_441884.1_8 Reverse -334 -353 13.6675 0.0405
NP_441884.1_9 Forward -294 -275 -23.01 0.284
NP_441893.1_8 Reverse -69 -88 15.9291 0.216
NP_442864.1_7 Reverse -159 -177 10.0489 0.274
NP_442864.1_7 Reverse -329 -347 5.62401 0.274
NP_440314.1_9 Forward -284 -265 -9.63698 0.273
NP_441719.1_4 Forward -290 -283 16.3621 0.0124
NP_441719.1_4 Reverse -283 -290 16.3621 0.0124
NP_441733.1_10 Reverse -279 -292 7.19745 0.156
NP_441733.1_10 Reverse -332 -345 5.91914 0.203
NP_441004.1_1 Reverse -160 -179 1.57275 0.111
NP_441004.1_1 Reverse -330 -349 -8.35868 0.2
NP_441004.1_1 Reverse -276 -295 -12.5869 0.247
NP_441004.1_2 Reverse -155 -174 2.26107 0.215
NP_442813.1_4 Reverse -327 -346 -1.08219 0.236
NP_442366.1_3 Forward -292 -274 13.8838 0.024
NP_442366.1_3 Forward -345 -327 -3.32411 0.246
NP_442366.1_3 Forward -115 -97 -4.50408 0.272
NP_440129.1_10 Reverse -328 -342 6.29277 0.177
NP_441115.1_8 Reverse -23 -41 12.2122 0.292
NP_442694.1_9 Forward -245 -226 7.96426 0.278
NP_443054.1_2 Reverse -280 -294 12.4876 0.0722
NP_443054.1_2 Forward -73 -59 1.57289 0.245
NP_443054.1_2 Reverse -76 -90 0.392915 0.267
NP_443054.1_2 Reverse -189 -203 0.0979218 0.278
NP_442308.1_3 Reverse -338 -357 11.2092 0.275
NP_441851.1_10 Forward -292 -282 16.008 0.00552
NP_441851.1_10 Reverse -281 -291 15.8113 0.00552
NP_441851.1_10 Reverse -40 -50 9.02648 0.114
NP_441851.1_10 Reverse -334 -344 7.74818 0.132
NP_441851.1_10 Forward -55 -45 4.69992 0.254
NP_442208.1_5 Reverse -24 -43 -8.85033 0.282
NP_442856.1_7 Reverse -273 -292 -3.3438 0.243
NP_441668.1_4 Forward -140 -121 3.24438 0.187
NP_442515.1_1 Reverse -281 -295 2.75286 0.13
NP_442515.1_1 Forward -292 -278 2.35953 0.137
NP_441396.1_5 Reverse -35 -44 8.55452 0.21
NP_441396.1_5 Reverse -340 -349 7.27622 0.29
NP_441540.1_4 Reverse -206 -225 14.7512 0.252
NP_440463.1_8 Reverse -259 -278 8.95209 0.252
NP_440338.1_4 Reverse -211 -230 7.37347 0.28
NP_440940.1_7 Forward -301 -283 2.57501 0.298
NP_441349.1_10 Reverse -272 -291 -1.37718 0.103
NP_442024.1_9 Reverse -284 -297 18.8005 0.123
NP_441409.1_6 Reverse -276 -295 -9.14533 0.18
NP_441394.1_2 Reverse -67 -86 15.1424 0.265
NP_440432.1_9 Reverse -283 -298 7.35472 0.0427
NP_442843.1_1 Reverse -283 -302 -1.47551 0.197
NP_439960.1_10 Reverse -67 -85 -1.75081 0.245
NP_440474.1_8 Reverse -283 -297 7.47213 0.204
NP_441150.1_5 Reverse -197 -215 15.3588 0.227
NP_441150.1_6 Reverse -42 -61 14.0599 0.256
NP_441477.1_5 Forward -146 -127 9.73422 0.268
NP_441477.1_10 Forward -71 -53 -1.06249 0.299
NP_442450.1_5 Reverse -280 -290 9.32148 0.115
