Your browser is old and dusty. Try Google Chrome!

Details for sll1796

ORF sll1796
Accession NP_440674.1
Symbol petJ
Category Soluble electron carriers
Definition cytochrome c553
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -202 -188 16.7159 0.0276
NP_441061.1_2 Forward -208 -194 13.8643 0.0392
NP_441061.1_2 Reverse -201 -215 9.73436 0.0698
NP_441061.1_2 Forward -138 -124 0.491246 0.207
NP_440557.1_1 Reverse -201 -220 0.294447 0.265
NP_440795.1_7 Forward -208 -201 14.6904 0.0123
NP_440795.1_7 Reverse -201 -208 14.6904 0.0123
NP_441418.1_3 Forward -349 -330 10.265 0.272
NP_441418.1_6 Reverse -200 -219 -18.7818 0.0837
NP_441418.1_6 Forward -209 -190 -20.945 0.133
NP_440815.1_5 Reverse -200 -219 9.83255 0.228
NP_442291.1_5 Forward -210 -194 15.0048 0.0222
NP_440897.1_6 Forward -209 -190 -0.197979 0.182
NP_441453.1_4 Reverse -200 -208 16.539 0.00633
NP_441453.1_4 Forward -209 -201 16.539 0.00633
NP_441453.1_4 Reverse -194 -202 5.42762 0.135
NP_441453.1_4 Reverse -124 -132 4.24765 0.259
NP_442151.1_6 Forward -209 -195 18.7808 0.00618
NP_442151.1_6 Reverse -200 -214 13.9626 0.0421
NP_442151.1_6 Forward -133 -119 11.406 0.101
NP_441818.1_1 Forward -208 -197 18.446 0.0046
NP_441818.1_9 Reverse -212 -231 -8.35868 0.277
NP_440226.1_1 Reverse -200 -219 10.8159 0.0588
NP_440259.1_4 Reverse -149 -163 8.73228 0.293
NP_440996.1_4 Forward -335 -325 17.5813 0.15
NP_442655.1_2 Reverse -101 -120 9.3409 0.114
NP_442173.1_1 Forward -208 -200 15.4574 0.00633
NP_442173.1_1 Reverse -201 -209 15.4574 0.00633
NP_442752.1_4 Forward -209 -202 13.8055 0.0199
NP_442752.1_4 Reverse -200 -207 13.8055 0.0199
NP_443027.1_4 Reverse -198 -208 14.0414 0.0452
NP_443027.1_4 Forward -135 -125 7.55152 0.24
NP_442975.1_10 Reverse -196 -210 12.782 0.0459
NP_440784.1_7 Forward -208 -201 15.9687 0.0123
NP_440784.1_7 Reverse -201 -208 15.9687 0.0123
NP_442909.1_7 Forward -208 -194 13.8636 0.12
NP_442909.1_7 Reverse -195 -209 9.83206 0.14
NP_441934.1_8 Reverse -121 -140 11.7992 0.292
NP_441250.1_3 Reverse -81 -100 5.30933 0.241
NP_440061.1_9 Forward -211 -197 12.9786 0.0878
NP_440061.1_9 Reverse -198 -212 10.422 0.124
NP_441054.1_4 Forward -108 -90 0.805796 0.173
NP_439979.1_9 Reverse -189 -207 8.08229 0.269
NP_442062.1_8 Forward -209 -199 17.3846 0.00193
NP_442062.1_8 Reverse -200 -210 17.3846 0.00193
NP_442062.1_8 Reverse -124 -134 4.10993 0.232
NP_442062.1_8 Forward -280 -270 2.7333 0.297
NP_441859.1_3 Reverse -316 -335 7.4718 0.157
NP_441859.1_3 Reverse -193 -212 1.37531 0.287
NP_440304.1_4 Reverse -198 -208 10.8948 0.051
NP_440304.1_4 Forward -282 -272 4.10993 0.272
NP_440304.1_4 Forward -211 -201 1.84832 0.299
NP_442242.1_4 Forward -208 -201 14.3954 0.0124
NP_442242.1_4 Reverse -201 -208 14.3954 0.0124
NP_440044.1_8 Forward -208 -189 6.19431 0.0935
NP_440044.1_8 Forward -132 -113 3.83436 0.125
NP_440044.1_8 Forward -202 -183 -1.96717 0.256
NP_441781.1_7 Reverse -200 -219 -3.24547 0.295
NP_440853.1_9 Forward -295 -278 16.3618 0.275
NP_442207.1_5 Forward -253 -234 9.43923 0.292
NP_442602.1_3 Reverse -230 -249 -3.63879 0.287
NP_439918.1_2 Reverse -106 -125 -0.197208 0.227
NP_441208.1_9 Forward -212 -198 7.07942 0.227
NP_441594.1_6 Reverse -191 -210 11.8975 0.116
NP_441594.1_6 Reverse -121 -140 1.17943 0.272
NP_442110.1_7 Forward -209 -195 18.6825 0.0142
NP_442110.1_7 Reverse -200 -214 0.589577 0.256
NP_441083.1_5 Forward -209 -199 20.3345 0.00053
NP_441083.1_5 Reverse -200 -210 20.3345 0.00053
NP_441083.1_5 Forward -203 -193 6.66654 0.0811
NP_441083.1_5 Reverse -194 -204 -0.41329 0.267
NP_441738.1_2 Forward -207 -200 15.28 0.0102
NP_441738.1_2 Reverse -202 -209 15.28 0.0102
NP_441558.1_5 Reverse -198 -217 19.9606 0.00612
NP_441558.1_5 Reverse -122 -141 4.32602 0.283
NP_441558.1_5 Forward -135 -116 3.73603 0.299
NP_441942.1_7 Forward -284 -265 13.0775 0.277
NP_440209.1_1 Reverse -200 -208 18.1123 0.00295
NP_440209.1_1 Forward -209 -201 18.1123 0.00295
NP_441444.1_1 Reverse -153 -172 2.26107 0.295
NP_442889.1_8 Reverse -197 -211 4.22722 0.27
NP_441713.1_1 Forward -215 -196 -5.9004 0.114
NP_440178.1_7 Forward -210 -191 -14.7502 0.156
NP_440178.1_7 Reverse -199 -218 -20.65 0.196
NP_441716.1_1 Forward -209 -195 15.7325 0.0467
NP_441716.1_1 Reverse -124 -138 9.5377 0.112
NP_441716.1_1 Reverse -194 -208 3.44117 0.265
NP_442111.1_4 Forward -210 -196 9.83269 0.0575
NP_442111.1_4 Reverse -199 -213 2.75286 0.266
NP_440343.1_3 Reverse -136 -154 7.49153 0.208
NP_440851.1_3 Reverse -322 -341 5.11266 0.245
NP_440906.1_5 Forward -208 -201 15.8704 0.0124
NP_440906.1_5 Reverse -201 -208 15.8704 0.0124
NP_441924.1_5 Reverse -48 -67 11.7992 0.258
NP_440747.1_10 Forward -212 -200 24.7201 0.00036
NP_440747.1_10 Reverse -197 -209 7.51213 0.00286
NP_440747.1_10 Forward -136 -124 -12.1541 0.227
NP_441486.1_1 Reverse -197 -211 23.4024 0.00162
NP_441486.1_1 Forward -212 -198 12.586 0.0112
NP_442634.1_4 Reverse -122 -136 -5.50694 0.258
NP_440470.1_5 Forward -349 -330 6.44528 0.279
NP_440403.1_10 Reverse -191 -210 7.37428 0.208
NP_440403.1_10 Forward -283 -264 1.47442 0.291
NP_441695.1_10 Forward -130 -111 15.3382 0.267
NP_441014.1_5 Forward -214 -196 13.5888 0.208
NP_441014.1_10 Reverse -199 -218 -1.57461 0.262
NP_442848.1_1 Reverse -194 -208 8.35772 0.0791
NP_442848.1_5 Forward -134 -116 -0.7675 0.276
NP_442848.1_5 Forward -255 -237 -1.84914 0.276
NP_442848.1_5 Reverse -310 -328 -2.43913 0.286
NP_442848.1_5 Reverse -264 -282 -3.42244 0.291
NP_442848.1_9 Forward -68 -49 -0.39387 0.278
NP_443018.1_3 Forward -208 -201 14.8871 0.0123
NP_443018.1_3 Reverse -201 -208 14.8871 0.0123
NP_443018.1_3 Forward -132 -125 12.5271 0.0523
