Your browser is old and dusty. Try Google Chrome!

Details for sll1783

ORF sll1783
Accession NP_440966.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -178 -164 -0.0987402 0.221
NP_440795.1_7 Forward -178 -171 14.6904 0.0123
NP_440795.1_7 Reverse -171 -178 14.6904 0.0123
NP_442291.1_5 Forward -180 -164 -1.80975 0.202
NP_442291.1_5 Reverse -169 -185 -4.07137 0.263
NP_441453.1_4 Reverse -170 -178 16.539 0.00633
NP_441453.1_4 Forward -179 -171 16.539 0.00633
NP_441453.1_4 Reverse -75 -83 4.93597 0.224
NP_441453.1_7 Forward -63 -56 12.9205 0.23
NP_441623.1_1 Forward -78 -60 -4.50408 0.274
NP_442151.1_6 Reverse -170 -184 20.4524 0.0045
NP_442151.1_6 Forward -179 -165 8.75105 0.164
NP_441818.1_1 Reverse -171 -182 10.1862 0.232
NP_440226.1_1 Reverse -170 -189 5.70265 0.148
NP_442173.1_1 Forward -178 -170 15.4574 0.00633
NP_442173.1_1 Reverse -171 -179 15.4574 0.00633
NP_442752.1_4 Forward -179 -172 13.8055 0.0199
NP_442752.1_4 Reverse -170 -177 13.8055 0.0199
NP_442752.1_4 Forward -84 -77 4.26735 0.293
NP_442975.1_10 Forward -183 -169 11.2087 0.0508
NP_442975.1_10 Reverse -166 -180 1.37564 0.299
NP_440784.1_7 Forward -178 -171 15.9687 0.0123
NP_440784.1_7 Reverse -171 -178 15.9687 0.0123
NP_442909.1_7 Forward -178 -164 9.93039 0.14
NP_441250.1_3 Reverse -333 -352 1.0811 0.298
NP_441438.1_1 Forward -159 -140 22.2223 0.00837
NP_440061.1_9 Forward -181 -167 9.53707 0.143
NP_440110.1_4 Reverse -159 -178 7.27595 0.142
NP_440878.1_9 Forward -189 -170 5.30933 0.174
NP_442062.1_8 Forward -179 -169 17.3846 0.00193
NP_442062.1_8 Reverse -170 -180 17.3846 0.00193
NP_441859.1_3 Reverse -83 -102 3.14526 0.249
NP_440304.1_4 Forward -181 -171 1.84832 0.299
NP_440304.1_4 Reverse -168 -178 1.84832 0.299
NP_442242.1_4 Forward -178 -171 14.3954 0.0124
NP_442242.1_4 Reverse -171 -178 14.3954 0.0124
NP_440044.1_8 Forward -178 -159 -0.688862 0.225
NP_440044.1_8 Reverse -171 -190 -2.45882 0.264
NP_441781.1_7 Reverse -170 -189 4.22769 0.187
NP_441035.1_9 Reverse -204 -223 15.2408 0.19
NP_440916.1_1 Forward -203 -189 7.66941 0.3
NP_442602.1_3 Forward -131 -112 -0.39387 0.22
NP_441619.1_8 Reverse -164 -178 15.3386 0.0847
NP_441208.1_9 Reverse -72 -86 10.0294 0.196
NP_442110.1_7 Reverse -170 -184 9.93102 0.0684
NP_440856.1_4 Reverse -68 -87 -0.295539 0.177
NP_441083.1_5 Forward -179 -169 20.3345 0.00053
NP_441083.1_5 Reverse -170 -180 20.3345 0.00053
NP_441083.1_5 Forward -84 -74 6.17489 0.0894
NP_441083.1_5 Reverse -75 -85 0.471689 0.226
NP_442827.1_8 Forward -92 -73 2.06362 0.167
NP_441571.1_8 Forward -94 -75 -3.14714 0.275
NP_441738.1_2 Forward -177 -170 15.28 0.0102
NP_441738.1_2 Reverse -172 -179 15.28 0.0102
NP_440209.1_1 Reverse -170 -178 18.1123 0.00295
NP_440209.1_1 Forward -179 -171 18.1123 0.00295
NP_440870.1_3 Reverse -276 -295 3.34271 0.208
NP_442889.1_8 Forward -182 -168 12.5853 0.0611
NP_442889.1_8 Reverse -167 -181 11.4053 0.0733
NP_440178.1_7 Reverse -169 -188 -23.2067 0.298
NP_441327.1_1 Reverse -270 -289 3.06006 0.279
NP_442111.1_4 Reverse -169 -183 3.14618 0.253
NP_442111.1_4 Forward -180 -166 1.76955 0.294
NP_441163.1_1 Reverse -169 -186 3.87303 0.299
NP_440906.1_5 Forward -178 -171 15.8704 0.0124
NP_440906.1_5 Reverse -171 -178 15.8704 0.0124
NP_440906.1_5 Reverse -236 -243 5.64398 0.292
NP_440747.1_10 Forward -182 -170 14.9853 0.00221
NP_440747.1_10 Reverse -167 -179 14.887 0.00223
NP_440747.1_10 Reverse -72 -84 -2.51763 0.0509
NP_441486.1_1 Forward -182 -168 23.894 0.00162
NP_441486.1_1 Reverse -167 -181 15.1426 0.0061
NP_441194.1_1 Forward -299 -280 13.8937 0.238
NP_442145.1_4 Reverse -139 -158 13.8937 0.11
NP_442634.1_4 Reverse -73 -87 -5.80194 0.279
NP_440842.1_4 Forward -223 -204 2.19523 0.23
NP_441014.1_10 Forward -180 -161 -1.18128 0.257