NP_442450.1_5 Forward -293 -283 9.32148 0.115
NP_440588.1_2 Reverse -273 -292 16.7157 0.0108
NP_442237.1_4 Forward -235 -217 17.3811 0.12
NP_440195.1_4 Forward -303 -284 12.7825 0.127
NP_441570.1_1 Reverse -282 -300 1.59244 0.0299
NP_441570.1_1 Reverse -260 -278 -1.16082 0.0543
NP_441570.1_1 Forward -291 -273 -7.25734 0.0879
NP_441570.1_1 Forward -70 -52 -16.1071 0.238
NP_441570.1_1 Reverse -276 -294 -16.7954 0.254
NP_440078.1_10 Forward -291 -272 9.63589 0.195
NP_441078.1_4 Forward -291 -282 19.6659 0.0007
NP_441078.1_4 Reverse -282 -291 19.6659 0.0007
NP_441078.1_4 Reverse -276 -285 6.09625 0.0863
NP_441078.1_4 Reverse -260 -269 -1.77023 0.266
NP_441078.1_4 Forward -285 -276 -2.06522 0.295
NP_442729.1_8 Reverse -278 -291 17.9155 0.0343
NP_441539.1_1 Forward -221 -207 13.6669 0.284
NP_442443.1_1 Reverse -35 -54 -0.885524 0.227
NP_442443.1_1 Forward -370 -351 -6.1954 0.293
NP_442443.1_1 Reverse -261 -280 -6.1954 0.293
NP_442443.1_1 Reverse -124 -143 -6.78538 0.298
NP_441091.1_5 Forward -295 -276 2.3594 0.29
NP_440526.1_3 Reverse -283 -294 1.92649 0.267
NP_440526.1_3 Forward -290 -279 0.943182 0.267
NP_441432.1_8 Reverse -281 -290 16.8143 0.00595
NP_441432.1_8 Forward -153 -144 11.9961 0.0519
NP_441432.1_8 Forward -292 -283 8.25953 0.0755
NP_441432.1_8 Reverse -275 -284 4.32629 0.223
NP_441432.1_9 Reverse -222 -235 11.2162 0.235
NP_442320.1_8 Reverse -276 -290 14.2576 0.0136
NP_442320.1_8 Forward -297 -283 12.9793 0.0155
NP_442344.1_7 Forward -290 -271 -6.39206 0.171
NP_441732.1_2 Reverse -278 -294 -16.4611 0.167
NP_441732.1_2 Forward -295 -279 -16.5594 0.174
NP_442003.1_4 Reverse -28 -47 9.93088 0.296
NP_440760.1_1 Forward -291 -272 4.62101 0.0156
NP_442797.1_7 Forward -292 -274 6.80398 0.198
NP_440199.1_10 Forward -294 -284 14.533 0.0861
NP_440199.1_10 Reverse -279 -289 7.64985 0.231
NP_440578.1_4 Forward -66 -47 11.0125 0.247
NP_442510.1_5 Reverse -273 -292 13.0775 0.248
NP_442727.1_1 Reverse -290 -304 12.3893 0.268
NP_442727.1_1 Reverse -288 -302 10.6193 0.297
NP_440713.1_4 Reverse -51 -70 8.16093 0.172
NP_440713.1_4 Reverse -272 -291 4.71934 0.223
NP_440713.1_4 Reverse -330 -349 3.44104 0.244
NP_440713.1_4 Forward -136 -117 2.55606 0.26
NP_440713.1_4 Forward -162 -143 1.76941 0.279
NP_442489.1_2 Forward -302 -283 1.57275 0.285
NP_442489.1_7 Forward -291 -282 20.1576 0.000695
NP_442489.1_7 Reverse -282 -291 20.1576 0.000695
NP_442489.1_7 Reverse -260 -269 -1.27858 0.185
NP_442489.1_7 Reverse -276 -285 -1.6719 0.235
NP_440565.1_7 Forward -373 -354 1.17943 0.246
NP_441706.1_10 Reverse -279 -298 9.0459 0.249