NP_443018.1_3 Reverse -125 -132 12.5271 0.0523
NP_443018.1_3 Reverse -195 -202 10.6589 0.0967
NP_443018.1_3 Forward -202 -195 4.16902 0.278
NP_441316.1_7 Reverse -198 -213 5.09311 0.121
NP_441634.1_8 Forward -135 -121 9.5377 0.101
NP_441634.1_8 Forward -211 -197 -3.93365 0.295
NP_440376.1_1 Forward -209 -200 19.4693 0.000692
NP_440376.1_1 Reverse -200 -209 19.4693 0.000692
NP_441588.1_4 Reverse -202 -212 9.02648 0.14
NP_442687.1_7 Forward -210 -200 8.92815 0.0994
NP_442687.1_7 Reverse -199 -209 8.92815 0.0994
NP_442687.1_7 Forward -249 -239 3.81494 0.286
NP_442485.1_3 Forward -285 -266 -5.01543 0.287
NP_442583.1_8 Forward -132 -113 13.4708 0.161
NP_441013.1_2 Reverse -166 -184 -3.6191 0.29
NP_440550.1_2 Reverse -259 -278 14.4541 0.267
NP_442296.1_5 Forward -142 -123 3.6377 0.251
NP_442658.1_1 Reverse -198 -208 6.76441 0.214
NP_442658.1_1 Forward -211 -201 6.76441 0.214
NP_442658.1_1 Forward -328 -318 6.0761 0.238
NP_442782.1_7 Reverse -192 -211 11.0125 0.109
NP_442205.1_9 Reverse -194 -210 -2.20308 0.268
NP_441414.1_9 Reverse -200 -219 0.0977854 0.0851
NP_441414.1_9 Forward -209 -190 -4.72043 0.161
NP_441414.1_9 Forward -203 -184 -7.4737 0.219
NP_440184.1_1 Forward -352 -333 5.93867 0.203
NP_439959.1_3 Reverse -188 -207 12.9791 0.215
NP_442937.1_5 Reverse -119 -138 14.0608 0.0836
NP_442937.1_5 Forward -214 -195 8.45592 0.22
NP_442937.1_5 Reverse -189 -208 5.99764 0.293
NP_442321.1_4 Forward -136 -117 0.491109 0.255
NP_442321.1_4 Reverse -261 -280 -1.08219 0.265
NP_441958.1_5 Forward -210 -200 12.2714 0.00183
NP_441958.1_5 Reverse -199 -209 12.2714 0.00183
NP_442836.1_5 Reverse -194 -213 7.57094 0.158
NP_440203.1_5 Forward -136 -126 15.7125 0.0611
NP_440203.1_5 Forward -206 -196 14.8275 0.0886
NP_440203.1_5 Reverse -203 -213 11.8776 0.171
NP_439905.1_1 Reverse -318 -331 6.60746 0.283
NP_440984.1_7 Reverse -189 -203 9.73436 0.127
NP_440984.1_7 Forward -214 -200 9.04604 0.131
NP_439990.1_5 Forward -214 -201 7.98409 0.183
NP_439990.1_5 Reverse -260 -273 5.42749 0.295
NP_442690.1_1 Forward -338 -319 -7.67036 0.177
NP_442911.1_2 Forward -219 -200 6.29264 0.0295
NP_442911.1_2 Reverse -190 -209 3.34271 0.0442
NP_442911.1_2 Forward -143 -124 -0.885524 0.0793
NP_442911.1_2 Forward -336 -317 -6.39206 0.182
NP_440153.1_5 Forward -208 -194 18.7808 0.0435
NP_442064.1_1 Forward -214 -195 -0.787193 0.146
NP_442064.1_4 Forward -213 -194 6.88182 0.246
NP_443055.1_1 Forward -85 -66 30.3837 0.0000985
NP_443055.1_6 Reverse -116 -134 0.215075 0.248
NP_440138.1_6 Reverse -195 -214 11.7983 0.124
NP_440138.1_6 Forward -202 -183 2.6536 0.262
NP_442853.1_5 Reverse -142 -161 8.06178 0.262
NP_441099.1_5 Forward -219 -200 7.86593 0.0409
NP_440809.1_9 Reverse -191 -209 -6.27403 0.225
NP_441294.1_4 Reverse -123 -142 9.14423 0.217
NP_441294.1_7 Reverse -196 -210 14.146 0.0466
NP_441646.1_1 Forward -216 -197 10.1275 0.121
NP_441646.1_1 Forward -210 -191 7.17762 0.164
NP_442438.1_10 Reverse -195 -209 16.3225 0.0222
NP_442438.1_10 Forward -214 -200 3.34284 0.163
NP_442438.1_10 Forward -138 -124 -0.983719 0.287
NP_440147.1_4 Forward -211 -198 11.3273 0.0326
NP_440147.1_4 Reverse -198 -211 2.18257 0.209
NP_441175.1_7 Reverse -200 -219 10.8159 0.153
NP_441550.1_8 Forward -211 -201 14.6309 0.0132
NP_441550.1_8 Reverse -198 -208 12.3692 0.0336
NP_441550.1_8 Reverse -192 -202 6.0761 0.214
NP_441916.1_7 Forward -209 -199 10.3048 0.0261
NP_441916.1_7 Reverse -200 -210 10.3048 0.0261
NP_441916.1_7 Forward -248 -238 3.32329 0.22
NP_441916.1_10 Reverse -192 -211 6.4893 0.202
NP_441041.1_4 Reverse -200 -219 17.699 0.00878
NP_441041.1_4 Reverse -194 -213 -5.40875 0.152
NP_441041.1_4 Reverse -124 -143 -6.58872 0.169
NP_441041.1_4 Forward -209 -190 -10.9153 0.238
NP_441041.1_7 Forward -212 -200 8.58373 0.133
NP_441041.1_7 Reverse -373 -385 5.18252 0.272
NP_442396.1_5 Forward -213 -200 11.6223 0.0913
NP_442004.1_6 Reverse -200 -214 14.2576 0.078
NP_442004.1_6 Forward -209 -195 11.5043 0.115
NP_441725.1_5 Forward -208 -198 11.2881 0.0247
NP_441725.1_5 Reverse -201 -211 2.04498 0.115
NP_439966.1_7 Reverse -198 -208 15.8108 0.0124
NP_439966.1_7 Forward -211 -201 7.25606 0.15
NP_439966.1_7 Reverse -192 -202 4.10949 0.289
NP_439966.1_9 Forward -328 -319 6.39124 0.253
NP_442941.1_3 Forward -208 -198 19.9412 0.00262
NP_442941.1_3 Reverse -201 -211 11.0914 0.0116
NP_440674.1_1 Forward -85 -66 27.8271 0.00106
NP_440674.1_7 Forward -205 -186 22.5164 0.0234
NP_440674.1_10 Forward -14 -1 19.5871 0.229
NP_440289.1_2 Reverse -197 -210 3.85419 0.0735
NP_440289.1_2 Forward -212 -199 -4.9956 0.294
NP_440260.1_8 Forward -283 -265 0.21581 0.202
NP_440260.1_8 Forward -218 -200 -2.83245 0.246
NP_442281.1_1 Forward -214 -200 15.7319 0.011
NP_442281.1_1 Reverse -195 -209 8.25877 0.0832
NP_442281.1_1 Reverse -119 -133 6.58715 0.122
NP_442281.1_1 Reverse -266 -280 3.63724 0.224
NP_441079.1_7 Reverse -328 -347 -5.1145 0.261
NP_442256.1_2 Forward -211 -193 0.21581 0.126
NP_442256.1_2 Reverse -198 -216 -7.55234 0.214
NP_442256.1_2 Forward -205 -187 -9.22396 0.254
NP_442012.1_1 Forward -286 -267 4.22769 0.171
NP_442012.1_1 Forward -215 -196 2.94938 0.19
NP_441860.1_1 Reverse -19 -33 14.8707 0.277
NP_441556.1_10 Forward -214 -200 14.602 0.164
NP_440498.1_1 Forward -218 -200 7.39397 0.0836
NP_441644.1_6 Forward -209 -199 17.3841 0.00127
NP_441644.1_6 Reverse -200 -210 17.3841 0.00127
NP_441644.1_6 Reverse -194 -204 11.6809 0.0448
NP_441644.1_6 Reverse -124 -134 11.4843 0.0481
NP_441644.1_6 Forward -133 -123 4.60114 0.233
NP_441644.1_6 Forward -203 -193 3.32285 0.288
NP_442215.1_2 Forward -211 -195 15.4965 0.0171
NP_442215.1_2 Reverse -198 -214 3.10679 0.102
