Your browser is old and dusty. Try Google Chrome!

Details for sll1791

ORF sll1791
Accession NP_440683.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY802a: 852462 - 853369]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441343.1_1 Forward -280 -261 15.7316 0.196
NP_441343.1_7 Reverse -99 -118 0.687771 0.278
NP_441818.1_9 Forward -269 -250 -5.40875 0.253
NP_441818.1_9 Forward -116 -97 -7.57203 0.272
NP_441818.1_9 Forward -115 -96 -10.817 0.299
NP_440259.1_4 Reverse -32 -46 18.1801 0.0912
NP_442287.1_5 Forward -234 -224 16.598 0.218
NP_441812.1_3 Reverse -364 -378 15.0442 0.106
NP_441812.1_3 Reverse -358 -372 8.55439 0.251
NP_440110.1_7 Forward -203 -184 11.5042 0.289
NP_440304.1_4 Forward -216 -206 4.60159 0.258
NP_440856.1_7 Reverse -378 -397 -5.50708 0.228
NP_441083.1_5 Reverse -205 -215 4.10993 0.158
NP_439957.1_10 Forward -48 -38 15.9097 0.278
NP_442889.1_1 Reverse -318 -337 -13.6686 0.262
NP_440053.1_2 Forward -240 -221 17.699 0.152
NP_441716.1_1 Reverse -239 -253 9.04604 0.127
NP_441716.1_1 Forward -368 -354 3.04785 0.282
NP_441163.1_1 Reverse -180 -197 7.90458 0.235
NP_441130.1_10 Reverse -176 -190 6.98109 0.173
NP_442145.1_4 Reverse -152 -171 5.1084 0.261
NP_443017.1_1 Reverse -63 -82 16.5041 0.191
NP_441695.1_4 Forward -134 -116 12.7038 0.22
NP_441634.1_9 Reverse -355 -374 12.4867 0.209
NP_442687.1_7 Forward -215 -205 7.84651 0.123
NP_440781.1_1 Reverse -317 -331 11.3077 0.293
NP_440642.1_10 Reverse -32 -46 12.782 0.133
NP_440642.1_10 Reverse -41 -55 6.68548 0.225
NP_440642.1_10 Forward -137 -123 3.73557 0.265
NP_440181.1_3 Forward -380 -361 10.7175 0.225
NP_440141.1_4 Reverse -321 -340 -8.752 0.298
NP_442205.1_9 Reverse -121 -137 1.14018 0.255
NP_440656.1_8 Reverse -96 -115 -9.44032 0.286
NP_441478.1_5 Forward -341 -322 15.8307 0.236
NP_442057.1_5 Forward -111 -93 13.6455 0.229
NP_442486.1_6 Reverse -239 -258 -5.99873 0.28
NP_439905.1_1 Forward -332 -319 10.639 0.216
NP_439905.1_1 Reverse -179 -192 9.16406 0.221
NP_440858.1_1 Forward -399 -380 3.14605 0.13
NP_440496.1_9 Forward -131 -112 6.19431 0.233
NP_441099.1_5 Forward -318 -299 -12.0953 0.294
NP_440475.1_5 Forward -56 -37 19.174 0.0274
NP_442013.1_10 Forward -366 -347 9.3409 0.169
NP_442013.1_10 Forward -246 -227 7.96426 0.174
NP_442013.1_10 Forward -282 -263 5.211 0.254
NP_441646.1_1 Forward -340 -321 0.884433 0.242
NP_442438.1_10 Forward -99 -85 -0.492064 0.264
NP_441110.1_1 Forward -251 -232 12.0942 0.164
NP_441550.1_8 Reverse -357 -367 6.17443 0.214
NP_441041.1_4 Forward -275 -256 -12.6852 0.272
NP_441725.1_5 Reverse -206 -216 -0.0199663 0.223
NP_441554.1_4 Forward -21 -7 15.2706 0.22
NP_440260.1_8 Reverse -321 -339 3.3624 0.17