NP_442848.1_1 Reverse -164 -178 -0.885388 0.263
NP_442848.1_1 Forward -185 -171 -1.96703 0.263
NP_443018.1_3 Forward -178 -171 14.8871 0.0123
NP_443018.1_3 Reverse -171 -178 14.8871 0.0123
NP_441634.1_8 Reverse -168 -182 -4.52363 0.295
NP_440376.1_1 Forward -179 -170 19.4693 0.000692
NP_440376.1_1 Reverse -170 -179 19.4693 0.000692
NP_440376.1_1 Forward -84 -75 5.99792 0.111
NP_440376.1_1 Reverse -75 -84 -0.000272808 0.285
NP_441588.1_4 Reverse -172 -182 18.1713 0.0143
NP_441588.1_4 Forward -177 -167 15.9097 0.0369
NP_442687.1_7 Forward -180 -170 8.92815 0.0994
NP_442687.1_7 Reverse -169 -179 8.92815 0.0994
NP_442687.1_7 Forward -85 -75 3.81494 0.286
NP_441077.1_6 Reverse -200 -216 5.59767 0.247
NP_442958.1_3 Reverse -159 -178 0.0977854 0.267
NP_440642.1_10 Forward -66 -52 10.1271 0.175
NP_442296.1_9 Reverse -171 -190 3.14605 0.17
NP_442658.1_1 Reverse -168 -178 6.76441 0.214
NP_442658.1_1 Forward -181 -171 6.76441 0.214
NP_440141.1_9 Forward -205 -186 -3.3438 0.29
NP_441553.1_9 Forward -162 -143 11.7992 0.214
NP_442782.1_7 Forward -187 -168 1.96607 0.193
NP_441414.1_9 Forward -179 -160 17.404 0.00979
NP_441414.1_9 Reverse -75 -94 1.67108 0.0726
NP_441414.1_9 Reverse -170 -189 -1.47551 0.101
NP_440720.1_1 Forward -190 -171 1.0811 0.279
NP_442937.1_5 Reverse -165 -184 7.37428 0.254
NP_442937.1_5 Forward -184 -165 7.17762 0.26
NP_441958.1_5 Forward -180 -170 12.2714 0.00183
NP_441958.1_5 Reverse -169 -179 12.2714 0.00183
NP_441958.1_5 Reverse -74 -84 1.55333 0.095
NP_441958.1_5 Forward -85 -75 0.275027 0.162
NP_440984.1_7 Reverse -165 -179 11.0127 0.122
NP_440984.1_7 Forward -184 -170 9.04604 0.131
NP_439990.1_5 Forward -184 -171 9.95071 0.128
NP_439990.1_5 Reverse -165 -178 7.6891 0.186
NP_442690.1_1 Reverse -337 -356 -13.3736 0.26
NP_442911.1_2 Reverse -160 -179 4.81767 0.0367
NP_442911.1_2 Forward -94 -75 4.52268 0.0378
NP_442911.1_2 Forward -189 -170 -5.31042 0.155
NP_440153.1_5 Forward -83 -69 7.66941 0.154
NP_442064.1_1 Reverse -165 -184 -12.0953 0.268
NP_442064.1_4 Forward -196 -177 6.58682 0.249
NP_440993.1_2 Reverse -70 -86 2.22182 0.269
NP_440993.1_3 Forward -318 -299 0.490334 0.252
NP_440993.1_3 Forward -189 -170 -0.197979 0.261
NP_442002.1_9 Forward -85 -78 10.7572 0.185
NP_441654.1_5 Forward -229 -210 18.1825 0.153
NP_441654.1_7 Forward -171 -152 12.7268 0.265
NP_441294.1_7 Forward -183 -169 17.8896 0.00674
NP_441646.1_1 Reverse -163 -182 0.0977854 0.254
NP_442438.1_10 Forward -184 -170 6.48943 0.114
NP_441000.1_5 Forward -177 -158 5.40686 0.254
NP_440147.1_4 Forward -181 -168 11.4257 0.0326
NP_440147.1_4 Reverse -168 -181 11.4257 0.0326
NP_440147.1_4 Forward -86 -73 5.62415 0.119
NP_441125.1_6 Forward -362 -349 11.1307 0.25
NP_441175.1_7 Forward -179 -160 5.40766 0.279
NP_441550.1_8 Reverse -168 -178 14.6309 0.0132
NP_441550.1_8 Forward -181 -171 14.6309 0.0132
NP_441550.1_8 Reverse -73 -83 12.2709 0.0349
NP_441916.1_7 Forward -179 -169 10.3048 0.0261
NP_441916.1_7 Reverse -170 -180 10.3048 0.0261
NP_441041.1_4 Reverse -170 -189 -11.9969 0.256
NP_441041.1_7 Forward -182 -170 11.8878 0.0689
NP_441041.1_7 Forward -124 -112 8.87526 0.128
NP_442396.1_5 Reverse -166 -179 21.1604 0.00421
NP_441725.1_4 Forward -282 -268 5.60385 0.278
NP_441725.1_5 Forward -178 -168 2.04498 0.115
NP_441725.1_5 Reverse -171 -181 2.04498 0.115
NP_439966.1_4 Forward -98 -79 6.4893 0.253
NP_439966.1_7 Reverse -168 -178 7.25606 0.15
NP_439966.1_7 Forward -181 -171 7.25606 0.15
NP_439966.1_9 Forward -86 -77 0.983037 0.253
NP_442941.1_3 Forward -178 -168 11.0914 0.0116
NP_442941.1_3 Reverse -171 -181 11.0914 0.0116
NP_442941.1_3 Forward -83 -73 6.96153 0.0903
NP_440289.1_2 Forward -182 -169 4.54251 0.066
NP_440289.1_2 Reverse -167 -180 -4.9956 0.294