NP_442029.1_6 Forward -214 -195 12.9791 0.151
NP_442029.1_6 Reverse -119 -138 9.24257 0.191
NP_442247.1_7 Reverse -197 -216 7.86593 0.228
NP_440929.1_8 Forward -209 -200 19.2726 0.000701
NP_440929.1_8 Reverse -200 -209 19.2726 0.000701
NP_440469.1_6 Forward -108 -89 23.7947 0.015
NP_440780.1_1 Forward -120 -101 8.45061 0.274
NP_442933.1_10 Forward -209 -200 17.601 0.00325
NP_442933.1_10 Reverse -200 -209 17.601 0.00325
NP_441751.2_8 Reverse -201 -215 5.01447 0.0448
NP_441751.2_8 Forward -208 -194 -0.590395 0.129
NP_442554.1_8 Forward -208 -198 15.9097 0.00747
NP_442554.1_8 Forward -132 -122 15.9097 0.00747
NP_442554.1_8 Reverse -201 -211 15.3197 0.00882
NP_442554.1_8 Forward -202 -192 14.6313 0.0129
NP_442554.1_8 Reverse -125 -135 10.4031 0.0466
NP_441762.1_7 Reverse -199 -211 0.432302 0.0747
NP_441762.1_7 Forward -210 -198 -6.84419 0.284
NP_442142.1_4 Forward -212 -199 12.2117 0.0464
NP_442142.1_4 Forward -136 -123 7.00021 0.151
NP_442142.1_4 Reverse -197 -210 6.31189 0.169
NP_442292.1_1 Forward -208 -199 18.486 0.00229
NP_442292.1_1 Reverse -201 -210 18.486 0.00229
NP_442292.1_1 Forward -202 -193 5.80125 0.129
NP_442292.1_1 Forward -132 -123 5.80125 0.129
NP_442292.1_1 Reverse -125 -134 5.21127 0.152
NP_442292.1_5 Forward -213 -194 0.884433 0.257
NP_442476.1_6 Reverse -272 -286 2.5562 0.179
NP_442476.1_6 Reverse -201 -215 2.2612 0.188
NP_440895.1_6 Forward -215 -202 11.7207 0.202
NP_443009.1_5 Forward -281 -270 10.0879 0.0818
NP_443009.1_5 Reverse -199 -210 8.90795 0.0965
NP_443009.1_5 Forward -210 -199 8.90795 0.0965
NP_443009.1_5 Reverse -270 -281 7.62965 0.124
NP_443009.1_5 Reverse -316 -327 3.79477 0.278
NP_441715.1_4 Forward -208 -198 14.828 0.0268
NP_441715.1_4 Reverse -201 -211 7.94484 0.107
NP_440357.1_3 Forward -205 -186 0.294447 0.285
NP_441198.1_4 Reverse -104 -123 11.7992 0.241
NP_441198.1_8 Forward -282 -272 12.783 0.116
NP_440464.1_10 Reverse -201 -211 13.0082 0.169
NP_441468.1_1 Forward -208 -201 15.8704 0.0124
NP_441468.1_1 Reverse -201 -208 15.8704 0.0124
NP_441468.1_1 Reverse -195 -202 3.97235 0.277
NP_441468.1_1 Reverse -125 -132 3.97235 0.277
NP_441468.1_1 Forward -132 -125 3.97235 0.277
NP_439939.1_4 Forward -85 -66 3.83436 0.199
NP_441020.2_6 Reverse -198 -215 10.9536 0.131
NP_441015.1_10 Forward -214 -195 9.14423 0.078
NP_441015.1_10 Reverse -119 -138 -1.08219 0.169
NP_441015.1_10 Reverse -189 -208 -3.04881 0.184
NP_441673.1_1 Forward -209 -200 20.8459 0.000698
NP_441673.1_1 Reverse -200 -209 20.8459 0.000698
NP_441826.1_2 Reverse -194 -208 23.4024 0.00229
NP_441826.1_2 Forward -209 -195 2.5562 0.125
NP_441330.1_1 Forward -191 -172 -5.60541 0.127
NP_442868.1_6 Reverse -198 -208 9.91146 0.038
NP_442868.1_6 Forward -211 -201 9.81313 0.038
NP_442719.1_2 Forward -89 -71 -11.7812 0.296
NP_441056.1_1 Reverse -200 -219 -4.91709 0.257
NP_441056.1_1 Forward -209 -190 -5.11376 0.257
NP_441612.1_2 Reverse -200 -210 8.54929 0.21
NP_441612.1_2 Forward -209 -199 8.54929 0.21
NP_441612.1_2 Reverse -294 -304 6.32259 0.294
NP_442227.1_2 Forward -298 -279 -1.96717 0.269
NP_442808.1_1 Reverse -199 -209 8.63269 0.0481
NP_442808.1_1 Forward -210 -200 8.63269 0.0481
NP_442808.1_1 Forward -61 -51 5.97777 0.134
NP_441101.1_10 Forward -389 -370 -2.36049 0.231
NP_440145.1_3 Reverse -114 -133 -0.000545616 0.138
NP_442542.1_2 Reverse -192 -205 7.49244 0.179
NP_442542.1_2 Forward -282 -269 6.80412 0.205
NP_442050.1_5 Reverse -198 -208 16.4991 0.00812
NP_442050.1_5 Forward -211 -201 7.64939 0.243
NP_440342.1_1 Reverse -44 -63 10.8159 0.279
NP_440558.1_2 Reverse -191 -210 3.83436 0.153
NP_440558.1_2 Reverse -126 -145 -0.0988766 0.198
NP_440558.1_2 Forward -142 -123 -1.57384 0.215
NP_440558.1_2 Forward -136 -117 -4.22878 0.243
NP_440558.1_2 Forward -283 -264 -4.72043 0.248
NP_440558.1_2 Reverse -120 -139 -6.78538 0.28
NP_440558.1_2 Forward -218 -199 -7.37537 0.293
NP_441878.1_6 Forward -210 -200 10.4031 0.0176
NP_441878.1_6 Reverse -199 -209 10.4031 0.0176
NP_441878.1_6 Reverse -123 -133 0.668351 0.139
NP_441878.1_6 Forward -134 -124 0.57002 0.14
NP_441036.1_8 Forward -210 -200 8.33817 0.174
NP_441036.1_8 Reverse -199 -209 8.33817 0.174
NP_442650.1_2 Reverse -200 -214 8.25939 0.13
NP_442650.1_2 Forward -209 -195 4.62115 0.165
NP_441557.1_5 Forward -209 -200 19.9609 0.000699
NP_441557.1_5 Reverse -200 -209 19.9609 0.000699
NP_441557.1_8 Forward -395 -385 13.1559 0.225
NP_441445.1_1 Forward -218 -199 9.0459 0.111
NP_441445.1_1 Reverse -191 -210 8.35759 0.122
NP_441445.1_1 Forward -142 -123 7.27595 0.136
NP_441590.1_4 Forward -247 -228 2.85027 0.293
NP_442066.2_4 Forward -209 -190 -8.45701 0.294
NP_441433.1_8 Forward -294 -275 7.27595 0.174
NP_440101.1_3 Forward -214 -195 2.85105 0.244
NP_440101.1_3 Forward -285 -266 1.37609 0.276
NP_442183.1_1 Forward -209 -195 7.07942 0.149
NP_442183.1_1 Reverse -200 -214 6.6861 0.164
NP_441549.1_9 Reverse -196 -214 -4.79907 0.198
NP_441549.1_9 Forward -213 -195 -5.88071 0.198
NP_441549.1_9 Reverse -190 -208 -9.22396 0.244
NP_441549.1_9 Forward -284 -266 -10.1089 0.269
NP_442170.1_4 Reverse -372 -391 10.6192 0.251
NP_442347.1_2 Forward -208 -199 12.4878 0.056
NP_442347.1_2 Reverse -201 -210 12.4878 0.056
NP_442645.1_2 Reverse -192 -211 -6.78538 0.0946
NP_442645.1_2 Forward -217 -198 -13.1769 0.147
NP_442965.1_2 Forward -185 -166 0.392778 0.2
NP_441037.1_4 Forward -211 -201 7.9999 0.237
NP_441633.1_3 Forward -211 -198 1.10092 0.109
NP_441633.1_3 Reverse -198 -211 -5.97891 0.236
NP_441633.1_5 Reverse -187 -206 17.434 0.168
NP_440136.1_2 Forward -208 -201 15.9687 0.0123
NP_440136.1_2 Reverse -201 -208 15.9687 0.0123