NP_442575.1_8 Reverse -115 -134 -1.7705 0.232
NP_441644.1_6 Forward -368 -358 8.43603 0.0998
NP_442215.1_2 Reverse -203 -219 -1.12144 0.179
NP_442215.1_2 Reverse -15 -31 -6.03799 0.263
NP_442029.1_6 Forward -239 -220 3.34271 0.282
NP_442029.1_10 Forward -205 -186 4.52268 0.29
NP_442933.1_5 Forward -129 -110 14.8474 0.115
NP_440576.1_2 Forward -167 -148 9.73422 0.251
NP_442554.1_8 Reverse -360 -370 4.0116 0.2
NP_443009.1_5 Reverse -106 -117 6.64635 0.154
NP_442406.1_9 Forward -340 -321 9.3409 0.262
NP_441015.1_8 Forward -57 -38 3.04771 0.272
NP_441096.1_5 Reverse -5 -23 15.358 0.297
NP_441016.2_6 Reverse -224 -243 8.55343 0.222
NP_441826.1_2 Reverse -353 -367 -3.73699 0.286
NP_442227.1_2 Forward -134 -115 16.2241 0.127
NP_442227.1_2 Forward -135 -116 5.11266 0.202
NP_441911.1_10 Forward -49 -30 19.7422 0.0263
NP_442808.1_1 Reverse -322 -332 2.43787 0.266
NP_440031.1_10 Reverse -187 -206 9.93088 0.167
NP_440346.1_7 Forward -24 -5 8.45592 0.233
NP_440558.1_2 Forward -342 -323 3.6377 0.154
NP_442789.1_4 Reverse -379 -398 -1.37718 0.219
NP_441878.1_6 Forward -340 -330 10.1081 0.0184
NP_441878.1_6 Reverse -329 -339 0.373358 0.144
NP_441878.1_6 Forward -334 -324 -7.39479 0.222
NP_441557.1_8 Forward -129 -119 14.0409 0.201
NP_441445.1_1 Forward -257 -238 2.65439 0.233
NP_441445.1_1 Reverse -169 -188 1.57275 0.252
NP_441433.1_8 Reverse -194 -213 -2.36049 0.268
NP_440084.1_6 Forward -259 -245 18.9777 0.188
NP_440101.1_3 Reverse -319 -338 7.07928 0.18
NP_440157.1_5 Forward -376 -357 14.5621 0.291
NP_441037.1_4 Forward -334 -324 7.12278 0.237
NP_441633.1_3 Forward -325 -312 -7.06055 0.288
NP_442590.1_10 Reverse -318 -337 5.01433 0.267
NP_440899.1_8 Reverse -31 -50 -9.44032 0.262
NP_440299.1_1 Forward -366 -353 7.09854 0.121
NP_440299.1_3 Reverse -228 -247 8.65258 0.284
NP_440256.1_1 Reverse -263 -282 -10.227 0.297
NP_441559.1_8 Reverse -319 -333 -6.58858 0.279
NP_442785.1_7 Forward -335 -321 8.35772 0.298
NP_441866.1_6 Reverse -285 -304 13.175 0.163
NP_442866.1_1 Reverse -318 -337 -1.86883 0.205
NP_441340.1_9 Forward -39 -29 9.02648 0.256
NP_442791.1_4 Forward -350 -331 12.3892 0.283
NP_440597.1_4 Forward -282 -264 19.7828 0.101
NP_442251.1_6 Reverse -206 -213 8.10225 0.245
NP_443038.1_10 Reverse -24 -43 12.585 0.277
NP_439937.1_9 Reverse -337 -354 -11.5649 0.257
NP_440408.1_7 Reverse -121 -140 6.98095 0.295
NP_442488.1_4 Reverse -348 -367 7.86593 0.298
NP_442384.1_10 Reverse -178 -191 3.75586 0.179
NP_440282.1_3 Reverse -325 -344 -3.3438 0.298
NP_442750.1_3 Forward -119 -100 -11.6036 0.256
NP_442556.1_10 Forward -104 -85 9.9767 0.273
NP_440297.1_9 Reverse -331 -341 0.176696 0.282
NP_440350.1_5 Reverse -22 -41 11.7992 0.134