NP_440559.1_1 Forward -290 -281 17.4043 0.00658
NP_440559.1_1 Reverse -283 -292 8.75118 0.0586
NP_441659.2_6 Forward -219 -200 13.175 0.292
NP_441659.2_8 Forward -291 -281 18.1713 0.00133
NP_441659.2_8 Reverse -282 -292 11.9764 0.0147
NP_441659.2_8 Forward -344 -334 4.10993 0.144
NP_441659.2_8 Forward -269 -259 3.81494 0.15
NP_442913.1_9 Reverse -276 -295 8.35759 0.257
NP_441040.1_2 Forward -183 -164 -0.983855 0.129
NP_441040.1_5 Reverse -271 -290 8.94757 0.226
NP_440315.1_6 Forward -306 -290 1.82849 0.227
NP_442346.1_5 Reverse -281 -291 16.6963 0.00248
NP_442346.1_5 Reverse -313 -323 9.7148 0.118
NP_442346.1_5 Forward -292 -282 9.02648 0.118
NP_442346.1_5 Reverse -275 -285 4.99491 0.267
NP_440831.1_3 Reverse -273 -292 15.5124 0.104
NP_441629.1_3 Forward -276 -257 -3.34455 0.277
NP_440010.1_4 Forward -295 -276 9.53674 0.169
NP_441943.1_8 Forward -340 -321 -12.7836 0.261
NP_442603.1_7 Forward -291 -277 12.6836 0.0948
NP_442603.1_7 Forward -344 -330 10.422 0.126
NP_441888.1_7 Forward -296 -282 2.35953 0.225
NP_440946.1_10 Forward -33 -15 17.5212 0.142
NP_441948.1_4 Forward -298 -280 -2.53746 0.169
NP_441833.1_4 Forward -290 -283 15.9687 0.0124
NP_441833.1_4 Reverse -283 -290 15.9687 0.0124
NP_442162.1_9 Forward -290 -283 16.2637 0.0124
NP_442162.1_9 Reverse -283 -290 16.2637 0.0124
NP_442796.1_2 Reverse -47 -66 14.8809 0.24
NP_440671.1_1 Forward -223 -204 26.8988 0.00274
NP_440671.1_4 Forward -297 -283 15.8309 0.0373
NP_440671.1_4 Reverse -276 -290 12.586 0.105
NP_440671.1_4 Reverse -254 -268 8.35772 0.201
NP_440671.1_6 Forward -357 -338 28.3179 0.000134
NP_440671.1_9 Forward -252 -239 22.0454 0.0862
NP_441973.1_1 Forward -196 -181 0.864876 0.235
NP_442045.1_5 Reverse -326 -345 -1.57384 0.29
NP_442140.1_3 Reverse -283 -293 8.33817 0.119
NP_442140.1_3 Forward -284 -274 6.17489 0.184
NP_442140.1_3 Forward -290 -280 4.40493 0.243
NP_440875.1_9 Reverse -284 -294 8.37203 0.233
NP_441813.1_5 Forward -293 -283 17.188 0.00979
NP_441813.1_5 Reverse -280 -290 15.9097 0.01
NP_441813.1_5 Forward -346 -336 5.68323 0.113
NP_442254.1_1 Forward -66 -47 5.11266 0.183
NP_440590.1_4 Forward -290 -277 10.8357 0.0239
NP_440590.1_4 Reverse -336 -349 1.9859 0.105
NP_440590.1_4 Reverse -62 -75 -3.52063 0.255
NP_440590.1_4 Reverse -283 -296 -3.81562 0.255
NP_440567.1_1 Forward -290 -276 11.8976 0.0265
NP_440567.1_4 Reverse -264 -283 0.491109 0.281
NP_442497.1_10 Forward -290 -281 10.4228 0.0087
NP_442497.1_10 Reverse -283 -292 10.4228 0.0087
NP_442497.1_10 Forward -284 -275 0.29472 0.199
NP_442497.1_10 Forward -343 -334 0.196389 0.208