NP_442590.1_10 Reverse -194 -213 3.6377 0.289
NP_442590.1_10 Forward -209 -190 2.94938 0.299
NP_442998.1_10 Forward -207 -200 15.5754 0.0102
NP_442998.1_10 Reverse -202 -209 15.5754 0.0102
NP_440299.1_1 Reverse -196 -209 19.9798 0.00161
NP_440299.1_1 Forward -213 -200 12.605 0.0362
NP_440299.1_1 Forward -137 -124 6.31189 0.146
NP_440299.1_1 Reverse -173 -186 5.13193 0.187
NP_441799.1_1 Forward -213 -199 17.6985 0.0109
NP_441799.1_1 Reverse -196 -210 7.17714 0.149
NP_441007.1_10 Forward -214 -201 10.8357 0.0646
NP_441007.1_10 Reverse -189 -202 7.59077 0.136
NP_441007.1_10 Reverse -119 -132 1.69091 0.203
NP_441007.1_10 Reverse -195 -208 -0.570702 0.287
NP_442201.1_10 Reverse -189 -208 -13.5702 0.274
NP_440256.1_1 Forward -212 -193 8.35759 0.0236
NP_441559.1_8 Reverse -195 -209 -6.78525 0.279
NP_440915.1_7 Forward -241 -222 9.73422 0.193
NP_441704.1_8 Forward -220 -201 8.25844 0.208
NP_441704.1_8 Reverse -189 -208 6.1935 0.262
NP_442555.1_9 Reverse -280 -299 14.4541 0.269
NP_442866.1_1 Forward -285 -266 -8.16202 0.277
NP_440748.1_5 Forward -224 -205 0.294447 0.252
NP_441464.1_8 Forward -127 -113 5.70279 0.253
NP_440306.1_8 Reverse -334 -353 -3.04956 0.278
NP_440695.1_5 Forward -209 -190 6.58763 0.153
NP_440695.1_5 Reverse -200 -219 5.60432 0.176
NP_441939.1_3 Reverse -201 -220 13.6675 0.0883
NP_441494.1_6 Forward -285 -272 16.9322 0.0926
NP_440677.1_1 Forward -218 -199 6.68596 0.258
NP_442386.1_9 Reverse -199 -208 13.8639 0.0289
NP_442386.1_9 Forward -210 -201 13.8639 0.0289
NP_442386.1_9 Reverse -123 -132 10.324 0.132
NP_442386.1_9 Forward -134 -125 9.04574 0.175
NP_442386.1_9 Reverse -193 -202 7.96411 0.213
NP_442386.1_9 Forward -204 -195 4.62087 0.294
NP_440570.1_5 Forward -219 -200 1.76941 0.234
NP_441340.1_5 Forward -208 -201 15.6737 0.0124
NP_441340.1_5 Reverse -201 -208 15.6737 0.0124
NP_441340.1_5 Forward -202 -195 11.3472 0.0526
NP_441340.1_5 Reverse -125 -132 4.07068 0.239
NP_441340.1_5 Forward -132 -125 4.07068 0.239
NP_442327.1_3 Forward -348 -329 5.87233 0.276
NP_442484.1_2 Forward -220 -201 5.30933 0.172
NP_440586.1_1 Reverse -190 -209 -3.83545 0.273
NP_440586.1_8 Forward -208 -201 13.2151 0.026
NP_440586.1_8 Reverse -201 -208 13.2151 0.026
NP_440586.1_8 Forward -132 -125 7.61025 0.227
NP_440586.1_8 Reverse -125 -132 7.61025 0.227
NP_440586.1_8 Reverse -195 -202 5.74197 0.283
NP_442251.1_6 Forward -208 -201 15.2804 0.0124
NP_442251.1_6 Reverse -201 -208 15.2804 0.0124
NP_440684.1_9 Reverse -194 -208 7.37441 0.266
NP_440684.1_9 Forward -215 -201 7.07942 0.28
NP_441262.1_3 Reverse -200 -207 14.7888 0.0223
NP_441262.1_3 Forward -209 -202 14.7888 0.0223
NP_440027.1_3 Forward -209 -191 2.57501 0.289
NP_440027.1_8 Forward -212 -193 17.0099 0.127
NP_443051.1_1 Reverse -199 -208 10.4228 0.00754
NP_443051.1_1 Forward -210 -201 10.4228 0.00754
NP_439996.1_1 Reverse -200 -219 11.9958 0.234
NP_439996.1_6 Reverse -184 -203 11.606 0.187
NP_439937.1_8 Reverse -192 -211 -5.21209 0.288
NP_439937.1_9 Reverse -269 -286 -3.40342 0.157
NP_439937.1_9 Forward -61 -44 -9.10659 0.181
NP_439937.1_9 Forward -210 -193 -16.1864 0.287
NP_441595.1_8 Forward -331 -312 25.4672 0.00662
NP_440408.1_7 Forward -209 -190 13.8641 0.175
NP_440408.1_7 Reverse -200 -219 7.27595 0.29
NP_440439.1_1 Reverse -197 -210 2.37923 0.135
NP_439943.1_7 Forward -273 -254 4.62101 0.278
NP_439943.1_7 Forward -74 -55 2.0644 0.299
NP_440372.1_2 Forward -208 -201 16.3621 0.0124
NP_440372.1_2 Reverse -201 -208 16.3621 0.0124
NP_440316.1_10 Forward -290 -280 7.25653 0.251
NP_441803.1_2 Forward -214 -195 13.3725 0.0506
NP_439977.1_5 Forward -215 -196 11.6025 0.0668
NP_441572.1_7 Reverse -194 -213 -2.65548 0.197
NP_442384.1_10 Forward -209 -196 18.9972 0.00338
NP_442384.1_10 Reverse -200 -213 15.5556 0.00986
NP_442384.1_10 Reverse -194 -207 5.32916 0.131
NP_441018.1_7 Forward -213 -194 15.6341 0.102
NP_441018.1_7 Reverse -190 -209 9.73422 0.218
NP_441018.1_7 Forward -284 -265 8.94757 0.239
NP_442262.1_10 Forward -208 -201 14.1988 0.0123
NP_442262.1_10 Reverse -201 -208 14.1988 0.0123
NP_442262.1_10 Reverse -195 -202 12.0355 0.062
NP_442262.1_10 Forward -132 -125 10.4622 0.145
NP_442262.1_10 Reverse -125 -132 10.4622 0.145
NP_441689.1_5 Reverse -198 -208 15.3192 0.0403
NP_441689.1_5 Forward -211 -201 5.78111 0.197
NP_440344.1_10 Reverse -193 -210 -5.1727 0.104
NP_440344.1_10 Forward -216 -199 -9.89259 0.16
NP_440282.1_10 Forward -219 -200 -5.80207 0.25
NP_440531.1_6 Forward -297 -278 1.86774 0.166
NP_440531.1_6 Reverse -192 -211 -2.0655 0.244
NP_440531.1_8 Reverse -36 -55 8.94757 0.216
NP_440189.1_5 Reverse -369 -388 20.5498 0.196
NP_441335.1_7 Reverse -121 -140 21.0423 0.0534
NP_441965.1_3 Reverse -190 -209 2.94938 0.197
NP_441965.1_10 Reverse -197 -213 21.298 0.0148
NP_440297.1_9 Reverse -125 -135 9.61647 0.0917
NP_440297.1_9 Forward -208 -198 9.32148 0.0917
NP_440297.1_9 Reverse -201 -211 -0.118297 0.282
NP_440297.1_9 Forward -132 -122 -0.216628 0.282
NP_442187.1_3 Reverse -50 -60 13.8447 0.241
NP_442280.1_10 Forward -73 -55 13.1491 0.158
NP_442280.1_10 Forward -298 -280 6.72063 0.268
NP_441896.1_3 Forward -335 -316 1.57275 0.213
NP_440894.1_7 Forward -90 -71 12.29 0.214
NP_440894.1_7 Reverse -75 -94 8.65176 0.267
NP_441679.1_6 Reverse -189 -208 10.5209 0.09
NP_440999.1_9 Reverse -196 -210 2.35953 0.151
NP_440999.1_9 Forward -213 -199 0.196253 0.191
NP_440888.1_2 Forward -209 -195 20.4518 0.000632
NP_440888.1_2 Reverse -200 -214 5.30886 0.284
NP_440600.1_4 Reverse -192 -210 -4.30741 0.257
NP_440179.1_6 Reverse -201 -220 6.58763 0.22
NP_440491.1_1 Reverse -197 -216 17.6373 0.0511
NP_441543.1_2 Forward -208 -199 16.9127 0.00359