NP_440350.1_5 Reverse -28 -47 0.392778 0.162
NP_440350.1_5 Reverse -40 -59 -3.63879 0.261
NP_440350.1_5 Reverse -10 -29 -5.80207 0.292
NP_439926.1_7 Forward -57 -39 7.78729 0.204
NP_442280.1_10 Forward -135 -117 6.03883 0.28
NP_440990.1_4 Forward -374 -355 12.8808 0.288
NP_440894.1_10 Forward -219 -200 14.8474 0.0958
NP_442277.1_7 Forward -393 -377 -1.42558 0.276
NP_442315.1_1 Forward -241 -223 3.46073 0.288
NP_442315.1_1 Forward -250 -232 3.26407 0.292
NP_443064.1_6 Forward -187 -177 11.3065 0.13
NP_440519.1_8 Forward -245 -229 2.91013 0.254
NP_442204.1_5 Reverse -314 -333 -0.688862 0.296
NP_440544.1_5 Reverse -41 -48 13.8024 0.28
NP_442697.1_2 Forward -287 -268 18.3873 0.0797
NP_440783.1_5 Reverse -318 -337 1.17943 0.191
NP_440673.1_2 Reverse -320 -339 8.24345 0.275
NP_441052.1_2 Reverse -239 -249 5.5849 0.111
NP_441052.1_2 Reverse -224 -234 3.61828 0.177
NP_441052.1_2 Reverse -245 -255 0.176696 0.262
NP_441004.1_3 Reverse -273 -292 6.29264 0.224
NP_441273.1_9 Forward -387 -368 12.926 0.279
NP_441683.1_7 Forward -231 -212 -10.227 0.284
NP_439960.1_10 Forward -132 -114 5.23069 0.155
NP_441477.1_10 Forward -369 -351 4.24738 0.203
NP_440431.1_4 Forward -43 -24 12.7478 0.038
NP_440431.1_4 Forward -392 -373 -10.0748 0.295
NP_441031.1_6 Forward -134 -115 0.392778 0.296
NP_439950.1_1 Forward -118 -109 12.4878 0.279
NP_440195.1_4 Forward -338 -319 7.27595 0.26
NP_440483.1_1 Forward -346 -327 -6.68705 0.252
NP_441570.1_1 Forward -248 -230 -0.177514 0.0437
NP_441570.1_1 Forward -368 -350 -17.0904 0.264
NP_442348.1_2 Forward -116 -107 7.96454 0.28
NP_442443.1_1 Forward -340 -321 -6.1954 0.293
NP_440793.1_1 Reverse -376 -390 9.34041 0.293
NP_441333.1_1 Reverse -376 -386 16.547 0.164
NP_441333.1_1 Reverse -375 -385 12.2572 0.238
NP_441732.1_2 Forward -372 -356 -16.8544 0.207
NP_442447.1_1 Forward -45 -26 6.78429 0.258
NP_442447.1_1 Forward -396 -377 4.03102 0.281
NP_442797.1_7 Reverse -322 -340 2.77242 0.238
NP_440199.1_10 Forward -66 -56 6.46988 0.299
NP_441945.1_10 Reverse -380 -399 8.25926 0.273
NP_441945.1_10 Reverse -329 -348 8.25926 0.273
NP_443011.1_4 Forward -249 -230 11.3075 0.212
NP_442968.1_8 Forward -130 -111 16.1257 0.123
NP_440713.1_4 Forward -258 -239 14.5524 0.0861
NP_442489.1_7 Reverse -205 -214 -1.86856 0.259
NP_440860.1_6 Forward -115 -96 11.9958 0.293
NP_441040.1_2 Reverse -315 -334 -16.1268 0.294
NP_440442.1_1 Forward -233 -214 9.14423 0.157
NP_442346.1_5 Reverse -238 -248 5.87989 0.225
NP_440459.1_2 Reverse -321 -338 11.4452 0.175
NP_443040.1_1 Forward -46 -32 11.7301 0.276
NP_441329.1_6 Forward -48 -29 2.81659 0.217
NP_441329.1_6 Forward -33 -14 0.0473228 0.266
NP_440912.1_3 Reverse -29 -48 8.06178 0.286
