Your browser is old and dusty. Try Google Chrome!

Details for sll1785

ORF sll1785
Accession NP_440964.1
Symbol
Category periplasmic protein, function unknown
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442272.1_4 Forward -306 -288 16.0647 0.247
NP_440348.1_6 Forward -224 -205 2.45773 0.288
NP_442752.1_4 Forward -251 -244 7.90559 0.144
NP_442752.1_4 Reverse -110 -117 5.84064 0.166
NP_441812.1_1 Reverse -206 -220 13.4703 0.234
NP_441054.1_3 Reverse -100 -118 16.1317 0.217
NP_441145.1_1 Reverse -325 -344 3.93269 0.269
NP_442062.1_8 Reverse -260 -270 3.81494 0.252
NP_442062.1_8 Forward -183 -173 3.22496 0.279
NP_440916.1_1 Reverse -196 -210 9.34103 0.236
NP_441208.1_1 Forward -343 -324 -5.01543 0.272
NP_440300.1_1 Reverse -329 -348 7.57013 0.274
NP_441083.1_3 Forward -91 -81 15.5158 0.138
NP_441083.1_5 Forward -119 -109 4.99491 0.126
NP_441738.1_2 Forward -117 -110 8.20023 0.181
NP_441770.1_4 Forward -391 -372 -9.44032 0.254
NP_442059.1_10 Reverse -126 -145 14.0608 0.166
NP_442570.1_3 Forward -185 -166 -1.37718 0.212
NP_441716.1_2 Forward -383 -364 -0.0896902 0.266
NP_441327.1_5 Forward -47 -38 14.651 0.192
NP_442111.1_3 Forward -47 -34 13.4306 0.261
NP_440012.1_6 Reverse -363 -382 8.94757 0.247
NP_440842.1_10 Forward -345 -331 1.37622 0.294
NP_440376.1_1 Forward -344 -335 3.44131 0.203
NP_442687.1_1 Reverse -28 -41 11.9167 0.273
NP_442687.1_5 Reverse -297 -311 17.2168 0.277
NP_441077.1_2 Reverse -223 -242 0.811258 0.29
NP_441846.1_10 Reverse -109 -128 -22.0267 0.257
NP_440642.1_10 Forward -122 -108 5.60385 0.241
NP_442937.1_5 Forward -181 -162 7.17762 0.26
NP_441317.1_4 Forward -148 -134 14.716 0.161
NP_441317.1_4 Forward -147 -133 13.952 0.164
NP_440318.1_1 Forward -183 -164 0.0977854 0.298
NP_440203.1_5 Reverse -245 -255 14.5325 0.0886
NP_440203.1_5 Forward -267 -257 8.92768 0.281
NP_440985.1_4 Reverse -213 -232 17.9043 0.248
NP_442690.1_1 Forward -217 -198 -6.78538 0.169
NP_442690.1_1 Forward -229 -210 -15.0452 0.277
NP_442690.1_1 Reverse -196 -215 -16.6185 0.29
NP_443055.1_6 Forward -134 -116 3.45998 0.196
NP_440496.1_1 Forward -51 -32 6.09597 0.266
NP_441752.1_6 Reverse -70 -89 5.60432 0.211
NP_440569.1_10 Forward -215 -196 5.1084 0.24
NP_440289.1_2 Reverse -107 -120 -4.50394 0.288
NP_442281.1_1 Forward -256 -242 4.62054 0.187
NP_442575.1_8 Reverse -106 -125 -6.78538 0.286
NP_442172.1_1 Reverse -207 -226 16.9969 0.17
NP_439983.1_7 Forward -151 -133 10.3439 0.277
NP_441087.1_6 Forward -127 -109 0.313405 0.258
NP_442177.1_5 Forward -347 -333 8.06273 0.288
NP_442029.1_6 Forward -182 -163 8.35759 0.207
NP_441751.2_8 Reverse -243 -257 -6.78525 0.283
