Your browser is old and dusty. Try Google Chrome!

Details for sll1768

ORF sll1768
Accession NP_440996.1
Symbol
Category probable oligopeptides ABC transporter permease protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -205 -191 15.4376 0.104
NP_442711.1_1 Reverse -153 -167 11.701 0.236
NP_442711.1_1 Reverse -347 -361 11.2093 0.253
NP_441061.1_2 Reverse -197 -211 3.34284 0.165
NP_441061.1_2 Forward -204 -190 2.45787 0.176
NP_441061.1_2 Reverse -191 -205 0.196253 0.215
NP_440557.1_1 Forward -204 -185 9.63589 0.125
NP_440557.1_1 Reverse -128 -147 -1.86883 0.278
NP_440795.1_7 Forward -204 -197 14.6904 0.0123
NP_440795.1_7 Reverse -197 -204 14.6904 0.0123
NP_441418.1_6 Forward -205 -186 -10.7186 0.0382
NP_441418.1_6 Reverse -196 -215 -27.9265 0.203
NP_441418.1_6 Forward -217 -198 -28.4182 0.205
NP_441418.1_6 Reverse -121 -140 -29.4998 0.228
NP_440815.1_5 Reverse -196 -215 3.34271 0.286
NP_442272.1_4 Reverse -94 -112 17.3286 0.247
NP_441453.1_1 Reverse -189 -207 11.7197 0.109
NP_441453.1_4 Reverse -196 -204 16.539 0.00633
NP_441453.1_4 Forward -205 -197 16.539 0.00633
NP_441453.1_7 Reverse -322 -329 14.1988 0.175
NP_441453.1_7 Forward -319 -312 11.9372 0.298
NP_441623.1_1 Reverse -353 -371 -3.52077 0.262
NP_442151.1_6 Reverse -196 -210 17.5025 0.00997
NP_442151.1_6 Reverse -76 -90 7.57108 0.194
NP_442151.1_6 Forward -205 -191 7.17775 0.206
NP_441818.1_9 Reverse -329 -348 -5.60541 0.254
NP_440226.1_1 Forward -205 -186 9.3409 0.0734
NP_440226.1_1 Reverse -196 -215 7.07928 0.114
NP_440226.1_1 Reverse -98 -117 5.40766 0.157
NP_440226.1_1 Forward -187 -168 3.04771 0.241
NP_442623.1_1 Reverse -23 -42 -9.83364 0.253
NP_440996.1_1 Forward -265 -246 20.2647 0.0234
NP_440996.1_2 Forward -120 -111 13.9627 0.293
NP_440996.1_3 Forward -218 -200 27.1585 0.0000165
NP_440996.1_5 Forward -76 -67 15.4627 0.195
NP_442287.1_1 Forward -131 -121 15.3192 0.22
NP_442173.1_1 Forward -204 -196 15.4574 0.00633
NP_442173.1_1 Reverse -197 -205 15.4574 0.00633
NP_442752.1_4 Forward -205 -198 13.8055 0.0199
NP_442752.1_4 Reverse -196 -203 13.8055 0.0199
NP_442752.1_4 Reverse -329 -336 5.54565 0.194
NP_442752.1_4 Reverse -121 -128 5.44732 0.202
NP_443027.1_4 Reverse -194 -204 13.2547 0.0521
NP_442975.1_10 Forward -209 -195 10.2254 0.056
NP_442975.1_10 Reverse -192 -206 4.22722 0.245
NP_440784.1_7 Forward -204 -197 15.9687 0.0123
NP_440784.1_7 Reverse -197 -204 15.9687 0.0123
NP_440061.1_9 Forward -207 -193 11.5037 0.109
NP_440061.1_9 Reverse -194 -208 9.24208 0.149
NP_440061.1_9 Reverse -119 -133 5.30886 0.29
NP_440110.1_4 Forward -292 -273 8.16093 0.134
NP_441054.1_4 Forward -215 -197 0.21581 0.174
NP_441054.1_4 Reverse -111 -129 -3.12744 0.26
NP_441145.1_1 Forward -370 -351 4.916 0.254
NP_441476.1_5 Reverse -191 -210 -0.983855 0.2