NP_442404.1_9 Reverse -224 -238 10.1271 0.263
NP_442073.1_6 Forward -354 -335 -3.54046 0.291
NP_442547.1_7 Reverse -320 -339 14.5051 0.171
NP_442028.1_1 Reverse -30 -43 11.1388 0.251
NP_442028.1_1 Forward -114 -101 6.65072 0.298
NP_441239.1_9 Reverse -328 -340 4.36554 0.253
NP_442568.1_8 Forward -380 -366 8.06273 0.296
NP_441892.1_1 Reverse -321 -338 4.95539 0.105
NP_440665.1_1 Reverse -260 -279 -17.2085 0.298
NP_442669.1_1 Forward -91 -72 1.67108 0.216
NP_441541.1_1 Reverse -152 -170 2.86674 0.195
NP_442402.1_4 Reverse -216 -235 1.96529 0.173
NP_439948.1_1 Forward -107 -90 19.2141 0.203
NP_441084.1_6 Reverse -190 -204 10.9924 0.225
NP_442039.1_4 Forward -196 -189 8.39725 0.202
NP_442679.1_1 Forward -53 -34 3.83436 0.147
NP_442679.1_1 Forward -51 -32 2.45773 0.164
NP_442679.1_1 Forward -52 -33 2.16274 0.167
NP_442679.1_1 Forward -50 -31 -5.40875 0.293
NP_440160.1_9 Forward -339 -320 8.75091 0.256
NP_442844.1_5 Reverse -283 -302 3.14526 0.26
NP_442532.1_2 Reverse -149 -168 10.074 0.121
NP_440914.1_1 Forward -248 -238 11.738 0.079
NP_440914.1_1 Forward -368 -358 11.3477 0.097
NP_440724.1_5 Forward -30 -12 15.6538 0.262
NP_442533.1_1 Reverse -181 -200 -8.35868 0.204
NP_442533.1_1 Forward -239 -220 -16.2252 0.263
NP_442533.1_6 Reverse -331 -340 7.57121 0.0898
NP_442533.1_6 Forward -338 -329 5.50626 0.14
NP_442533.1_6 Forward -339 -330 4.52295 0.179
NP_442533.1_6 Reverse -330 -339 4.52295 0.179
NP_442533.1_6 Forward -368 -359 1.37636 0.3
NP_442322.1_4 Reverse -322 -339 -8.31994 0.286
NP_441527.1_4 Forward -48 -29 2.81659 0.125
NP_441527.1_4 Forward -44 -25 0.429291 0.136
NP_441527.1_4 Forward -42 -23 -0.334645 0.146
NP_441527.1_4 Forward -50 -31 -0.716613 0.146
NP_441527.1_4 Forward -56 -37 -1.48055 0.148
NP_441527.1_4 Forward -51 -32 -4.63178 0.188
NP_441527.1_4 Forward -62 -43 -8.16498 0.241
NP_441527.1_4 Forward -58 -39 -8.26048 0.242
NP_441527.1_4 Forward -41 -22 -8.35597 0.243
NP_441527.1_4 Forward -59 -40 -10.4568 0.27
NP_441527.1_4 Forward -45 -26 -11.0297 0.278
NP_441527.1_4 Forward -395 -376 -11.4117 0.282
NP_441527.1_4 Forward -53 -34 -11.6982 0.284
NP_441527.1_4 Forward -47 -28 -12.7486 0.293
NP_441106.1_3 Reverse -60 -79 11.3075 0.217
NP_441815.1_3 Forward -334 -315 9.43923 0.257
NP_439903.1_6 Forward -217 -198 0.686995 0.258
NP_442306.1_10 Forward -373 -354 -21.83 0.291
NP_440886.1_7 Reverse -187 -197 3.12618 0.296
NP_440404.1_9 Forward -389 -370 13.9891 0.195
NP_440404.1_9 Forward -51 -32 10.4559 0.209
NP_442213.1_5 Forward -110 -91 -1.08219 0.293
NP_440028.1_6 Forward -239 -221 12.4089 0.24
NP_440907.2_8 Reverse -57 -67 5.58445 0.194
NP_440962.1_5 Reverse -30 -40 16.6963 0.261