NP_440821.1_4 Forward -293 -283 19.0562 0.00399
NP_440821.1_4 Reverse -280 -290 18.2696 0.00448
NP_440821.1_4 Reverse -333 -343 6.96153 0.0781
NP_441239.1_9 Forward -293 -281 13.3137 0.037
NP_441239.1_9 Reverse -280 -292 6.92215 0.173
NP_441239.1_9 Forward -346 -334 5.05386 0.231
NP_441239.1_9 Forward -271 -259 4.46387 0.253
NP_441239.1_9 Forward -79 -67 3.08724 0.296
NP_441951.1_9 Forward -337 -318 3.53937 0.254
NP_441009.1_10 Forward -290 -271 17.0099 0.152
NP_440400.1_1 Forward -353 -334 4.42355 0.22
NP_441892.1_1 Forward -300 -283 1.21881 0.155
NP_441892.1_1 Forward -294 -277 -4.28772 0.258
NP_440665.1_1 Reverse -45 -64 -11.6036 0.244
NP_442044.1_1 Forward -131 -112 -5.40875 0.187
NP_442044.1_1 Forward -54 -35 -14.4552 0.291
NP_442044.1_9 Forward -259 -240 3.53937 0.253
NP_442270.1_9 Reverse -271 -290 -9.53865 0.235
NP_441508.1_1 Forward -220 -201 15.7475 0.104
NP_441508.1_1 Reverse -206 -225 12.3837 0.23
NP_441017.1_6 Reverse -278 -292 14.7486 0.138
NP_441017.1_6 Forward -295 -281 12.487 0.217
NP_440900.1_5 Reverse -255 -274 15.8248 0.24
NP_440949.1_7 Forward -299 -280 18.2882 0.114
NP_440354.1_7 Reverse -276 -294 14.4738 0.167
NP_442138.1_10 Reverse -282 -301 1.96607 0.12
NP_442138.1_10 Reverse -260 -279 -1.18052 0.171
NP_440546.1_4 Reverse -282 -292 11.8882 0.0679
NP_440546.1_4 Reverse -335 -345 11.2095 0.0923
NP_440546.1_4 Forward -291 -281 10.046 0.109
NP_440546.1_4 Forward -54 -44 8.59164 0.181
NP_440546.1_4 Reverse -276 -286 7.42815 0.241
NP_440546.1_4 Forward -108 -98 6.74945 0.282
NP_440462.1_6 Forward -293 -283 15.418 0.0142
NP_440462.1_6 Reverse -280 -290 7.74818 0.0699
NP_440462.1_6 Forward -346 -336 3.81494 0.228
NP_440868.1_4 Forward -295 -283 8.49544 0.0602
NP_440868.1_4 Reverse -278 -290 -0.944332 0.284
NP_442499.1_1 Forward -290 -271 13.2741 0.201
NP_442499.1_10 Reverse -55 -74 16.6125 0.232
NP_441868.1_4 Forward -133 -119 13.0776 0.282
NP_442402.1_2 Reverse -3 -17 13.4703 0.263
NP_442402.1_4 Forward -110 -91 -9.44104 0.29
NP_441084.1_6 Reverse -156 -170 9.92586 0.257
NP_440696.1_3 Reverse -335 -353 2.47742 0.216
NP_442039.1_4 Forward -290 -283 15.1821 0.0124
NP_442039.1_4 Reverse -283 -290 15.1821 0.0124
NP_441811.1_1 Reverse -113 -132 8.65258 0.28
NP_441811.1_8 Reverse -276 -290 14.5526 0.171
NP_441811.1_8 Reverse -111 -125 7.27608 0.251
NP_441811.1_8 Forward -57 -43 6.6861 0.265
NP_440008.1_9 Reverse -276 -295 9.3409 0.282
NP_441926.1_3 Forward -291 -275 5.07341 0.174
NP_441053.1_3 Reverse -121 -140 -3.54046 0.299
NP_442837.1_3 Forward -290 -283 15.7721 0.0124