NP_442554.1_8 Reverse -63 -73 2.04498 0.285
NP_442554.1_9 Forward -396 -377 14.6943 0.246
NP_442142.1_7 Reverse -109 -126 13.3135 0.298
NP_442408.2_1 Forward -119 -100 2.55606 0.165
NP_441448.1_1 Reverse -381 -400 5.60432 0.261
NP_440464.1_10 Forward -341 -331 13.2946 0.169
NP_441020.2_6 Reverse -108 -125 7.80699 0.218
NP_442811.1_2 Reverse -246 -265 0.687771 0.252
NP_441251.1_7 Forward -211 -198 15.7522 0.266
NP_442808.1_1 Reverse -334 -344 5.38779 0.155
NP_440038.1_4 Forward -379 -360 -0.0988766 0.277
NP_440334.1_2 Reverse -169 -182 14.5723 0.238
NP_441048.1_1 Forward -347 -328 16.7157 0.287
NP_441557.1_4 Forward -211 -197 11.0127 0.291
NP_441467.1_10 Forward -146 -132 5.89945 0.281
NP_442645.1_2 Forward -104 -85 -16.6185 0.237
NP_442594.1_8 Reverse -109 -128 3.04771 0.289
NP_442594.1_10 Forward -128 -109 13.9616 0.153
NP_440151.1_2 Forward -127 -109 17.2262 0.222
NP_442998.1_5 Forward -208 -198 13.7464 0.157
NP_440899.1_2 Forward -262 -243 6.88182 0.25
NP_440977.1_5 Forward -214 -201 17.4232 0.141
NP_440256.1_1 Forward -186 -167 -8.94866 0.27
NP_440717.1_2 Forward -95 -76 -10.227 0.245
NP_441866.1_2 Reverse -31 -50 17.7133 0.252
NP_441866.1_4 Forward -146 -133 16.7464 0.234
NP_442957.1_8 Forward -185 -166 7.27595 0.288
NP_440677.1_8 Forward -197 -178 13.8641 0.281
NP_441340.1_9 Forward -47 -37 8.54444 0.256
NP_442240.1_1 Forward -128 -109 7.96345 0.244
NP_440408.1_7 Reverse -74 -93 10.5209 0.247
NP_440271.1_2 Reverse -102 -121 1.0811 0.284
NP_441789.1_7 Reverse -163 -182 -5.21283 0.294
NP_442887.1_5 Forward -265 -246 -11.8003 0.27
NP_441877.1_5 Forward -186 -167 5.211 0.2
NP_442572.1_1 Forward -400 -381 8.16093 0.254
NP_441018.1_7 Forward -157 -138 7.57094 0.269
NP_440189.1_2 Reverse -110 -129 -0.983855 0.294
NP_440297.1_9 Forward -70 -60 6.37155 0.193
NP_440297.1_9 Forward -250 -240 -0.511621 0.289
NP_440888.1_2 Forward -183 -169 8.84875 0.145
NP_440739.1_8 Forward -324 -305 3.34271 0.299
NP_442966.1_7 Forward -205 -188 19.1175 0.122
NP_443062.1_6 Reverse -311 -330 0.58944 0.292
NP_442204.1_1 Forward -255 -244 0.550326 0.281
NP_440516.1_8 Reverse -110 -119 -0.196935 0.185
NP_440128.1_6 Forward -277 -258 18.3865 0.242
NP_441052.1_2 Reverse -335 -345 5.97822 0.0968
NP_440436.1_4 Forward -176 -167 4.52254 0.256
NP_442907.1_9 Reverse -81 -100 -6.49039 0.289
NP_441363.1_1 Forward -141 -122 8.65258 0.236
NP_441004.1_1 Forward -182 -163 -14.3569 0.267
NP_440129.1_10 Reverse -103 -117 1.96621 0.28
NP_442515.1_1 Reverse -332 -346 3.44117 0.119
NP_441982.1_6 Reverse -352 -361 13.5358 0.274
NP_441349.1_10 Forward -341 -322 -9.14533 0.284
NP_441124.1_5 Forward -208 -198 16.1594 0.188