NP_441543.1_2 Reverse -201 -210 16.9127 0.00359
NP_441543.1_2 Forward -202 -193 5.3096 0.204
NP_441543.1_2 Forward -132 -123 5.11294 0.209
NP_442845.1_2 Reverse -194 -208 17.0108 0.0608
NP_442845.1_2 Forward -209 -195 16.8142 0.0608
NP_442845.1_2 Reverse -118 -132 11.6026 0.127
NP_442845.1_2 Forward -215 -201 8.84938 0.185
NP_442845.1_2 Forward -139 -125 4.32615 0.261
NP_442710.1_7 Reverse -329 -348 -1.9367 0.231
NP_441469.1_8 Forward -210 -201 6.48957 0.227
NP_441469.1_8 Reverse -199 -208 6.48957 0.227
NP_441469.1_8 Reverse -117 -126 6.39124 0.227
NP_443064.1_3 Forward -295 -276 5.70265 0.298
NP_443064.1_6 Forward -209 -199 12.5669 0.0796
NP_443064.1_6 Reverse -200 -210 12.5669 0.0796
NP_442578.1_7 Forward -208 -201 14.5921 0.026
NP_442578.1_7 Reverse -201 -208 14.5921 0.026
NP_442578.1_7 Reverse -90 -97 9.97054 0.112
NP_440710.1_4 Reverse -325 -339 20.9244 0.157
NP_439907.1_2 Forward -33 -14 12.1925 0.269
NP_441462.1_2 Forward -209 -199 11.5831 0.00406
NP_441462.1_2 Reverse -200 -210 11.5831 0.00406
NP_443062.1_1 Reverse -200 -218 10.2035 0.121
NP_443062.1_1 Forward -209 -191 8.44842 0.153
NP_443062.1_1 Reverse -124 -142 7.57085 0.172
NP_441601.1_4 Forward -298 -279 -3.93378 0.293
NP_442204.1_1 Reverse -196 -207 7.92515 0.108
NP_442204.1_1 Reverse -208 -219 1.33697 0.274
NP_442204.1_5 Reverse -190 -209 3.04771 0.198
NP_441560.1_8 Forward -214 -195 14.6291 0.139
NP_440454.1_2 Forward -228 -214 10.6112 0.291
NP_440454.1_2 Forward -166 -152 10.5157 0.291
NP_440516.1_8 Forward -209 -200 16.9127 0.00442
NP_440516.1_8 Reverse -200 -209 16.9127 0.00442
NP_440516.1_8 Reverse -194 -203 7.17789 0.0754
NP_442428.1_5 Forward -208 -201 15.8704 0.0124
NP_442428.1_5 Reverse -201 -208 15.8704 0.0124
NP_442428.1_5 Reverse -195 -202 4.36568 0.271
NP_442428.1_5 Forward -132 -125 4.36568 0.271
NP_442428.1_5 Reverse -125 -132 4.36568 0.271
NP_440818.1_6 Reverse -78 -97 6.58763 0.284
NP_440673.1_3 Forward -207 -200 12.4288 0.0426
NP_440673.1_3 Reverse -202 -209 12.4288 0.0426
NP_441714.1_3 Forward -216 -198 13.883 0.204
NP_441052.1_2 Forward -209 -199 19.9412 0.00106
NP_441052.1_2 Reverse -200 -210 19.9412 0.00106
NP_441052.1_2 Forward -203 -193 7.94484 0.0576
NP_441052.1_2 Forward -133 -123 5.19158 0.128
NP_441052.1_2 Reverse -124 -134 4.0116 0.168
NP_442219.1_8 Reverse -190 -209 9.80987 0.219
NP_442219.1_9 Forward -208 -199 17.7976 0.00718
NP_442219.1_9 Reverse -201 -210 17.7976 0.00718
NP_440436.1_4 Forward -208 -199 17.2072 0.00233
NP_440436.1_4 Reverse -201 -210 17.2072 0.00233
NP_440436.1_4 Forward -202 -193 4.7192 0.244
NP_440436.1_4 Forward -132 -123 4.7192 0.244
NP_441884.1_9 Reverse -371 -390 -20.65 0.199
NP_441884.1_9 Forward -212 -193 -22.8133 0.284
NP_440648.1_1 Reverse -200 -219 5.60432 0.213
NP_441086.1_7 Forward -143 -124 16.5191 0.076
NP_441719.1_4 Forward -208 -201 16.3621 0.0124
NP_441719.1_4 Reverse -201 -208 16.3621 0.0124
NP_441004.1_1 Reverse -112 -131 -4.32711 0.169
NP_442813.1_4 Reverse -165 -184 -4.81876 0.299
NP_442813.1_4 Forward -299 -280 -7.67036 0.299
NP_441577.1_1 Reverse -73 -92 18.584 0.136
NP_442366.1_3 Forward -327 -309 -0.0791831 0.183
NP_442366.1_3 Forward -210 -192 -3.42244 0.247
NP_442366.1_5 Forward -212 -202 14.0409 0.0497
NP_441115.1_4 Reverse -316 -334 8.47483 0.247
NP_442206.1_7 Forward -211 -192 9.63589 0.295
NP_442206.1_10 Reverse -200 -215 6.07642 0.178
NP_440328.1_4 Reverse -194 -213 10.4225 0.0866
NP_443054.1_2 Reverse -198 -212 1.57289 0.245
NP_443054.1_2 Reverse -293 -307 0.786239 0.254
NP_442430.1_10 Forward -219 -200 13.2733 0.192
NP_441851.1_10 Forward -210 -200 15.8113 0.00552
NP_441851.1_10 Reverse -199 -209 15.8113 0.00552
NP_441851.1_10 Forward -281 -271 5.97822 0.19
NP_441851.1_10 Reverse -123 -133 4.3066 0.277
NP_442856.1_7 Reverse -191 -210 8.25926 0.106
NP_441668.1_4 Reverse -108 -127 3.83436 0.183
NP_441668.1_4 Reverse -229 -248 -1.47551 0.274
NP_442515.1_1 Forward -210 -196 8.84938 0.0698
NP_442515.1_1 Reverse -199 -213 4.12949 0.108
NP_440593.1_3 Reverse -195 -214 10.3242 0.107
NP_442689.1_8 Forward -334 -317 -1.73112 0.221
NP_441349.1_10 Reverse -190 -209 3.24438 0.0684
NP_441661.1_1 Reverse -38 -57 11.2092 0.147
NP_442024.1_4 Reverse -191 -210 13.6675 0.197
NP_441409.1_6 Forward -104 -85 -7.17871 0.145
NP_441409.1_6 Forward -139 -120 -7.76869 0.156
NP_441409.1_6 Reverse -194 -213 -10.3253 0.203
NP_440432.1_9 Reverse -178 -193 0.373221 0.159
NP_442843.1_1 Forward -288 -269 -9.14533 0.264
NP_440474.1_8 Reverse -318 -332 4.52221 0.276
NP_441477.1_10 Reverse -193 -211 0.314141 0.284
NP_440431.1_3 Reverse -258 -277 1.47442 0.104
NP_440431.1_3 Reverse -238 -257 -12.3902 0.299
NP_440431.1_4 Forward -169 -150 -8.26048 0.275
NP_442450.1_5 Reverse -198 -208 9.32148 0.115
NP_442450.1_5 Forward -211 -201 7.55152 0.13
NP_442450.1_5 Forward -100 -90 6.17489 0.197
NP_442168.1_5 Reverse -201 -220 -3.73712 0.291
NP_440588.1_2 Forward -212 -193 2.0644 0.125
NP_440588.1_2 Reverse -191 -210 -2.36049 0.164
NP_440195.1_5 Reverse -118 -137 8.16093 0.17
NP_440943.1_4 Forward -256 -244 17.3452 0.0959
NP_440483.1_1 Forward -294 -275 0.491109 0.193
NP_442243.1_1 Reverse -194 -212 -2.53818 0.293
NP_441570.1_1 Forward -209 -191 -0.0791831 0.0433
NP_441570.1_1 Reverse -200 -218 -8.92897 0.124
NP_441570.1_1 Reverse -194 -212 -16.9921 0.26
NP_441078.1_4 Forward -209 -200 19.6659 0.0007
NP_441078.1_4 Reverse -200 -209 19.6659 0.0007
NP_441078.1_4 Reverse -124 -133 -1.6719 0.266
NP_441078.1_4 Forward -133 -124 -1.77023 0.266
NP_442729.1_8 Reverse -196 -209 8.47575 0.125
NP_442729.1_8 Forward -64 -51 5.62415 0.238
NP_441663.1_8 Forward -391 -372 -0.000545616 0.225