NP_442837.1_3 Reverse -283 -290 15.7721 0.0124
NP_442837.1_3 Reverse -118 -125 6.52896 0.2
NP_442053.1_1 Forward -291 -282 18.3876 0.0007
NP_442053.1_1 Reverse -282 -291 18.3876 0.0007
NP_440505.1_3 Reverse -280 -290 16.303 0.00696
NP_440505.1_3 Forward -293 -283 13.8447 0.0247
NP_440505.1_3 Reverse -333 -343 5.19158 0.241
NP_442360.1_5 Forward -337 -327 13.2547 0.28
NP_441102.1_1 Reverse -283 -302 9.3409 0.157
NP_441203.1_1 Forward -290 -271 -12.5869 0.143
NP_441203.1_1 Forward -343 -324 -20.3551 0.297
NP_441408.2_7 Forward -293 -274 -3.63879 0.274
NP_440914.1_1 Forward -291 -281 17.5935 0.000537
NP_440914.1_1 Reverse -282 -292 8.6151 0.186
NP_441011.1_8 Reverse -283 -292 16.9127 0.00602
NP_441011.1_8 Forward -290 -281 8.25953 0.144
NP_441011.1_8 Reverse -336 -345 5.11294 0.283
NP_442533.1_1 Reverse -75 -94 -15.0452 0.248
NP_442533.1_6 Forward -291 -282 17.2076 0.00137
NP_442533.1_6 Reverse -282 -291 17.2076 0.00137
NP_442533.1_6 Forward -269 -260 5.21127 0.15
NP_442533.1_6 Reverse -99 -108 4.22796 0.186
NP_442533.1_6 Forward -344 -335 3.83464 0.202
NP_442533.1_6 Reverse -260 -269 3.83464 0.202
NP_442533.1_6 Forward -355 -346 3.63797 0.206
NP_442541.1_10 Forward -356 -342 1.96562 0.27
NP_442322.1_4 Forward -96 -79 -1.63347 0.226
NP_442322.1_4 Forward -358 -341 -8.31994 0.286
NP_442322.1_4 Forward -352 -335 -9.10659 0.287
NP_441482.1_7 Reverse -276 -290 8.25939 0.0181
NP_441482.1_7 Forward -297 -283 -1.37704 0.0683
NP_441482.1_7 Forward -350 -336 -2.85201 0.1
NP_441482.1_7 Reverse -329 -343 -9.44018 0.202
NP_441482.1_7 Reverse -254 -268 -11.2101 0.245
NP_439944.1_9 Forward -290 -280 19.0562 0.00329
NP_439944.1_9 Reverse -283 -293 10.3048 0.0887
NP_439944.1_9 Reverse -277 -287 4.79825 0.296
NP_442269.1_1 Reverse -86 -105 11.3075 0.119
NP_441697.1_5 Reverse -209 -228 -9.59736 0.271
NP_441028.1_6 Reverse -7 -17 10.6976 0.197
NP_441028.1_6 Reverse -8 -18 7.74772 0.218
NP_441028.1_6 Reverse -118 -128 3.42118 0.296
NP_441527.1_4 Forward -237 -218 -1.67153 0.148
NP_441527.1_4 Reverse -179 -198 -11.4117 0.282
NP_442728.1_1 Forward -93 -74 7.57094 0.248
NP_439965.1_1 Forward -135 -116 4.916 0.083
NP_441680.1_4 Forward -346 -327 3.83436 0.213
NP_441680.1_4 Forward -347 -328 -2.0655 0.266
NP_441347.1_5 Reverse -138 -152 13.4703 0.238
NP_441602.1_3 Reverse -277 -296 -4.6221 0.269
NP_441106.1_1 Forward -292 -283 18.191 0.0028
NP_441106.1_1 Reverse -281 -290 9.63616 0.0311
NP_441106.1_3 Forward -224 -205 13.0775 0.195
NP_439903.1_6 Forward -294 -275 13.8633 0.0781
NP_439903.1_6 Forward -272 -253 2.55527 0.225