NP_440431.1_3 Forward -218 -199 -8.85033 0.239
NP_440023.1_5 Forward -224 -205 6.19431 0.27
NP_442006.1_2 Reverse -116 -133 -17.3657 0.274
NP_442006.1_2 Reverse -110 -127 -19.234 0.299
NP_442038.1_1 Forward -214 -195 2.3594 0.275
NP_442443.1_4 Reverse -135 -145 14.8275 0.202
NP_441732.1_2 Reverse -151 -167 -17.641 0.281
NP_442400.1_10 Reverse -198 -211 9.61097 0.271
NP_442489.1_2 Forward -388 -369 10.6192 0.168
NP_441022.1_1 Forward -44 -35 13.7524 0.188
NP_441022.1_1 Reverse -195 -204 13.5606 0.216
NP_442008.1_2 Forward -165 -146 4.62101 0.234
NP_441185.1_6 Forward -181 -162 0.982764 0.224
NP_441629.1_3 Reverse -151 -170 -0.787962 0.25
NP_442943.1_1 Reverse -210 -225 12.9631 0.123
NP_440227.1_4 Reverse -362 -379 10.8545 0.28
NP_441239.1_9 Forward -129 -117 6.1355 0.2
NP_442568.1_8 Reverse -168 -182 13.7659 0.257
NP_442643.1_5 Reverse -170 -189 -6.09707 0.293
NP_441541.1_1 Forward -320 -302 -0.666458 0.237
NP_440675.1_1 Reverse -371 -390 3.83436 0.246
NP_442465.1_9 Reverse -132 -146 21.8291 0.0632
NP_441184.1_3 Forward -98 -79 6.58763 0.249
NP_442479.1_9 Reverse -196 -215 -13.0786 0.288
NP_442402.1_6 Forward -210 -201 12.9794 0.289
NP_442402.1_10 Reverse -199 -209 10.501 0.288
NP_442923.1_4 Forward -182 -163 -5.9004 0.293
NP_441811.1_1 Reverse -332 -351 4.12936 0.293
NP_442679.1_1 Reverse -96 -115 -4.32711 0.276
NP_440505.1_3 Forward -346 -336 4.60159 0.277
NP_441959.1_8 Forward -31 -18 8.70929 0.286
NP_442533.1_1 Reverse -107 -126 -7.37537 0.188
NP_442533.1_6 Forward -120 -111 1.96635 0.28
NP_442541.1_10 Forward -121 -107 14.7486 0.182
NP_442541.1_10 Forward -127 -113 8.65209 0.218
NP_440263.1_5 Forward -212 -198 6.98109 0.294
NP_442322.1_4 Reverse -333 -350 -10.1882 0.298
NP_440854.1_1 Reverse -220 -239 6.73176 0.209
NP_442269.1_10 Forward -152 -133 3.6377 0.248
NP_441697.1_5 Forward -376 -357 -10.1703 0.278
NP_441527.1_4 Reverse -132 -151 -11.6982 0.284
NP_440007.1_9 Forward -255 -241 2.16287 0.281
NP_441106.1_3 Reverse -211 -230 12.1925 0.217
NP_441930.1_3 Reverse -196 -215 4.50265 0.269
NP_440886.1_7 Reverse -334 -344 5.58445 0.175
NP_442800.1_7 Forward -178 -159 16.8141 0.12
NP_442022.1_4 Forward -84 -65 6.39097 0.271
NP_441463.1_3 Forward -280 -261 -4.52377 0.207
NP_441993.1_1 Forward -176 -157 1.26449 0.282
NP_442698.1_10 Reverse -127 -146 0.491109 0.297
NP_441237.1_9 Reverse -111 -121 10.1081 0.248
NP_442930.1_1 Reverse -197 -207 12.3692 0.239
NP_442867.1_8 Forward -118 -99 4.03102 0.293
NP_440457.1_1 Reverse -106 -118 0.137309 0.25
NP_440798.1_1 Reverse -196 -214 10.5418 0.294
NP_441801.1_4 Forward -130 -120 3.02829 0.231