NP_441463.1_3 Reverse -229 -248 3.34271 0.103
NP_441463.1_3 Reverse -349 -368 -5.11376 0.22
NP_442365.1_7 Reverse -56 -75 -4.22878 0.238
NP_441993.1_1 Reverse -324 -343 5.55261 0.2
NP_442698.1_10 Forward -55 -36 6.19431 0.233
NP_442698.1_10 Forward -56 -37 0.58944 0.297
NP_441853.1_5 Forward -23 -4 0.294447 0.283
NP_440293.1_3 Forward -340 -321 -2.0655 0.239
NP_440293.1_3 Forward -341 -322 -2.75381 0.241
NP_439988.1_3 Reverse -319 -333 10.4227 0.225
NP_440643.1_6 Forward -344 -325 2.75272 0.246
NP_442680.1_5 Forward -51 -32 5.4452 0.225
NP_442680.1_5 Forward -50 -31 3.00294 0.237
NP_442509.1_6 Forward -245 -226 7.57094 0.294
NP_441765.1_4 Forward -306 -287 16.5191 0.138
NP_442862.1_3 Forward -238 -221 5.15205 0.28
NP_442737.1_5 Forward -243 -224 14.2364 0.199
NP_442737.1_5 Forward -249 -230 11.0368 0.294
NP_441466.1_10 Forward -309 -290 20.649 0.297
NP_442395.2_4 Forward -324 -305 0.883656 0.258
NP_440750.1_5 Forward -298 -284 21.7307 0.0569
NP_440091.1_1 Forward -252 -240 1.21895 0.204
NP_442275.1_1 Reverse -314 -333 3.14605 0.284
NP_440679.1_5 Reverse -227 -246 5.30933 0.292
NP_441207.1_7 Reverse -100 -114 9.54584 0.275
NP_441207.1_7 Forward -45 -31 9.54584 0.275
NP_442495.1_4 Forward -341 -331 12.5664 0.224
NP_441105.1_3 Reverse -319 -338 -8.55534 0.274
NP_440172.1_1 Forward -368 -358 7.45319 0.0789
NP_440172.1_1 Forward -214 -204 2.63497 0.274
NP_442015.1_10 Reverse -174 -187 -0.964025 0.289
NP_440416.1_1 Forward -214 -195 -14.6519 0.295
NP_440416.1_9 Forward -137 -118 -18.7818 0.264
NP_443052.1_9 Forward -133 -114 -3.3438 0.249
NP_442403.1_8 Forward -246 -227 0.196116 0.241
NP_442154.1_1 Forward -241 -223 -19.2537 0.294
NP_440261.1_10 Forward -19 -5 13.4709 0.207
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCGCCACCAAGGTGAAAACTAAAAAAGTTGAAGCCGATGACGACCTTTTGGACGACACTAGGGCCCGGGCCTATGCCGGCACTCAACTCAGTCAGGATGACGAAGAGTTTGAAGAAACCTACGACACCGATGAGGATGATTTCGATATGGATGACGATGACGATTTTGGGGATGATGAGGATTAAGGGTAATCTCCTATGCCCCGAGCTTGCGGACGTTCAGCATCCCTATTTTTATATTTCTAGATATTTCTAGCTAGTCAGTATCCCTTCCCTTCTCCGGGCGGGGATTATTTTTTTTGCGGGCTGCTATGAGCTCATTTATAAAGTCTTGTAATGGATAGCAAGTAGGAGAAGAAAAAAAGGAAAACTAAGAGTAAGAGCAGAAGGAGACAAAGAGC

CDS

ATGAAAAGTCTGACAGCCTATGAAACAGACCTGAGCGATGCAGAATGGGCAATACTTGAACCAATGATTCCTCCCGCAAAGCCCGGAGGACACCCACGAACCACAGATATGCGAGCGGTTTGTAATGGTATTTACTACCAACTAAAAACGGGTTGTCAATGGGCAATGTTACCCCATGACTTTCCTCCTAGTAGCACGGTCTATAGCTATTACCGTAAATGGCAACGTCATGGCGTGTGGGAAAGGCTCAATCTAAGGCTGTTGGAGCAATGCCGCCTCCAGAGTGGCAAGAGCCTTGAGCCCAGCGTGATAGCGGCAGATAGTCAATCGGTAAAAACCACCGAAAAAAGGGGGAAGTCTACGGTTTTGACGGAGGTAAGAAGGTGA

Protein

MKSLTAYETDLSDAEWAILEPMIPPAKPGGHPRTTDMRAVCNGIYYQLKTGCQWAMLPHDFPPSSTVYSYYRKWQRHGVWERLNLRLLEQCRLQSGKSLEPSVIAADSQSVKTTEKRGKSTVLTEVRR