NP_439903.1_6 Forward -365 -346 0.883656 0.256
NP_441286.1_1 Reverse -281 -293 14.4936 0.00418
NP_441286.1_1 Forward -292 -280 11.8387 0.0114
NP_441286.1_1 Reverse -116 -128 -5.56589 0.208
NP_440670.1_8 Forward -291 -282 18.3876 0.000699
NP_440670.1_8 Reverse -282 -291 18.3876 0.000699
NP_440670.1_8 Reverse -61 -70 3.24465 0.29
NP_442908.1_1 Reverse -295 -314 1.96607 0.277
NP_440886.1_7 Forward -292 -282 17.7774 0.0011
NP_440886.1_7 Reverse -281 -291 7.94438 0.0805
NP_440886.1_7 Forward -270 -260 5.48612 0.181
NP_440886.1_7 Forward -345 -335 5.09279 0.201
NP_440886.1_7 Forward -44 -34 3.71617 0.267
NP_442614.1_2 Forward -15 -1 12.3893 0.162
NP_442614.1_2 Reverse -165 -179 7.27608 0.275
NP_442614.1_2 Forward -54 -40 6.3911 0.291
NP_439995.1_5 Reverse -380 -399 3.53937 0.299
NP_442072.1_9 Reverse -281 -299 -14.1405 0.133
NP_442401.1_2 Forward -55 -36 9.43841 0.206
NP_439899.1_1 Forward -224 -206 18.8852 0.031
NP_440907.2_8 Reverse -283 -293 7.84605 0.117
NP_440907.2_8 Forward -343 -333 7.0594 0.132
NP_441021.1_1 Forward -174 -155 1.96607 0.083
NP_441021.1_1 Forward -290 -271 0.392778 0.0911
NP_441021.1_8 Reverse -277 -295 3.16574 0.234
NP_441463.1_3 Forward -301 -282 1.27776 0.127
NP_441463.1_3 Reverse -272 -291 -8.94866 0.276
NP_441463.1_6 Reverse -280 -294 5.64286 0.287
NP_441463.1_6 Forward -293 -279 5.35296 0.291
NP_441626.1_2 Forward -290 -283 15.7721 0.0124
NP_441626.1_2 Reverse -283 -290 15.7721 0.0124
NP_442365.1_7 Reverse -278 -297 -4.42544 0.245
NP_440107.1_2 Reverse -148 -167 8.75091 0.299
NP_442794.1_1 Reverse -278 -290 16.8536 0.0276
NP_442615.1_1 Reverse -273 -291 -2.14413 0.139
NP_441962.1_4 Reverse -277 -296 1.47442 0.103
NP_441962.1_4 Reverse -161 -180 -13.9635 0.28
NP_440387.1_1 Forward -291 -275 23.953 0.00129
NP_440387.1_1 Forward -126 -110 -1.41643 0.142
NP_440387.1_1 Reverse -282 -298 -2.39974 0.147
NP_440855.1_5 Forward -293 -274 5.70185 0.285
NP_441993.1_1 Reverse -276 -295 11.3026 0.115
NP_441993.1_1 Reverse -160 -179 1.75177 0.27
NP_440114.1_10 Reverse -282 -296 15.7325 0.0234
NP_440114.1_10 Reverse -260 -274 6.88276 0.253
NP_441510.2_7 Forward -297 -283 13.077 0.28
NP_441272.1_7 Reverse -292 -302 13.353 0.257
NP_440293.1_3 Reverse -339 -358 -4.6221 0.264
NP_440293.1_3 Reverse -258 -277 -4.6221 0.264
NP_440766.1_4 Reverse -331 -345 12.3893 0.054
NP_440766.1_4 Reverse -278 -292 9.43936 0.0871
NP_441421.1_6 Reverse -207 -224 16.8587 0.21
NP_439988.1_3 Reverse -342 -356 10.0294 0.233
NP_439988.1_7 Forward -115 -101 12.487 0.292
NP_441979.1_5 Reverse -276 -295 -12.2919 0.228