NP_440878.1_1 Reverse -185 -204 15.9291 0.259
NP_442062.1_8 Reverse -196 -206 17.3846 0.00193
NP_442062.1_8 Reverse -121 -131 12.3697 0.033
NP_442062.1_8 Forward -205 -195 10.3048 0.0493
NP_442062.1_8 Reverse -214 -224 4.20827 0.228
NP_440761.1_4 Reverse -261 -280 -11.9969 0.218
NP_440304.1_4 Reverse -194 -204 10.8948 0.051
NP_440304.1_4 Forward -207 -197 1.84832 0.299
NP_442242.1_4 Forward -204 -197 14.3954 0.0124
NP_442242.1_4 Reverse -197 -204 14.3954 0.0124
NP_441781.1_7 Reverse -196 -215 12.7825 0.136
NP_441781.1_7 Reverse -121 -140 -1.08219 0.268
NP_440011.1_1 Forward -207 -188 15.2408 0.188
NP_439918.1_2 Reverse -140 -159 -2.16383 0.242
NP_439918.1_3 Reverse -149 -168 5.11266 0.264
NP_439918.1_3 Forward -208 -189 4.62101 0.264
NP_441210.1_8 Forward -122 -103 13.7658 0.133
NP_440291.1_1 Forward -312 -293 15.2408 0.286
NP_441208.1_9 Forward -208 -194 7.57108 0.221
NP_441208.1_9 Reverse -41 -55 5.40779 0.267
NP_441594.1_6 Forward -94 -75 4.52268 0.219
NP_440132.1_1 Forward -207 -189 10.7372 0.218
NP_442110.1_7 Forward -205 -191 12.0943 0.0586
NP_442110.1_7 Reverse -272 -286 5.80112 0.162
NP_442110.1_7 Reverse -196 -210 1.76955 0.222
NP_442367.1_10 Reverse -327 -341 15.5359 0.279
NP_440856.1_4 Reverse -189 -208 8.45592 0.0597
NP_441083.1_5 Reverse -196 -206 20.3345 0.00053
NP_441083.1_5 Forward -205 -195 11.2881 0.0159
NP_441083.1_5 Forward -338 -328 6.17489 0.0894
NP_441083.1_5 Reverse -329 -339 4.69992 0.134
NP_441083.1_5 Forward -165 -155 1.94665 0.197
NP_441083.1_5 Reverse -121 -131 0.963343 0.218
NP_441083.1_5 Forward -281 -271 -0.118297 0.256
NP_441083.1_5 Forward -130 -120 -0.708283 0.276
NP_442827.1_8 Reverse -321 -340 0.686995 0.199
NP_441738.1_2 Forward -203 -196 15.28 0.0102
NP_441738.1_2 Reverse -198 -205 15.28 0.0102
NP_441738.1_2 Forward -128 -121 10.2652 0.101
NP_441558.1_5 Reverse -194 -213 23.5006 0.00172
NP_440209.1_1 Reverse -196 -204 18.1123 0.00295
NP_440209.1_1 Forward -205 -197 18.1123 0.00295
NP_442889.1_8 Reverse -193 -207 11.307 0.0733
NP_442889.1_8 Forward -88 -74 10.3237 0.0864
NP_442889.1_8 Reverse -218 -232 6.0955 0.203
NP_440447.1_1 Reverse -191 -209 4.6407 0.223
NP_440447.1_5 Reverse -321 -331 15.418 0.277
NP_440056.1_1 Reverse -191 -210 14.0608 0.146
NP_441713.1_1 Forward -211 -192 -10.1286 0.193
NP_441713.1_1 Reverse -115 -134 -16.3235 0.28
NP_441713.1_8 Forward -318 -300 8.86894 0.268
NP_440178.1_7 Reverse -195 -214 -20.5517 0.194
NP_442570.1_3 Reverse -313 -332 3.6377 0.166
NP_441025.1_5 Forward -362 -348 13.7659 0.294
NP_442445.1_1 Reverse -191 -210 17.404 0.122
NP_441327.1_1 Reverse -236 -255 2.96396 0.279
NP_442111.1_4 Forward -206 -192 22.6157 0.000842
NP_442111.1_4 Reverse -195 -209 8.35772 0.0758
NP_442111.1_4 Reverse -177 -191 5.1128 0.176
NP_441624.1_7 Reverse -202 -216 14.5526 0.158