NP_442281.1_1 Forward -184 -170 17.5018 0.00555
NP_442281.1_1 Reverse -165 -179 8.94708 0.0747
NP_440177.1_9 Reverse -162 -181 12.1925 0.238
NP_442256.1_2 Forward -181 -163 -9.51896 0.274
NP_442982.1_5 Forward -189 -170 -0.885524 0.262
NP_443030.1_1 Forward -299 -282 7.217 0.277
NP_441644.1_6 Forward -179 -169 17.3841 0.00127
NP_441644.1_6 Reverse -170 -180 17.3841 0.00127
NP_441644.1_6 Forward -84 -74 6.17443 0.165
NP_442215.1_2 Reverse -168 -184 26.5096 0.000599
NP_442215.1_2 Forward -181 -165 4.48343 0.0838
NP_440929.1_8 Forward -179 -170 19.2726 0.000701
NP_440929.1_8 Reverse -170 -179 19.2726 0.000701
NP_440929.1_8 Reverse -75 -84 6.68623 0.0887
NP_440929.1_8 Forward -373 -364 0.786375 0.299
NP_440780.1_1 Forward -220 -201 9.59652 0.274
NP_440780.1_1 Reverse -82 -101 7.78217 0.274
NP_442933.1_10 Forward -179 -170 17.601 0.00325
NP_442933.1_10 Reverse -170 -179 17.601 0.00325
NP_442933.1_10 Reverse -75 -84 4.42462 0.246
NP_441751.2_8 Forward -178 -164 -3.147 0.134
NP_441751.2_8 Forward -83 -69 -3.54032 0.15
NP_442554.1_8 Forward -178 -168 15.3197 0.00882
NP_442554.1_8 Reverse -171 -181 15.3197 0.00882
NP_442554.1_8 Forward -83 -73 5.19158 0.157
NP_441762.1_7 Forward -180 -168 0.432302 0.0747
NP_441762.1_7 Reverse -169 -181 0.432302 0.0747
NP_441762.1_7 Reverse -74 -86 -7.13918 0.285
NP_442313.1_5 Reverse -255 -274 7.66927 0.213
NP_442142.1_4 Forward -182 -169 10.9334 0.0646
NP_442142.1_4 Reverse -167 -180 2.96866 0.269
NP_442292.1_1 Forward -178 -169 18.486 0.00229
NP_442292.1_1 Reverse -171 -180 18.486 0.00229
NP_442292.1_2 Reverse -284 -298 17.1007 0.248
NP_440775.1_4 Forward -291 -272 9.30814 0.268
NP_442476.1_6 Forward -178 -164 8.16106 0.105
NP_443009.1_5 Reverse -169 -180 8.90795 0.0965
NP_443009.1_5 Forward -180 -169 8.90795 0.0965
NP_443009.1_5 Reverse -74 -85 6.35136 0.165
NP_441715.1_4 Reverse -171 -181 7.94484 0.107
NP_441715.1_4 Forward -178 -168 7.94484 0.107
NP_441715.1_4 Forward -83 -73 7.05986 0.118
NP_440279.1_2 Reverse -159 -178 7.07928 0.24
NP_440158.1_1 Reverse -142 -161 12.1748 0.195
NP_440464.1_10 Forward -178 -168 13.0082 0.169
NP_440464.1_10 Reverse -171 -181 13.0082 0.169
NP_441468.1_1 Forward -178 -171 15.8704 0.0124
NP_441468.1_1 Reverse -171 -178 15.8704 0.0124
NP_441020.2_6 Forward -181 -164 5.64371 0.293
NP_441673.1_1 Forward -179 -170 20.8459 0.000698
NP_441673.1_1 Reverse -170 -179 20.8459 0.000698
NP_441673.1_1 Forward -84 -75 1.37636 0.114
NP_441673.1_1 Reverse -75 -84 1.1797 0.163
NP_441826.1_2 Forward -185 -171 7.07942 0.0899
NP_442811.1_2 Forward -98 -79 -1.37718 0.257
NP_442490.1_9 Forward -96 -77 -5.01543 0.273
NP_441764.1_1 Forward -157 -138 16.3224 0.086
NP_441764.1_4 Forward -298 -281 12.0825 0.199
NP_441764.1_4 Forward -159 -142 9.98168 0.271
NP_441764.1_8 Forward -362 -352 15.7131 0.284
NP_442868.1_6 Forward -181 -171 9.81313 0.038
NP_442868.1_6 Reverse -168 -178 9.81313 0.038
NP_442719.1_2 Forward -253 -235 -10.8963 0.284
NP_441612.1_2 Reverse -170 -180 8.54929 0.21
NP_441612.1_2 Forward -179 -169 8.54929 0.21
NP_442361.1_3 Forward -185 -172 8.47575 0.285
NP_442427.1_8 Reverse -161 -180 6.29264 0.244
NP_442427.1_8 Forward -188 -169 5.80098 0.252
NP_442808.1_1 Reverse -169 -179 8.63269 0.0481
NP_442808.1_1 Forward -180 -170 8.63269 0.0481
NP_440145.1_3 Forward -189 -170 -1.7705 0.156
NP_442050.1_5 Forward -181 -171 7.64939 0.243
NP_442050.1_5 Reverse -168 -178 7.64939 0.243
NP_440923.1_1 Reverse -278 -296 13.0964 0.208
NP_441878.1_6 Forward -180 -170 10.4031 0.0176
NP_441878.1_6 Reverse -169 -179 10.4031 0.0176
NP_441036.1_8 Forward -180 -170 8.33817 0.174
NP_441036.1_8 Reverse -169 -179 8.33817 0.174
NP_441036.1_8 Forward -85 -75 6.76487 0.215
NP_441557.1_5 Forward -179 -170 19.9609 0.000699