NP_439910.1_2 Forward -299 -282 5.64371 0.0269
NP_442867.1_8 Forward -85 -66 6.09597 0.27
NP_440457.1_1 Reverse -331 -343 17.8369 0.0426
NP_440457.1_1 Forward -130 -118 8.10212 0.101
NP_440457.1_1 Reverse -278 -290 7.02048 0.105
NP_440457.1_1 Reverse -256 -268 4.46387 0.161
NP_440457.1_1 Forward -295 -283 0.0389777 0.25
NP_440457.1_1 Reverse -161 -173 -0.0593532 0.25
NP_442940.1_2 Forward -52 -33 3.93269 0.253
NP_442940.1_2 Forward -103 -84 1.57275 0.295
NP_441801.1_4 Reverse -325 -335 2.53664 0.292
NP_440801.1_8 Forward -292 -273 4.03102 0.211
NP_441984.1_3 Forward -295 -277 5.52568 0.282
NP_441436.1_8 Reverse -164 -183 7.47261 0.293
NP_441436.1_9 Forward -357 -347 16.8925 0.27
NP_440473.1_9 Reverse -379 -398 -10.1286 0.27
NP_442509.1_9 Reverse -282 -292 16.2041 0.00739
NP_442509.1_9 Reverse -165 -175 9.616 0.192
NP_442509.1_9 Forward -291 -281 8.14104 0.192
NP_442509.1_9 Reverse -117 -127 7.94438 0.195
NP_440554.1_4 Reverse -283 -293 14.6313 0.02
NP_440554.1_4 Forward -290 -280 7.05986 0.106
NP_441885.1_5 Forward -291 -281 20.9245 0.000538
NP_441885.1_5 Reverse -282 -292 11.4848 0.00668
NP_441885.1_5 Reverse -276 -286 0.766681 0.123
NP_441885.1_5 Reverse -335 -345 -1.78992 0.284
NP_442703.1_4 Forward -291 -272 9.7334 0.183
NP_442341.1_7 Forward -292 -278 17.4042 0.012
NP_442341.1_7 Reverse -281 -295 10.0294 0.0682
NP_442341.1_7 Reverse -60 -74 2.75286 0.247
NP_442341.1_9 Forward -293 -279 6.88214 0.21
NP_441756.1_5 Forward -348 -329 0.392778 0.234
NP_441756.1_5 Forward -43 -24 -1.47551 0.257
NP_441173.1_9 Reverse -8 -16 9.75379 0.284
NP_442395.2_4 Forward -292 -273 21.5331 0.0143
NP_442395.2_4 Forward -345 -326 5.11187 0.169
NP_440423.1_6 Forward -299 -280 -15.0452 0.229
NP_443000.1_7 Reverse -280 -290 17.0896 0.00865
NP_443000.1_7 Forward -293 -283 8.73149 0.0437
NP_440507.2_3 Reverse -273 -292 21.4347 0.0116
NP_441842.1_8 Forward -353 -335 15.063 0.274
NP_440275.1_3 Forward -293 -283 8.4365 0.0602
NP_440275.1_3 Reverse -280 -290 8.1415 0.0602
NP_440091.1_1 Forward -295 -283 18.3285 0.0114
NP_440091.1_1 Reverse -278 -290 -0.452677 0.273
NP_442275.1_1 Forward -365 -346 1.47442 0.284
NP_440679.1_5 Forward -288 -269 7.37428 0.292
NP_440679.1_10 Reverse -284 -303 -18.2901 0.278
NP_440149.1_8 Reverse -282 -301 5.70265 0.0745
NP_440149.1_8 Forward -291 -272 1.86774 0.117
NP_440149.1_8 Reverse -276 -295 -8.06369 0.298
NP_441105.1_3 Reverse -271 -290 3.14605 0.0936
NP_441105.1_3 Forward -296 -277 -4.03212 0.19
NP_442373.1_2 Forward -374 -355 -7.4737 0.233
NP_440216.1_1 Reverse -282 -296 6.29277 0.0156