NP_441663.1_8 Reverse -194 -213 -2.36049 0.266
NP_440526.1_3 Forward -132 -121 10.2846 0.0646
NP_440526.1_3 Reverse -201 -212 8.02298 0.126
NP_440526.1_3 Forward -202 -191 1.43483 0.267
NP_440526.1_3 Forward -208 -197 0.844851 0.267
NP_441432.1_8 Reverse -199 -208 16.8143 0.00595
NP_441432.1_8 Forward -210 -201 16.8143 0.00595
NP_441432.1_8 Reverse -123 -132 6.19458 0.118
NP_441432.1_8 Reverse -193 -202 4.22796 0.235
NP_443024.1_3 Forward -328 -318 14.533 0.255
NP_443024.1_3 Forward -282 -272 10.8948 0.289
NP_442320.1_8 Reverse -118 -132 5.1128 0.0437
NP_442320.1_8 Reverse -194 -208 3.8345 0.0578
NP_442344.1_7 Reverse -201 -220 -9.047 0.235
NP_442344.1_7 Forward -325 -306 -9.14533 0.239
NP_441732.1_2 Reverse -196 -212 2.02515 0.0253
NP_441732.1_2 Forward -213 -197 1.82849 0.026
NP_441732.1_2 Forward -207 -191 -7.90627 0.0983
NP_442815.1_2 Reverse -49 -67 4.44404 0.243
NP_442815.1_3 Forward -135 -116 15.3391 0.106
NP_442157.1_1 Reverse -70 -89 13.8641 0.195
NP_440760.1_1 Reverse -200 -219 -2.75381 0.0332
NP_440760.1_1 Forward -209 -190 -22.125 0.249
NP_442797.1_6 Forward -207 -188 7.25546 0.294
NP_442797.1_7 Forward -210 -192 2.57575 0.238
NP_440199.1_10 Reverse -197 -207 15.5163 0.0861
NP_440199.1_10 Forward -206 -196 7.25653 0.231
NP_442353.1_4 Reverse -194 -213 12.7816 0.0776
NP_442400.1_10 Reverse -331 -344 8.75154 0.278
NP_440713.1_4 Reverse -190 -209 5.99764 0.198
NP_440713.1_4 Reverse -202 -221 2.26107 0.266
NP_440713.1_4 Forward -213 -194 1.57275 0.284
NP_442489.1_2 Forward -214 -195 6.4893 0.175
NP_442489.1_7 Forward -209 -200 20.1576 0.000695
NP_442489.1_7 Reverse -200 -209 20.1576 0.000695
NP_442489.1_7 Reverse -194 -203 -1.47524 0.203
NP_442489.1_7 Reverse -124 -133 -1.6719 0.235
NP_442489.1_7 Forward -133 -124 -1.77023 0.247
NP_440559.1_1 Forward -208 -199 17.4043 0.00658
NP_440559.1_1 Reverse -201 -210 17.4043 0.00658
NP_440559.1_1 Forward -202 -193 5.01461 0.161
NP_442763.1_10 Reverse -266 -285 6.78429 0.26
NP_441659.2_8 Forward -209 -199 18.1713 0.00133
NP_441659.2_8 Reverse -200 -210 18.1713 0.00133
NP_441659.2_8 Reverse -124 -134 3.02829 0.177
NP_442913.1_10 Reverse -191 -210 9.14423 0.0462
NP_442913.1_10 Forward -218 -199 -0.0988766 0.157
NP_441040.1_2 Forward -211 -192 -11.6036 0.255
NP_439956.1_7 Forward -285 -266 7.7676 0.257
NP_442008.1_2 Forward -212 -193 8.06259 0.202
NP_441800.1_3 Forward -214 -196 4.54237 0.289
NP_442346.1_5 Forward -210 -200 16.6963 0.00248
NP_442346.1_5 Reverse -199 -209 16.6963 0.00248
NP_442346.1_5 Reverse -123 -133 13.4514 0.0235
NP_442346.1_5 Forward -134 -124 5.28991 0.253
NP_440545.1_3 Forward -213 -196 4.6604 0.0679
NP_440545.1_3 Reverse -313 -330 -1.14113 0.163
NP_440545.1_3 Reverse -196 -213 -1.92778 0.177
NP_440545.1_3 Reverse -120 -137 -2.12444 0.179
NP_441856.1_3 Reverse -197 -216 6.68596 0.113
NP_440831.1_3 Reverse -191 -210 15.027 0.108
NP_440459.1_2 Reverse -378 -395 11.8386 0.166
NP_440459.1_2 Forward -211 -194 11.1502 0.181
NP_440010.1_4 Reverse -190 -209 1.86696 0.227
NP_441943.1_8 Forward -257 -238 3.6377 0.164
NP_442603.1_7 Forward -209 -195 22.5167 0.00306
NP_442603.1_7 Forward -203 -189 10.6187 0.125
NP_441585.1_5 Forward -116 -97 2.16195 0.279
NP_441948.1_4 Reverse -44 -62 -0.669169 0.139
NP_441833.1_4 Forward -208 -201 15.9687 0.0124
NP_441833.1_4 Reverse -201 -208 15.9687 0.0124
NP_441895.1_10 Reverse -103 -122 -18.5851 0.282
NP_442162.1_9 Forward -208 -201 16.2637 0.0124
NP_442162.1_9 Reverse -201 -208 16.2637 0.0124
NP_440671.1_4 Reverse -194 -208 11.111 0.141
NP_442404.1_9 Reverse -320 -334 9.73373 0.263
NP_441973.1_1 Forward -300 -285 -0.216765 0.271
NP_442140.1_3 Reverse -201 -211 12.2714 0.0632
NP_442140.1_3 Forward -132 -122 8.73149 0.119
NP_442140.1_3 Forward -208 -198 4.40493 0.243
NP_441696.1_6 Forward -208 -189 1.17943 0.294
NP_441813.1_5 Reverse -198 -208 15.9097 0.01
NP_441813.1_5 Forward -211 -201 8.63316 0.0367
NP_440590.1_4 Forward -208 -195 12.704 0.013
NP_440590.1_4 Reverse -201 -214 1.19926 0.13
NP_440590.1_4 Forward -202 -189 -5.68391 0.286
NP_440567.1_1 Reverse -201 -215 13.8643 0.0196
NP_440567.1_1 Forward -208 -194 13.3726 0.0213
NP_442497.1_10 Forward -208 -199 10.4228 0.0087
NP_442497.1_10 Reverse -201 -210 10.4228 0.0087
NP_440821.1_4 Reverse -198 -208 18.2696 0.00448
NP_440821.1_4 Forward -211 -201 9.41981 0.0286
NP_441239.1_9 Forward -135 -123 4.46387 0.253
NP_441239.1_9 Reverse -198 -210 4.36554 0.253
NP_441239.1_9 Forward -211 -199 3.38223 0.285
NP_441239.1_9 Reverse -122 -134 3.08724 0.296
NP_441009.1_4 Reverse -200 -219 10.5209 0.265
NP_441727.1_3 Forward -216 -197 8.84924 0.199
NP_441727.1_3 Reverse -187 -206 8.55425 0.205
NP_441727.1_3 Reverse -117 -136 4.71934 0.262
NP_441892.1_1 Reverse -191 -208 1.31714 0.154
NP_440796.1_3 Reverse -193 -211 10.3431 0.204
NP_441017.1_6 Reverse -196 -210 16.4202 0.0651
NP_441017.1_8 Forward -283 -268 16.0078 0.174
NP_441769.1_3 Reverse -331 -350 14.7483 0.0402
NP_442216.1_4 Reverse -273 -281 8.08217 0.255
NP_440354.1_5 Forward -212 -193 19.469 0.0721
NP_442138.1_9 Forward -248 -229 13.3716 0.202
NP_442809.1_6 Forward -280 -261 3.53937 0.256
NP_440546.1_4 Forward -209 -199 10.046 0.109
NP_440546.1_4 Reverse -200 -210 10.046 0.109
NP_440546.1_4 Reverse -194 -204 8.00989 0.209
NP_440546.1_4 Forward -203 -193 6.65249 0.288
NP_441230.1_5 Reverse -195 -214 1.47442 0.24
NP_440462.1_6 Reverse -198 -208 7.74818 0.0699
NP_440462.1_6 Forward -211 -201 1.35667 0.294
NP_442465.1_1 Reverse -153 -172 4.52268 0.216
NP_442340.1_3 Forward -131 -112 -7.27704 0.23
NP_440868.1_4 Forward -213 -201 15.1819 0.0164
NP_440868.1_4 Reverse -196 -208 8.6921 0.0582