NP_442680.1_5 Reverse -126 -145 2.70987 0.237
NP_440801.1_10 Forward -348 -329 5.50599 0.289
NP_440142.1_7 Reverse -112 -131 11.9958 0.2
NP_442509.1_9 Reverse -110 -120 11.1893 0.142
NP_442862.1_3 Reverse -198 -215 5.25038 0.279
NP_442862.1_3 Reverse -296 -313 4.75873 0.287
NP_441173.1_9 Reverse -201 -209 10.9338 0.242
NP_440191.1_4 Forward -221 -211 13.1481 0.282
NP_440191.1_6 Forward -34 -20 15.5768 0.294
NP_440191.1_6 Reverse -17 -31 15.3858 0.294
NP_441902.1_3 Forward -13 -3 14.5365 0.218
NP_441122.1_1 Forward -181 -166 3.91314 0.28
NP_441207.1_7 Forward -207 -193 9.2554 0.282
NP_440804.1_7 Forward -32 -15 13.2144 0.175
NP_439929.1_4 Forward -49 -35 18.8549 0.234
NP_442371.1_1 Forward -209 -199 14.0409 0.191
NP_440244.1_1 Reverse -108 -127 -8.16202 0.287
NP_442417.1_2 Reverse -249 -267 17.6204 0.127
NP_440416.1_9 Forward -184 -165 -3.54046 0.0746
NP_440416.1_9 Forward -127 -108 -20.7484 0.288
NP_442116.1_6 Forward -214 -197 8.8374 0.238
NP_442403.1_9 Reverse -248 -267 5.30933 0.211
NP_440591.1_5 Reverse -76 -95 10.0284 0.234
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCATGCTCCCCTTTATGGTATTAACCAAAGCTACTACTTTTTTGAGTATGTAGATGGGGTTAGCGGCAAGCTACCAACGTCATTAACTAAGTTAGAAAATGATCAGAGCTTAAACCGGATTATCGATACTATCAATGCCTACAATCAAGGCGATGCAACTGTTAAATGCTTTTAATACTTTCAACAATTTCTGGGAAAATTTATGAGTAAAGAACTAGGCTTTGCCATTCTTGGCGGCTGGATCTTAGGAGTGATTTTTGGCTTTTTCAAACTCCCCTTGCCCGTTCCCCCTTTTGAAGGCTTAGTCGCTGCCGGAGCCTGTCTTTTAGGCCAAGTCACTTACACGTTTATCAAGCAAAAATTTGGTTTTTAAATCTAAATTAGCCTGGAGAAGCAATT

CDS

ATGCTATTGAAAGTCAAACTTTGGGGTATTGGTCTAGTTTTAACTCTGACGTTGGGGACTATTCTGTTTTTGCAAAATTTTAGCGTTGCCGCAGAAACAGAAATTCATACCTTTGACGATATTCCCATGCCCAAATTAGCGGATCCCCTGCTAATTTATACTCCTGCCAACGAAATTTTTGATATTGCTTCCTGTAGTGCCAAGGACATTGGTTTTGCCATCGCCCACGCCCAAATTCCCCCCGGAGGCGGCCCCATGCCCCATATTCATTACTTCATCAATGAATGGTTTTGGACTCCGGAAGGCGGTATTGAACTGTTCCACAGCACTAAACAATATCCCAATATGGACGAGTTACCTGTGGTCGGGGGAGCCGGTCGGGGAGATTTGTATAGCATTCAAAGCGAACCCAAACAATTGATTTATTCTCCCAACCATTACATGCATGGTTTTGTTAATCCTACGGATAAAACATTACCCATTGTTTTTGTTTGGATGCGTAATGAAGTTGCACCGGATTTTCCCTACCATGACGGTGGGATGCGGGAATATTTTCAAGCTGTGGGGCCCCGCATTACTGATTTGAACAATTTACCGGAATTGACCAATGCCCAAAGGGCGGCCTTTGCTTCGGAAGCTCCCAAATATGGGATTAATCAAAGTTCCTACTTTATGGAATATGTCAACACCATTAGTGACAAATTACCTGCCCAAATTGCCAAACTAAAAAATGATAAAGACTTAGAGCGTATGGTGGAGGTAATTGAAGCTTTTAACCGTGGTGATAAATCGGTAACCTGCTCATGA

Protein

MLLKVKLWGIGLVLTLTLGTILFLQNFSVAAETEIHTFDDIPMPKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGPMPHIHYFINEWFWTPEGGIELFHSTKQYPNMDELPVVGGAGRGDLYSIQSEPKQLIYSPNHYMHGFVNPTDKTLPIVFVWMRNEVAPDFPYHDGGMREYFQAVGPRITDLNNLPELTNAQRAAFASEAPKYGINQSSYFMEYVNTISDKLPAQIAKLKNDKDLERMVEVIEAFNRGDKSVTCS