NP_440906.1_5 Forward -204 -197 15.8704 0.0124
NP_440906.1_5 Reverse -197 -204 15.8704 0.0124
NP_440747.1_10 Reverse -193 -205 17.1486 0.000663
NP_440747.1_10 Forward -208 -196 14.887 0.00223
NP_440747.1_10 Forward -133 -121 -2.32097 0.0331
NP_440747.1_10 Forward -284 -272 -11.8591 0.161
NP_440747.1_10 Reverse -118 -130 -12.2524 0.254
NP_441847.1_9 Forward -59 -41 10.8356 0.232
NP_442973.1_5 Reverse -187 -206 10.5209 0.282
NP_441486.1_1 Reverse -211 -225 0.88457 0.124
NP_441486.1_1 Forward -208 -194 -2.45868 0.175
NP_441486.1_1 Reverse -193 -207 -2.55701 0.175
NP_441486.1_1 Forward -366 -352 -4.52363 0.201
NP_441486.1_1 Forward -226 -212 -6.19526 0.283
NP_440944.1_2 Forward -217 -198 -1.57384 0.259
NP_442634.1_4 Forward -207 -193 -1.27871 0.149
NP_442634.1_4 Reverse -194 -208 -1.8687 0.149
NP_442634.1_4 Reverse -119 -133 -1.8687 0.149
NP_442848.1_1 Forward -211 -197 -1.67204 0.263
NP_442848.1_5 Forward -289 -271 4.14905 0.276
NP_442848.1_9 Reverse -331 -350 -1.27885 0.288
NP_443018.1_3 Forward -204 -197 14.8871 0.0123
NP_443018.1_3 Reverse -197 -204 14.8871 0.0123
NP_440376.1_1 Forward -205 -196 19.4693 0.000692
NP_440376.1_1 Reverse -196 -205 19.4693 0.000692
NP_440376.1_1 Reverse -121 -130 13.4711 0.016
NP_440376.1_1 Reverse -272 -281 10.4228 0.0288
NP_440376.1_1 Reverse -329 -338 3.44131 0.203
NP_440376.1_1 Reverse -330 -339 1.1797 0.255
NP_440376.1_1 Forward -130 -121 -0.0986038 0.285
NP_441588.1_4 Reverse -198 -208 15.9097 0.0369
NP_441588.1_4 Forward -221 -211 7.64985 0.178
NP_442687.1_7 Reverse -195 -205 9.02648 0.0994
NP_442687.1_7 Forward -206 -196 8.92815 0.0994
NP_442191.1_4 Forward -204 -190 17.2953 0.0224
NP_442485.1_3 Forward -351 -332 -1.37718 0.257
NP_441846.1_1 Reverse -43 -62 18.879 0.0245
NP_441846.1_10 Reverse -122 -141 -22.2233 0.257
NP_441763.1_10 Forward -292 -273 7.17681 0.248
NP_440360.1_10 Forward -165 -151 3.24451 0.239
NP_442658.1_1 Reverse -194 -204 14.2375 0.0237
NP_442658.1_1 Forward -207 -197 6.76441 0.214
NP_442198.1_7 Forward -220 -201 10.4217 0.248
NP_442782.1_2 Forward -205 -191 11.111 0.173
NP_442782.1_2 Forward -216 -202 4.42448 0.254
NP_442782.1_2 Forward -217 -203 2.94952 0.269
NP_442782.1_2 Reverse -128 -142 1.67122 0.281
NP_442782.1_2 Reverse -273 -287 0.786239 0.284
NP_441414.1_9 Reverse -196 -215 0.196116 0.0845
NP_442937.1_5 Forward -210 -191 16.9124 0.0377
NP_442937.1_5 Reverse -191 -210 6.39097 0.28
NP_442937.1_5 Reverse -147 -166 6.29264 0.282
NP_441958.1_5 Reverse -195 -205 21.2195 0.000805
NP_441958.1_5 Forward -206 -196 12.2714 0.00183
NP_441958.1_5 Reverse -120 -130 1.65166 0.0872
NP_441958.1_5 Reverse -328 -338 -1.19994 0.231
NP_442486.1_4 Reverse -198 -217 8.25926 0.27
NP_440203.1_5 Forward -29 -19 12.0743 0.166
NP_440203.1_5 Reverse -124 -134 10.1076 0.239