NP_440868.1_4 Reverse -190 -202 -0.0593532 0.242
NP_440374.1_3 Forward -358 -340 11.079 0.288
NP_442479.1_9 Forward -337 -318 -14.0619 0.294
NP_442402.1_6 Forward -173 -164 14.1594 0.241
NP_442402.1_10 Reverse -275 -285 11.8776 0.231
NP_442402.1_10 Reverse -274 -284 10.206 0.299
NP_440696.1_3 Forward -284 -266 0.510803 0.229
NP_440696.1_6 Reverse -228 -247 5.40766 0.276
NP_442039.1_4 Forward -208 -201 15.1821 0.0124
NP_442039.1_4 Reverse -201 -208 15.1821 0.0124
NP_442039.1_7 Forward -174 -164 7.25653 0.277
NP_441811.1_8 Reverse -194 -208 7.66941 0.241
NP_440825.1_7 Reverse -201 -211 12.9096 0.152
NP_442837.1_3 Forward -208 -201 15.7721 0.0124
NP_442837.1_3 Reverse -201 -208 15.7721 0.0124
NP_440160.1_9 Forward -209 -190 13.0775 0.215
NP_442053.1_1 Forward -209 -200 18.3876 0.0007
NP_442053.1_1 Reverse -200 -209 18.3876 0.0007
NP_442053.1_1 Reverse -194 -203 6.09625 0.147
NP_440505.1_3 Reverse -198 -208 16.303 0.00696
NP_440505.1_3 Forward -211 -201 9.22315 0.122
NP_441203.1_2 Reverse -185 -204 -2.85214 0.188
NP_441408.2_7 Forward -188 -169 1.47442 0.215
NP_441408.2_7 Reverse -58 -77 -2.0655 0.264
NP_440914.1_1 Forward -209 -199 17.5935 0.000537
NP_440914.1_1 Reverse -200 -210 17.5935 0.000537
NP_440914.1_1 Reverse -194 -204 13.2019 0.0378
NP_440914.1_1 Reverse -60 -70 6.66328 0.269
NP_441011.1_8 Forward -208 -199 8.25953 0.144
NP_441011.1_8 Reverse -201 -210 8.25953 0.144
NP_442533.1_6 Forward -209 -200 17.2076 0.00137
NP_442533.1_6 Reverse -200 -209 17.2076 0.00137
NP_442533.1_6 Reverse -124 -133 7.17789 0.0948
NP_442533.1_6 Forward -133 -124 6.68623 0.105
NP_442533.1_6 Reverse -194 -203 3.93297 0.197
NP_442541.1_10 Forward -133 -119 11.4053 0.182
NP_442232.1_3 Reverse -309 -328 -11.2103 0.281
NP_441482.1_7 Reverse -194 -208 -8.65353 0.193
NP_441482.1_7 Forward -215 -201 -8.94853 0.193
NP_441482.1_9 Forward -108 -95 15.3583 0.278
NP_439944.1_9 Forward -208 -198 19.0562 0.00329
NP_439944.1_9 Reverse -201 -211 10.5014 0.0887
NP_439944.1_9 Forward -132 -122 7.05986 0.157
NP_441697.1_5 Reverse -328 -347 10.074 0.129
NP_441697.1_5 Forward -348 -329 -10.0748 0.278
NP_441028.1_6 Reverse -275 -285 6.37109 0.23
NP_441028.1_6 Forward -299 -289 5.68278 0.243
NP_441028.1_6 Reverse -162 -172 5.09279 0.267
NP_440116.1_8 Forward -208 -189 -8.55534 0.254
NP_441527.1_4 Forward -168 -149 -4.63178 0.188
NP_441527.1_4 Forward -177 -158 -11.5072 0.282
NP_440115.1_6 Forward -212 -202 9.32148 0.115
NP_440115.1_6 Reverse -197 -207 8.4365 0.13
NP_440115.1_6 Reverse -48 -58 4.99491 0.277
NP_440115.1_6 Reverse -373 -383 4.60159 0.293
NP_440007.1_9 Reverse -126 -140 2.5562 0.277
NP_440007.1_9 Reverse -196 -210 1.57289 0.285
NP_441961.1_4 Forward -282 -263 19.2723 0.108
NP_440608.1_6 Forward -208 -189 5.60352 0.242
NP_441602.1_3 Forward -391 -372 -2.55715 0.233
NP_441972.1_5 Reverse -201 -220 -4.22878 0.207
NP_441106.1_1 Forward -210 -201 9.63616 0.0311
NP_441106.1_1 Reverse -199 -208 9.63616 0.0311
NP_441106.1_3 Forward -355 -336 11.3075 0.217
NP_439903.1_6 Forward -218 -199 5.99684 0.173
NP_439903.1_6 Forward -224 -205 0.490334 0.261
NP_439903.1_6 Reverse -197 -216 -0.984623 0.289
NP_442704.1_7 Forward -262 -243 12.0942 0.25
NP_441286.1_1 Forward -210 -198 21.3768 0.00196
NP_441286.1_1 Reverse -199 -211 12.9203 0.00815
NP_441286.1_1 Reverse -193 -205 0.825626 0.107
NP_441286.1_1 Forward -134 -122 0.825626 0.107
NP_441286.1_1 Forward -204 -192 -6.84419 0.283
NP_441286.1_1 Reverse -88 -100 -6.94252 0.288
NP_442674.1_3 Forward -217 -198 3.34192 0.294
NP_440670.1_8 Forward -209 -200 18.3876 0.000699
NP_440670.1_8 Reverse -200 -209 18.3876 0.000699
NP_440886.1_7 Forward -210 -200 7.94438 0.0805
NP_440886.1_7 Reverse -199 -209 7.94438 0.0805
NP_440828.1_4 Forward -64 -45 -7.27777 0.285
NP_442614.1_2 Reverse -200 -214 16.3225 0.0675
NP_442614.1_2 Reverse -124 -138 12.4876 0.157
NP_442614.1_2 Forward -209 -195 7.17775 0.275
NP_442614.1_2 Forward -241 -227 5.99778 0.295
NP_440460.1_9 Forward -168 -155 19.9805 0.158
NP_442072.1_9 Forward -210 -192 -22.007 0.216
NP_442072.1_9 Forward -282 -264 -23.0886 0.277
NP_440907.2_8 Reverse -201 -211 7.64939 0.117
NP_442264.1_2 Reverse -120 -137 16.4601 0.121
NP_442264.1_2 Reverse -190 -207 13.1169 0.156
NP_442264.1_2 Forward -336 -319 7.217 0.246
NP_442264.1_5 Reverse -200 -214 14.8476 0.222
NP_441021.1_1 Reverse -201 -220 -8.26035 0.194
NP_441021.1_1 Forward -132 -113 -9.047 0.206
NP_440841.1_4 Reverse -198 -217 -11.0136 0.292
NP_441463.1_3 Forward -219 -200 -1.08219 0.135
NP_441463.1_3 Reverse -190 -209 -8.16202 0.266
NP_441463.1_3 Forward -213 -194 -10.522 0.296
NP_441463.1_6 Reverse -198 -212 11.151 0.224
NP_441463.1_6 Forward -141 -127 7.09237 0.265
NP_441626.1_2 Forward -208 -201 15.7721 0.0124
NP_441626.1_2 Reverse -201 -208 15.7721 0.0124
NP_442365.1_7 Forward -207 -188 7.57094 0.0956
NP_442365.1_7 Reverse -196 -215 0.982764 0.175
NP_442365.1_7 Forward -213 -194 -2.0655 0.199
NP_442365.1_7 Reverse -190 -209 -3.24547 0.216
NP_442238.1_3 Forward -149 -130 9.3409 0.173
NP_440107.1_5 Forward -210 -191 -0.4922 0.178
NP_442794.1_1 Forward -213 -201 12.1337 0.0721
NP_442794.1_1 Reverse -196 -208 10.1671 0.0721
NP_442794.1_1 Reverse -173 -185 4.16888 0.276
NP_442615.1_1 Forward -218 -200 9.26226 0.0259
NP_442615.1_1 Forward -257 -239 -7.55234 0.296
NP_441962.1_1 Reverse -123 -142 11.6025 0.0482
NP_441962.1_4 Forward -208 -189 -0.0988766 0.117
NP_441962.1_4 Reverse -195 -214 -9.93197 0.222
NP_441962.1_4 Reverse -119 -138 -11.8003 0.245
NP_440387.1_1 Reverse -200 -216 18.7414 0.0042
NP_440387.1_1 Forward -209 -193 6.35172 0.0282