NP_441557.1_5 Reverse -170 -179 19.9609 0.000699
NP_441557.1_5 Forward -84 -75 0.491382 0.144
NP_441557.1_5 Reverse -75 -84 0.29472 0.174
NP_442066.2_9 Reverse -166 -179 11.1307 0.154
NP_442066.2_9 Forward -88 -75 8.57408 0.185
NP_441458.1_10 Reverse -161 -180 6.39097 0.2
NP_442183.1_1 Forward -179 -165 11.5043 0.0702
NP_442397.1_9 Reverse -170 -189 6.78429 0.246
NP_441116.1_6 Reverse -60 -79 10.2259 0.26
NP_442347.1_1 Reverse -206 -223 18.4181 0.174
NP_442347.1_2 Forward -178 -169 12.4878 0.056
NP_442347.1_2 Reverse -171 -180 12.4878 0.056
NP_442347.1_2 Reverse -76 -85 11.2095 0.056
NP_442645.1_2 Reverse -162 -181 -3.44213 0.0487
NP_442645.1_2 Forward -187 -168 -22.3217 0.29
NP_441037.1_4 Forward -181 -171 7.9999 0.237
NP_441037.1_4 Reverse -168 -178 7.9999 0.237
NP_442594.1_7 Reverse -159 -178 6.88182 0.196
NP_442317.1_6 Forward -249 -230 2.55606 0.275
NP_441633.1_3 Reverse -73 -86 1.29759 0.109
NP_441633.1_3 Forward -181 -168 1.19926 0.109
NP_441633.1_3 Reverse -168 -181 1.19926 0.109
NP_440136.1_2 Forward -178 -171 15.9687 0.0123
NP_440136.1_2 Reverse -171 -178 15.9687 0.0123
NP_440136.1_6 Forward -107 -89 19.1929 0.192
NP_442998.1_5 Forward -124 -114 10.1081 0.225
NP_442998.1_5 Forward -96 -86 8.73149 0.261
NP_442998.1_9 Reverse -380 -397 22.065 0.0514
NP_442998.1_10 Forward -177 -170 15.5754 0.0102
NP_442998.1_10 Reverse -172 -179 15.5754 0.0102
NP_442998.1_10 Reverse -77 -84 5.93897 0.206
NP_440299.1_1 Forward -183 -170 14.08 0.0259
NP_440299.1_1 Reverse -166 -179 12.9984 0.0319
NP_441799.1_1 Reverse -166 -180 15.8302 0.0163
NP_441799.1_1 Forward -183 -169 6.98048 0.155
NP_441799.1_1 Reverse -71 -85 4.8172 0.236
NP_441007.1_10 Reverse -165 -178 8.27909 0.115
NP_441007.1_10 Forward -184 -171 0.60927 0.221
NP_442201.1_10 Reverse -159 -178 -13.9635 0.28
NP_440256.1_1 Reverse -167 -186 -9.63698 0.284
NP_440709.1_1 Reverse -138 -157 7.4718 0.118
NP_441559.1_8 Reverse -70 -84 -2.95034 0.196
NP_441270.1_5 Reverse -356 -375 11.3352 0.294
NP_440915.1_6 Forward -88 -74 4.81781 0.0953
NP_440915.1_6 Forward -183 -169 4.42448 0.0953
NP_440717.1_1 Reverse -171 -190 11.5042 0.199
NP_442866.1_1 Forward -89 -70 -5.60541 0.243
NP_442386.1_9 Reverse -169 -178 13.8639 0.0289
NP_442386.1_9 Forward -180 -171 13.8639 0.0289
NP_441340.1_5 Forward -178 -171 15.6737 0.0124
NP_441340.1_5 Reverse -171 -178 15.6737 0.0124
NP_441340.1_9 Forward -362 -352 14.6181 0.194
NP_442484.1_2 Forward -190 -171 6.4893 0.156
NP_440168.1_9 Reverse -73 -92 -4.22878 0.296
NP_440586.1_8 Forward -178 -171 13.2151 0.026
NP_440586.1_8 Reverse -171 -178 13.2151 0.026
NP_442251.1_6 Forward -178 -171 15.2804 0.0124
NP_442251.1_6 Reverse -171 -178 15.2804 0.0124
NP_442251.1_6 Forward -92 -85 6.43063 0.298
NP_440684.1_9 Reverse -164 -178 12.6843 0.168
NP_441262.1_3 Reverse -170 -177 14.7888 0.0223
NP_441262.1_3 Forward -179 -172 14.7888 0.0223
NP_443051.1_1 Reverse -169 -178 10.4228 0.00754
NP_443051.1_1 Forward -180 -171 10.4228 0.00754
NP_443051.1_1 Reverse -74 -83 -0.0986038 0.256
NP_440451.1_10 Reverse -171 -190 9.43841 0.264
NP_439984.1_1 Forward -232 -213 9.42666 0.292
NP_439984.1_3 Reverse -163 -177 15.2402 0.158
NP_439937.1_9 Reverse -267 -284 -13.0398 0.279
NP_441167.1_1 Forward -299 -280 4.62101 0.256
NP_440439.1_1 Reverse -72 -85 7.59077 0.0631
NP_440372.1_2 Forward -178 -171 16.3621 0.0124
NP_440372.1_2 Reverse -171 -178 16.3621 0.0124
NP_440372.1_2 Forward -83 -76 4.07068 0.262
NP_441803.1_2 Reverse -165 -184 10.5209 0.0857
NP_440267.1_2 Reverse -70 -84 9.34041 0.156
NP_442384.1_10 Forward -179 -166 15.8506 0.00946
NP_442384.1_10 Reverse -170 -183 10.049 0.047
NP_442384.1_10 Forward -84 -71 4.93583 0.142
NP_442384.1_10 Reverse -75 -88 3.85419 0.176
NP_441877.1_5 Reverse -311 -330 -1.18052 0.283