NP_440216.1_1 Forward -291 -277 -10.7185 0.146
NP_440216.1_1 Forward -185 -171 -11.4068 0.184
NP_440216.1_9 Reverse -155 -164 9.83282 0.286
NP_440216.1_9 Forward -75 -66 7.47288 0.286
NP_440172.1_1 Forward -291 -281 15.0247 0.00945
NP_440172.1_1 Reverse -282 -292 8.73149 0.0586
NP_440172.1_1 Reverse -276 -286 3.61828 0.222
NP_442015.1_10 Reverse -278 -291 10.2457 0.04
NP_442015.1_10 Forward -58 -45 2.67422 0.187
NP_442015.1_10 Forward -348 -335 2.2809 0.196
NP_442015.1_10 Reverse -101 -114 1.10092 0.213
NP_442015.1_10 Forward -295 -282 0.904263 0.216
NP_441226.1_7 Forward -290 -283 14.4934 0.0123
NP_441226.1_7 Reverse -283 -290 14.4934 0.0123
NP_441226.1_7 Forward -343 -336 8.59356 0.197
NP_441111.1_7 Forward -290 -282 18.7023 0.00294
NP_441111.1_7 Reverse -283 -291 18.7023 0.00294
NP_441766.1_2 Forward -291 -282 17.5026 0.00297
NP_441766.1_2 Reverse -282 -291 17.5026 0.00297
NP_442417.1_5 Forward -269 -255 7.9644 0.168
NP_442417.1_5 Forward -344 -330 5.1128 0.275
NP_440416.1_9 Reverse -328 -347 7.96426 0.0325
NP_440416.1_9 Forward -351 -332 -15.2418 0.187
NP_440416.1_9 Reverse -275 -294 -16.5201 0.216
NP_443052.1_8 Forward -301 -282 -10.6203 0.212
NP_443052.1_9 Forward -43 -24 -6.1954 0.279
NP_442403.1_8 Reverse -284 -303 1.57275 0.239
NP_440591.1_9 Reverse -275 -293 16.1454 0.0782
NP_440261.1_5 Forward -284 -271 -2.83231 0.0932
NP_440261.1_5 Forward -343 -330 -10.9938 0.23
NP_440988.1_5 Forward -334 -315 13.4458 0.275
NP_440988.1_10 Forward -340 -326 4.22114 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CACTGATCACTGCTATGCGTAAATCCTTCCGGGGTGGAAGTGTCTGCCCAAGCCCCACCGATCCCCCTGGGGAAGTTAACCATGACCCGCTAATGATCCCAACAAAAACGGCGATCGCCATAGCCCAGAAAGCCCACCGCCGTAGCTTGAGTTTGTTATCATCAGAAAAGTCACGAAAATGTAAAGTTTTGTAACGCACAGGCATTTCCCCTTGAAGCTTTCTCCGGCCGTTTCCCCTTCCCTTGCTTGGCATTCACTGGACCTACTCTGGCAGGGGGATCAACACGACGTTAGGCATGGTCTACCCCACAGCGTCCTGCCCCCTCCATGGCAGATCCTCATCCTCGGGGATGGTTCCCCCACCAGGCACCTGCAACTACTCACCGGGGAAAAGACAGAG

CDS

GTGGATGTGATTGACATGGCTCCAGTGAGCCCCAGGGACGACGGCGCTCCCCCCCAAATTAACACGGTGCCCGGCCCCCACCTGCGGCGACAGGTATGGCTAAGGACCAAGTCTGGCCAAAGACTGGCCTATGCGGTTTCCTGGTGGGATGCTAGCCATGTGGACGAGTATTTGCAAAATCGTAGTTTACCCATTTGGGACAGCCTTTCCCGGTTGCACACCGAGCTGTATCGGGATATCCAAGCCATATACTGCGGCCATAATCGGACCCTAGCTAAGGCTTTTGGCCAAGAAGGGCCTTTTTGGGGCCGTCATTACCTTTTCTGGCATGACCGTAAACCCCTAACCCTAATTTACGAAATTTTTTCCCCCTACCTATCCCGCTACCTAGGCGAATTGCCTAGGCCAAAATTTGAGTAA

Protein

MDVIDMAPVSPRDDGAPPQINTVPGPHLRRQVWLRTKSGQRLAYAVSWWDASHVDEYLQNRSLPIWDSLSRLHTELYRDIQAIYCGHNRTLAKAFGQEGPFWGRHYLFWHDRKPLTLIYEIFSPYLSRYLGELPRPKFE