NP_440855.1_5 Forward -135 -116 2.6536 0.288
NP_441993.1_1 Reverse -118 -137 2.23906 0.261
NP_441174.1_2 Reverse -48 -62 13.1759 0.219
NP_440814.1_4 Reverse -230 -249 -12.4886 0.23
NP_440814.1_8 Reverse -48 -67 4.22769 0.269
NP_441425.1_2 Reverse -329 -348 11.6 0.289
NP_442437.1_3 Forward -207 -188 11.2084 0.211
NP_442323.1_7 Reverse -195 -214 4.03023 0.224
NP_440492.1_9 Reverse -16 -30 17.6733 0.193
NP_441510.2_7 Reverse -194 -208 9.43874 0.281
NP_440287.1_5 Forward -303 -284 15.4366 0.158
NP_440293.1_3 Reverse -231 -250 -5.50708 0.279
NP_440766.1_4 Reverse -196 -210 7.9644 0.0871
NP_440766.1_4 Forward -207 -193 0.687908 0.271
NP_441237.1_9 Reverse -201 -211 14.828 0.0242
NP_441237.1_9 Forward -202 -192 11.8781 0.153
NP_442743.1_5 Reverse -195 -214 4.52268 0.215
NP_441311.1_2 Forward -215 -201 11.1104 0.257
NP_442103.1_1 Forward -399 -385 16.8142 0.242
NP_440502.1_3 Reverse -163 -173 16.3223 0.1
NP_440457.1_1 Reverse -196 -208 8.88877 0.101
NP_442680.1_5 Forward -173 -154 5.15213 0.227
NP_441436.1_8 Reverse -46 -65 9.3409 0.266
NP_442509.1_9 Forward -209 -199 8.14104 0.192
NP_442509.1_9 Reverse -200 -210 8.14104 0.192
NP_440554.1_4 Forward -208 -198 7.05986 0.106
NP_441885.1_5 Forward -209 -199 20.9245 0.000538
NP_441885.1_5 Reverse -200 -210 20.9245 0.000538
NP_441885.1_5 Forward -203 -193 -0.41329 0.197
NP_440478.1_4 Forward -213 -194 13.1758 0.2
NP_442341.1_7 Forward -210 -196 17.6992 0.0111
NP_442341.1_7 Reverse -199 -213 12.3893 0.0454
NP_442341.1_7 Forward -204 -190 2.65453 0.249
NP_442341.1_9 Reverse -198 -212 9.14375 0.156
NP_442341.1_9 Forward -211 -197 7.3738 0.2
NP_441173.1_9 Reverse -276 -284 10.1471 0.261
NP_443000.1_7 Reverse -198 -208 17.0896 0.00865
NP_443000.1_7 Forward -211 -201 10.3048 0.0345
NP_440507.2_3 Reverse -191 -210 8.35677 0.253
NP_441842.1_10 Reverse -193 -207 9.34103 0.192
NP_441842.1_10 Reverse -187 -201 6.3911 0.291
NP_440275.1_3 Reverse -198 -208 8.1415 0.0602
NP_440275.1_3 Forward -211 -201 8.04317 0.0602
NP_440091.1_1 Reverse -196 -208 6.43049 0.095
NP_442451.1_2 Reverse -192 -211 -1.86883 0.179
NP_441207.1_7 Forward -169 -155 12.4502 0.241
NP_441207.1_7 Forward -167 -153 7.80321 0.295
NP_439962.1_4 Reverse -276 -295 -3.73712 0.257
NP_439962.1_4 Forward -298 -279 -8.35868 0.293
NP_442495.1_5 Reverse -113 -132 8.65258 0.291
NP_440149.1_8 Reverse -200 -219 4.71934 0.0809
NP_440149.1_8 Forward -209 -190 -7.17871 0.275
NP_439929.1_4 Reverse -94 -108 16.9268 0.28
NP_441105.1_3 Reverse -189 -208 3.14605 0.0936
NP_441105.1_3 Reverse -306 -325 -1.57384 0.15
NP_441105.1_3 Forward -214 -195 -7.08038 0.245
NP_441105.1_3 Forward -138 -119 -9.34199 0.288
NP_440216.1_1 Forward -209 -195 0.392915 0.0284
NP_440216.1_1 Reverse -200 -214 -10.3252 0.145
NP_440216.1_6 Reverse -193 -209 6.84337 0.189
NP_440216.1_9 Reverse -126 -135 7.76787 0.286
NP_440216.1_9 Forward -184 -175 5.40793 0.294
NP_440172.1_1 Forward -209 -199 15.0247 0.00945
NP_440172.1_1 Reverse -200 -210 15.0247 0.00945
NP_440172.1_1 Reverse -194 -204 10.3048 0.0524
NP_440172.1_1 Forward -280 -270 2.53664 0.277
NP_442371.1_1 Forward -285 -275 11.9759 0.273
NP_442015.1_10 Reverse -196 -209 19.2922 0.00444
NP_442015.1_10 Forward -213 -200 10.049 0.0415
NP_442015.1_10 Forward -137 -124 -0.964025 0.289
NP_441226.1_7 Forward -208 -201 14.4934 0.0123
NP_441226.1_7 Reverse -201 -208 14.4934 0.0123
NP_441226.1_7 Forward -202 -195 12.4284 0.0404
NP_441757.1_2 Forward -250 -232 6.01734 0.289
NP_441757.1_6 Reverse -108 -127 8.06259 0.191
NP_441111.1_7 Forward -208 -200 18.7023 0.00294
NP_441111.1_7 Reverse -201 -209 18.7023 0.00294
NP_442379.1_10 Forward -216 -199 -1.23946 0.223
NP_442379.1_10 Reverse -193 -210 -1.43612 0.223
NP_441766.1_2 Forward -209 -200 17.5026 0.00297
NP_441766.1_2 Reverse -200 -209 17.5026 0.00297
NP_440416.1_9 Forward -216 -197 -5.70374 0.0814
NP_440416.1_9 Reverse -193 -212 -8.35868 0.114
NP_440416.1_9 Forward -210 -191 -16.3235 0.212
NP_443052.1_8 Reverse -190 -209 -7.57203 0.161
NP_443052.1_9 Forward -400 -381 -1.86883 0.231
NP_440072.1_5 Forward -289 -271 -2.3408 0.271
NP_440845.1_1 Forward -283 -264 -3.83545 0.206
NP_441135.1_3 Forward -282 -263 9.63589 0.266
NP_442154.1_1 Reverse -186 -204 -15.3205 0.218
NP_442154.1_1 Forward -282 -264 -17.5821 0.26
NP_442226.1_8 Forward -335 -325 16.6963 0.164
NP_440261.1_5 Reverse -201 -214 -0.964025 0.0655
NP_440261.1_5 Forward -208 -195 -2.63565 0.0924
NP_440261.1_5 Reverse -272 -285 -3.02898 0.108
NP_440988.1_10 Forward -205 -191 19.9048 0.0733
NP_440988.1_10 Reverse -198 -212 15.7419 0.112
NP_440988.1_10 Reverse -122 -136 11.8693 0.187
NP_440988.1_10 Reverse -192 -206 7.80321 0.215
NP_440988.1_10 Forward -135 -121 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACTCACCTGCTCCGGCGGATTGTTCCGCTCAAAAGTACTAATCAAGTCGTCAAAATACTTATTAAATTTTGGCTGCAATTGCATAGTCCAAAAGCTGACTTTCCCCTCCATGCTCTGGGGGGAATTGCTCTGGCAACTGATTAATCCACTGAGCAACAGCCCAAGACACGCAAACAAAAACCAACGTCTTGGCGATCGCCATCGGCACCATGAAACCATCGTAAAAGCTGGGGAAAGAATAAAAAACAGTGGTTCAGGAATTGCATTGCCATGGCCACTTCACAAACCTAGCCAATTTTAGCTTGACCGCAACTTTGACAGATTGTCTTTTGACTTTGCCTGGACCGCCTCCCATAATACCTTCGCGTCTTGAAGACTTTATCCTTGAAAGGAGAACTA

CDS

ATGTTTAAATTATTCAACCAAGCTAGCCGAATTTTTTTTGGCATTGCCCTCCCCTGTCTAATTTTCCTGGGGGGGATTTTTTCCCTGGGTAACACCGCCCTAGCCGCTGACCTAGCCCATGGTAAAGCTATCTTTGCCGGTAACTGTGCCGCTTGTCATAATGGGGGCCTTAATGCCATCAACCCCAGCAAAACCTTAAAAATGGCAGACTTGGAAGCCAATGGTAAAAATTCCGTGGCGGCAATTGTGGCCCAGATCACCAATGGTAATGGCGCTATGCCTGGCTTTAAGGGTCGCATCAGTGACAGCGACATGGAAGATGTGGCGGCCTACGTGCTTGATCAAGCGGAAAAGGGCTGGTAG

Protein

MFKLFNQASRIFFGIALPCLIFLGGIFSLGNTALAADLAHGKAIFAGNCAACHNGGLNAINPSKTLKMADLEANGKNSVAAIVAQITNGNGAMPGFKGRISDSDMEDVAAYVLDQAEKGW