NP_441877.1_9 Forward -159 -142 4.56207 0.284
NP_441018.1_7 Reverse -166 -185 7.66927 0.268
NP_442790.1_4 Forward -93 -74 -5.01543 0.136
NP_442262.1_10 Forward -178 -171 14.1988 0.0123
NP_442262.1_10 Reverse -171 -178 14.1988 0.0123
NP_441689.1_5 Forward -181 -171 5.78111 0.197
NP_441689.1_5 Reverse -168 -178 5.78111 0.197
NP_440344.1_10 Forward -186 -169 2.69378 0.0282
NP_440531.1_6 Forward -187 -168 -5.11376 0.293
NP_441060.1_3 Forward -137 -118 8.45592 0.24
NP_442910.1_1 Forward -186 -167 0.392778 0.168
NP_441965.1_10 Forward -182 -166 2.71347 0.284
NP_442529.1_4 Forward -93 -74 11.0125 0.208
NP_440297.1_9 Forward -178 -168 -0.118297 0.282
NP_440297.1_9 Reverse -171 -181 -0.118297 0.282
NP_441592.1_4 Reverse -170 -189 -3.3438 0.28
NP_442078.1_3 Forward -132 -113 6.98015 0.186
NP_440999.1_9 Forward -183 -169 4.22782 0.116
NP_440888.1_2 Reverse -170 -184 12.9786 0.0354
NP_440888.1_2 Reverse -75 -89 10.717 0.0861
NP_440888.1_2 Forward -179 -165 7.07881 0.208
NP_440600.1_4 Reverse -162 -180 -0.7675 0.155
NP_441543.1_2 Forward -178 -169 16.9127 0.00359
NP_441543.1_2 Reverse -171 -180 16.9127 0.00359
NP_442845.1_2 Forward -185 -171 12.291 0.114
NP_442845.1_2 Reverse -164 -178 5.99778 0.219
NP_441469.1_8 Forward -180 -171 6.48957 0.227
NP_441469.1_8 Reverse -169 -178 6.48957 0.227
NP_443064.1_6 Forward -84 -74 13.5365 0.0796
NP_443064.1_6 Forward -179 -169 12.5669 0.0796
NP_443064.1_6 Reverse -170 -180 12.5669 0.0796
NP_442578.1_7 Forward -178 -171 14.5921 0.026
NP_442578.1_7 Reverse -171 -178 14.5921 0.026
NP_442286.1_4 Forward -236 -217 16.2241 0.259
NP_441462.1_2 Forward -179 -169 11.5831 0.00406
NP_441462.1_2 Reverse -170 -180 11.5831 0.00406
NP_441462.1_2 Forward -84 -74 8.73149 0.0313
NP_441621.1_7 Forward -95 -81 -3.24533 0.188
NP_441621.1_7 Forward -86 -72 -5.40861 0.252
NP_443062.1_1 Reverse -75 -93 5.23067 0.235
NP_443062.1_1 Reverse -170 -188 4.06059 0.276
NP_442204.1_1 Reverse -71 -82 0.0586712 0.284
NP_442204.1_5 Forward -189 -170 7.27595 0.132
NP_440516.1_8 Forward -179 -170 16.9127 0.00442
NP_440516.1_8 Reverse -170 -179 16.9127 0.00442
NP_440516.1_8 Forward -84 -75 7.17789 0.0754
NP_440516.1_8 Reverse -75 -84 5.01461 0.118
NP_442428.1_5 Forward -178 -171 15.8704 0.0124
NP_442428.1_5 Reverse -171 -178 15.8704 0.0124
NP_442859.1_8 Forward -123 -104 17.8948 0.0983
NP_442120.1_10 Reverse -293 -312 -7.76869 0.222
NP_440673.1_2 Reverse -160 -179 11.3651 0.178
NP_440673.1_3 Forward -177 -170 12.4288 0.0426
NP_440673.1_3 Reverse -172 -179 12.4288 0.0426
NP_440673.1_3 Reverse -77 -84 10.1672 0.149
NP_440718.1_5 Reverse -256 -275 13.3725 0.0338
NP_441052.1_2 Forward -179 -169 19.9412 0.00106
NP_441052.1_2 Reverse -170 -180 19.9412 0.00106
NP_442219.1_9 Forward -178 -169 17.7976 0.00718
NP_442219.1_9 Reverse -171 -180 17.7976 0.00718
NP_440436.1_4 Forward -178 -169 17.2072 0.00233
NP_440436.1_4 Reverse -171 -180 17.2072 0.00233
NP_441884.1_8 Forward -85 -66 -10.3253 0.268
NP_441884.1_9 Forward -182 -163 -25.5666 0.29
NP_440314.1_9 Forward -178 -159 -0.4922 0.11
NP_440314.1_9 Reverse -171 -190 -9.24366 0.262
NP_441719.1_4 Forward -178 -171 16.3621 0.0124
NP_441719.1_4 Reverse -171 -178 16.3621 0.0124
NP_442366.1_3 Reverse -169 -187 4.34571 0.0984
NP_442366.1_3 Forward -187 -169 -0.865831 0.201
NP_442366.1_5 Reverse -167 -177 15.4175 0.0374
NP_442366.1_5 Forward -182 -172 14.8275 0.0375
NP_442694.1_9 Forward -286 -267 10.2259 0.24
NP_442206.1_10 Forward -179 -164 3.32315 0.186
NP_443054.1_2 Reverse -168 -182 1.76955 0.245
NP_443054.1_2 Reverse -73 -87 -0.197071 0.288
NP_441851.1_10 Forward -180 -170 15.8113 0.00552
NP_441851.1_10 Reverse -169 -179 15.8113 0.00552
NP_442856.1_7 Forward -188 -169 2.75272 0.159
NP_441668.1_4 Reverse -160 -179 17.3057 0.0435
NP_442515.1_1 Forward -180 -166 13.3726 0.0278
NP_442515.1_1 Reverse -169 -183 -4.91696 0.298
NP_440593.1_3 Forward -184 -165 5.70265 0.122
NP_441349.1_10 Forward -189 -170 6.58763 0.035
NP_441349.1_10 Reverse -160 -179 1.17943 0.0845
NP_440432.1_9 Forward -178 -163 -3.26502 0.179
NP_442843.1_1 Forward -101 -82 -4.03212 0.232
NP_441124.1_5 Reverse -158 -168 11.0028 0.268
NP_440431.1_3 Forward -290 -271 -10.9153 0.28
NP_442450.1_5 Reverse -168 -178 7.55152 0.13
NP_442450.1_5 Forward -181 -171 7.55152 0.13
NP_440588.1_2 Forward -188 -169 5.99764 0.06
NP_441031.1_1 Reverse -136 -155 12.3179 0.161
NP_442243.1_1 Forward -185 -167 6.70489 0.178
NP_441570.1_1 Reverse -170 -188 -9.12563 0.129
NP_441570.1_1 Forward -84 -66 -17.1888 0.267
NP_441078.1_4 Forward -179 -170 19.6659 0.0007
NP_441078.1_4 Reverse -170 -179 19.6659 0.0007
NP_441078.1_4 Forward -84 -75 0.393051 0.205
NP_441078.1_4 Reverse -75 -84 -0.000272808 0.205
NP_442729.1_8 Reverse -166 -179 10.639 0.125
NP_442729.1_8 Forward -88 -75 9.16406 0.125
NP_440526.1_3 Reverse -171 -182 10.2846 0.0646
NP_440526.1_3 Forward -178 -167 1.04151 0.267
NP_441432.1_8 Reverse -169 -178 16.8143 0.00595
NP_441432.1_8 Forward -180 -171 16.8143 0.00595
NP_442320.1_8 Forward -185 -171 13.7659 0.0144
NP_442320.1_8 Reverse -164 -178 -4.81863 0.188
NP_441732.1_2 Forward -183 -167 -6.7263 0.0495
NP_441732.1_2 Reverse -166 -182 -16.7561 0.195
NP_440760.1_1 Forward -179 -160 3.04771 0.0202
NP_440760.1_1 Reverse -170 -189 -5.40875 0.05
NP_440760.1_1 Reverse -75 -94 -22.42 0.257
NP_440199.1_10 Forward -182 -172 7.25653 0.231
NP_442353.1_4 Forward -185 -166 12.7816 0.0776
NP_442489.1_7 Forward -179 -170 20.1576 0.000695
NP_442489.1_7 Reverse -170 -179 20.1576 0.000695
NP_442489.1_7 Forward -84 -75 0.688044 0.152
NP_442489.1_7 Reverse -75 -84 0.688044 0.152
NP_440559.1_1 Forward -178 -169 17.4043 0.00658
NP_440559.1_1 Reverse -171 -180 17.4043 0.00658
NP_441659.2_8 Forward -179 -169 18.1713 0.00133
NP_441659.2_8 Reverse -170 -180 18.1713 0.00133
NP_441659.2_8 Forward -84 -74 1.65166 0.233
NP_442913.1_10 Forward -188 -169 18.9773 0.0136
NP_442913.1_10 Reverse -161 -180 -2.55715 0.187
NP_442346.1_5 Forward -180 -170 16.6963 0.00248
NP_442346.1_5 Reverse -169 -179 16.6963 0.00248
NP_440352.1_5 Reverse -50 -69 10.9037 0.27
NP_440025.1_3 Forward -337 -323 10.7076 0.29
NP_440459.1_2 Forward -188 -171 12.9202 0.133
NP_440459.1_2 Reverse -168 -185 12.7235 0.137
NP_442603.1_7 Forward -179 -165 7.17714 0.211
NP_440449.1_6 Forward -187 -169 4.36531 0.297
NP_441833.1_4 Forward -178 -171 15.9687 0.0124
NP_441833.1_4 Reverse -171 -178 15.9687 0.0124
NP_441329.1_6 Forward -359 -340 11.2199 0.106
NP_442162.1_9 Forward -178 -171 16.2637 0.0124
NP_442162.1_9 Reverse -171 -178 16.2637 0.0124
NP_440671.1_4 Forward -185 -171 6.88276 0.233
NP_440224.1_1 Forward -190 -171 3.14605 0.132
NP_441973.1_1 Forward -199 -184 1.2582 0.235
NP_442140.1_3 Forward -178 -168 12.2714 0.0632
NP_442140.1_3 Reverse -171 -181 12.2714 0.0632
NP_442140.1_3 Reverse -76 -86 5.5849 0.202
NP_441813.1_5 Reverse -168 -178 8.63316 0.0367
NP_441813.1_5 Forward -181 -171 8.63316 0.0367
NP_441813.1_5 Reverse -73 -83 5.19158 0.142
NP_440594.1_6 Forward -185 -166 6.58682 0.258
NP_440590.1_4 Reverse -171 -184 19.1938 0.00669
NP_440590.1_4 Forward -178 -165 0.805932 0.143
NP_440567.1_1 Reverse -171 -185 14.3559 0.0187
NP_440567.1_1 Forward -178 -164 2.35953 0.176
NP_440567.1_6 Forward -178 -159 4.32602 0.269
NP_442497.1_10 Forward -178 -169 10.4228 0.0087
NP_442497.1_10 Reverse -171 -180 10.4228 0.0087
NP_440821.1_4 Reverse -168 -178 9.41981 0.0286
NP_440821.1_4 Forward -181 -171 9.41981 0.0286
NP_440821.1_4 Forward -86 -76 -0.708283 0.287
NP_441239.1_9 Reverse -73 -85 4.66053 0.248
NP_441239.1_9 Forward -81 -69 3.87389 0.272
NP_441239.1_9 Forward -181 -169 3.38223 0.285
NP_441239.1_9 Reverse -168 -180 3.38223 0.285
NP_440624.1_5 Reverse -202 -220 10.5596 0.211
NP_442270.1_9 Forward -190 -171 -9.44032 0.234
NP_440876.1_5 Forward -177 -158 5.99764 0.283
NP_441617.1_6 Reverse -163 -182 -2.45882 0.258
NP_441617.1_6 Forward -253 -234 -6.49039 0.283
NP_440546.1_4 Forward -179 -169 10.046 0.109
NP_440546.1_4 Reverse -170 -180 10.046 0.109
NP_440462.1_6 Reverse -73 -83 6.37155 0.118
NP_440462.1_6 Reverse -168 -178 1.35667 0.294
NP_440462.1_6 Forward -181 -171 1.35667 0.294
NP_440868.1_4 Reverse -166 -178 8.10212 0.0602
NP_440868.1_4 Forward -88 -76 -0.354346 0.263
NP_440868.1_4 Forward -183 -171 -0.846001 0.282
NP_441497.1_1 Reverse -206 -220 18.9775 0.165
NP_442499.1_4 Reverse -53 -67 12.4876 0.226
NP_440374.1_3 Forward -229 -211 13.2754 0.272
NP_442479.1_9 Reverse -312 -331 -13.5702 0.288
NP_441848.1_4 Reverse -237 -253 9.17403 0.288
NP_442039.1_4 Forward -178 -171 15.1821 0.0124
NP_442039.1_4 Reverse -171 -178 15.1821 0.0124
NP_441811.1_1 Forward -272 -253 3.83436 0.299
NP_440825.1_7 Reverse -171 -181 12.9096 0.152
NP_440825.1_7 Forward -178 -168 12.9096 0.152
NP_442837.1_3 Forward -178 -171 15.7721 0.0124
NP_442837.1_3 Reverse -171 -178 15.7721 0.0124
NP_442053.1_1 Forward -179 -170 18.3876 0.0007
NP_442053.1_1 Reverse -170 -179 18.3876 0.0007
NP_442053.1_1 Reverse -75 -84 6.8829 0.111
NP_440505.1_3 Forward -181 -171 9.22315 0.122
NP_440505.1_3 Reverse -168 -178 9.22315 0.122
NP_441252.1_6 Forward -336 -329 11.6422 0.288
NP_441203.1_1 Reverse -171 -190 -9.047 0.137
NP_442532.1_7 Reverse -75 -89 3.44117 0.197
NP_440914.1_1 Forward -179 -169 17.5935 0.000537
NP_440914.1_1 Reverse -170 -180 17.5935 0.000537
NP_440914.1_1 Forward -84 -74 10.2742 0.147
NP_441011.1_8 Forward -178 -169 8.25953 0.144
NP_441011.1_8 Reverse -171 -180 8.25953 0.144
NP_442533.1_6 Forward -179 -170 17.2076 0.00137
NP_442533.1_6 Reverse -170 -179 17.2076 0.00137
NP_442533.1_6 Forward -84 -75 4.91628 0.165
NP_442533.1_6 Reverse -75 -84 4.42462 0.179
NP_442229.1_1 Reverse -168 -182 8.55376 0.184
NP_441482.1_7 Reverse -69 -83 2.85119 0.0554
NP_441482.1_7 Reverse -164 -178 -3.147 0.11
NP_439944.1_9 Forward -178 -168 10.5014 0.0887
NP_439944.1_9 Reverse -171 -181 10.5014 0.0887
NP_441697.1_5 Reverse -201 -220 -7.01908 0.239
NP_441028.1_6 Forward -67 -57 3.51951 0.292
NP_440116.1_8 Reverse -171 -190 1.67108 0.0915
NP_441527.1_4 Forward -359 -340 3.96249 0.111
NP_440007.1_9 Forward -183 -169 1.08123 0.29
NP_441972.1_5 Reverse -171 -190 13.6675 0.0347
NP_441106.1_1 Forward -180 -171 9.63616 0.0311
NP_441106.1_1 Reverse -169 -178 9.63616 0.0311
NP_442306.1_10 Reverse -70 -89 -12.1936 0.166
NP_441286.1_1 Forward -180 -168 12.9203 0.00815
NP_441286.1_1 Reverse -169 -181 12.9203 0.00815
NP_440670.1_8 Forward -179 -170 18.3876 0.000699
NP_440670.1_8 Reverse -170 -179 18.3876 0.000699
NP_440670.1_8 Forward -84 -75 8.55452 0.066
NP_440670.1_8 Reverse -75 -84 5.99792 0.13
NP_440886.1_7 Reverse -83 -93 8.14104 0.0805
NP_440886.1_7 Forward -180 -170 7.94438 0.0805
NP_440886.1_7 Reverse -169 -179 7.94438 0.0805
NP_440886.1_7 Forward -85 -75 7.55106 0.0892
NP_442717.1_2 Reverse -154 -173 -0.4922 0.211
NP_442072.1_9 Reverse -169 -187 -21.5153 0.209
NP_442072.1_9 Reverse -74 -92 -22.4986 0.241
NP_439899.1_1 Forward -160 -142 4.57667 0.263
NP_440907.2_8 Forward -178 -168 7.64939 0.117
NP_440907.2_8 Reverse -171 -181 7.64939 0.117
NP_440907.2_8 Reverse -76 -86 6.0761 0.179
NP_441021.1_1 Reverse -171 -190 -6.1954 0.177
NP_441021.1_1 Forward -178 -159 -11.4069 0.262
NP_442056.1_3 Forward -194 -175 10.7175 0.274
NP_441626.1_2 Forward -178 -171 15.7721 0.0124
NP_441626.1_2 Reverse -171 -178 15.7721 0.0124
NP_442794.1_1 Forward -183 -171 12.4287 0.0721
NP_442794.1_1 Reverse -166 -178 9.28209 0.0795
NP_442615.1_1 Reverse -161 -179 4.34571 0.0472
NP_442615.1_1 Forward -188 -170 3.75572 0.0518
NP_441962.1_4 Forward -184 -165 0.196116 0.117
NP_440387.1_1 Forward -179 -163 20.1181 0.00313
NP_440387.1_1 Reverse -75 -91 4.87675 0.0377
NP_440387.1_1 Reverse -170 -186 -1.71142 0.143
NP_441488.1_8 Forward -184 -170 11.897 0.146
NP_442805.1_1 Reverse -281 -298 11.9369 0.124
NP_441858.1_9 Reverse -104 -123 17.8957 0.144
NP_441237.1_9 Forward -178 -168 14.828 0.0242
NP_441237.1_9 Reverse -171 -181 14.828 0.0242
NP_442509.1_9 Reverse -75 -85 13.3526 0.0571
NP_442509.1_9 Forward -179 -169 8.14104 0.192
NP_442509.1_9 Reverse -170 -180 8.14104 0.192
NP_442862.1_3 Reverse -114 -131 5.34871 0.277
NP_441845.1_6 Forward -96 -78 10.3439 0.116
NP_441885.1_5 Forward -179 -169 20.9245 0.000538
NP_441885.1_5 Reverse -170 -180 20.9245 0.000538
NP_441885.1_5 Forward -84 -74 -0.314959 0.195
NP_442341.1_7 Reverse -169 -183 18.0925 0.0111
NP_442341.1_7 Forward -180 -166 13.6676 0.0334
NP_442341.1_9 Reverse -168 -182 8.84875 0.164
NP_443000.1_7 Forward -181 -171 10.3048 0.0345
NP_443000.1_7 Reverse -168 -178 10.3048 0.0345
NP_443000.1_7 Reverse -73 -83 7.64985 0.0734
NP_441842.1_10 Forward -186 -172 12.586 0.0982
NP_440275.1_3 Forward -181 -171 8.04317 0.0602
NP_440275.1_3 Reverse -168 -178 8.04317 0.0602
NP_440275.1_3 Forward -86 -76 5.68323 0.136
NP_440091.1_1 Forward -183 -171 1.31728 0.198
NP_443060.1_5 Forward -187 -168 19.4681 0.0357
NP_442354.1_7 Forward -182 -163 7.47261 0.216
NP_441122.1_1 Forward -190 -175 5.78142 0.28
NP_441207.1_7 Forward -359 -345 14.5801 0.179
NP_440149.1_8 Forward -179 -160 -3.14714 0.183
NP_441105.1_3 Forward -190 -171 -5.9004 0.225
NP_440216.1_1 Reverse -170 -184 0.196253 0.0284
NP_440216.1_1 Forward -84 -70 -3.04867 0.0682
NP_440216.1_1 Forward -179 -165 -10.6202 0.145
NP_440216.1_9 Reverse -57 -66 5.99792 0.289
NP_440172.1_1 Forward -179 -169 15.0247 0.00945
NP_440172.1_1 Reverse -170 -180 15.0247 0.00945
NP_440172.1_1 Forward -84 -74 4.99491 0.157
NP_442015.1_10 Forward -183 -170 11.3273 0.0372
NP_442015.1_10 Reverse -166 -179 1.39592 0.204
NP_441226.1_7 Forward -178 -171 14.4934 0.0123
NP_441226.1_7 Reverse -171 -178 14.4934 0.0123
NP_441111.1_7 Forward -178 -170 18.7023 0.00294
NP_441111.1_7 Reverse -171 -179 18.7023 0.00294
NP_441766.1_2 Forward -179 -170 17.5026 0.00297
NP_441766.1_2 Reverse -170 -179 17.5026 0.00297
NP_441766.1_2 Reverse -75 -84 4.12963 0.194
NP_440261.1_5 Forward -178 -165 -10.3055 0.201
NP_440261.1_5 Reverse -171 -184 -10.4038 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAATTCACCTGTTCAGAACCAGAATACTCCGCACTCCGAAAGAAAAATTCAAAGAGAACTAATTTGGTGCAAAGCATAGCATAATCTCCCGACTAAATTGCCACTGTAACGAAATGTTACTGAGGAAATCCAGCTCGACCCATTTCGACGTTTTGCAGCTATCATTCCTTGACAATTAGTCAATAATTCTTGACATTTTAATTGTCCCTAGACTGTCCATTGGCGATCGCCAAAATTTAACCATGTAAATATTTGTAAACGTACTAAGCCTAAGCTAGGGAAGATTCCTATAATGCCTGATAATTGGCAAGATTGCGGCGATCAGCTGGCTTGATTTCCCCTGGGTACTTAATCAAGGTATAGCTGATATGACCTGGACAACTTATTAATATATCTGAAC

CDS

ATGAGAGCTGATTTTTTTCTGTCTGATAACAGAGCAGCATTGCTAAAAAGGGGGCTGACCATTATCCTTTCCTTTTTGGTGTTTACTAGCATTTTCTTGCTGCCATCTCCCAGTTTGGCAGAGGATGTTAAGGGGGCGGACGATCCCATTGTCGTAGCGGGCAACATTAAGGTAAAACCCGATAAAAAAGAAGAATTTATTGCCCTATCCCAGACATTTATTGAGCCTTCTCGGTCGGAACCTGGCTGTATTTCCTACAGTTTTTATGAGGATGAAACGGAAGATAATTCTTTTCTTTTTTTTGAAGTTTGGCGGAATCGAGCGGCCCTCGACTATCATTTTCAAACCCCTTACTTCCATGAATTTGTGGAAAAATCTCCTGATTTATTAGCTAAGCCAGCCGAAATTAAGATTTATAAAATAGCCGAAACGCAGACATTGTAA

Protein

MRADFFLSDNRAALLKRGLTIILSFLVFTSIFLLPSPSLAEDVKGADDPIVVAGNIKVKPDKKEEFIALSQTFIEPSRSEPGCISYSFYEDETEDNSFLFFEVWRNRAALDYHFQTPYFHEFVEKSPDLLAKPAEIKIYKIAETQTL