NP_440203.1_5 Forward -128 -118 10.0093 0.242
NP_439990.1_5 Reverse -116 -129 12.8023 0.106
NP_439990.1_5 Forward -210 -197 11.0324 0.128
NP_439990.1_5 Reverse -191 -204 10.7374 0.128
NP_442376.1_2 Forward -210 -191 -12.7836 0.286
NP_442911.1_2 Forward -215 -196 5.01433 0.0356
NP_442911.1_2 Reverse -186 -205 -2.75381 0.102
NP_441580.1_6 Forward -216 -197 4.03102 0.117
NP_440153.1_5 Reverse -273 -287 2.06454 0.239
NP_443055.1_6 Reverse -182 -200 4.44329 0.182
NP_442236.1_3 Forward -233 -214 8.06259 0.248
NP_442236.1_7 Forward -237 -218 12.1925 0.215
NP_440993.1_3 Reverse -186 -205 5.99684 0.148
NP_440993.1_3 Reverse -319 -338 3.53858 0.181
NP_440993.1_3 Reverse -363 -382 -0.787962 0.273
NP_442210.1_9 Forward -221 -203 10.9339 0.23
NP_442210.1_9 Forward -209 -191 9.45892 0.259
NP_441099.1_5 Forward -215 -196 18.0924 0.0135
NP_441099.1_5 Forward -175 -156 -10.817 0.262
NP_441099.1_5 Reverse -186 -205 -11.2103 0.273
NP_441294.1_7 Reverse -217 -231 11.4584 0.143
NP_440106.1_2 Reverse -351 -369 16.5388 0.225
NP_442440.1_7 Forward -330 -311 9.24257 0.23
NP_441646.1_1 Forward -212 -193 1.37609 0.231
NP_442438.1_10 Forward -135 -121 7.66941 0.09
NP_442438.1_10 Reverse -191 -205 2.75286 0.168
NP_442438.1_10 Forward -210 -196 1.08123 0.206
NP_442885.1_4 Forward -39 -26 14.6634 0.294
NP_442771.1_1 Forward -340 -322 -8.83064 0.208
NP_440484.1_3 Reverse -194 -208 12.1926 0.242
NP_440147.1_4 Forward -207 -194 18.4072 0.00407
NP_440147.1_4 Reverse -194 -207 10.344 0.0355
NP_441175.1_7 Reverse -196 -215 6.78429 0.248
NP_441550.1_8 Reverse -194 -204 15.8108 0.0132
NP_441550.1_8 Forward -207 -197 14.6309 0.0132
NP_441550.1_8 Forward -340 -330 6.46942 0.206
NP_441916.1_7 Forward -205 -195 18.9579 0.00144
NP_441916.1_7 Reverse -196 -206 10.3048 0.0261
NP_441041.1_4 Reverse -196 -215 17.2074 0.0103
NP_441041.1_4 Forward -223 -204 5.01433 0.0533
NP_441041.1_4 Forward -281 -262 -12.9802 0.278
NP_441041.1_4 Reverse -121 -140 -13.2752 0.285
NP_441041.1_7 Reverse -193 -205 13.3454 0.0485
NP_442396.1_5 Forward -209 -196 12.114 0.0913
NP_440569.1_10 Forward -307 -288 4.15348 0.27
NP_442004.1_6 Reverse -196 -210 8.94771 0.14
NP_442004.1_6 Forward -205 -191 7.27608 0.161
NP_441725.1_4 Reverse -191 -205 22.025 0.00544
NP_441725.1_5 Reverse -197 -207 2.04498 0.115
NP_441725.1_5 Forward -204 -194 1.94665 0.115
NP_441725.1_5 Reverse -122 -132 -0.0199663 0.223
NP_439966.1_7 Reverse -194 -204 14.3359 0.0203
NP_439966.1_7 Forward -132 -122 9.41933 0.113
NP_439966.1_7 Forward -207 -197 7.25606 0.15
NP_442941.1_3 Forward -204 -194 19.2529 0.00262
NP_442941.1_3 Reverse -197 -207 11.0914 0.0116
NP_442941.1_3 Reverse -122 -132 7.84651 0.0564
NP_442941.1_3 Forward -129 -119 -0.0199663 0.244
NP_440289.1_2 Reverse -193 -206 3.16588 0.0811
NP_440289.1_2 Reverse -218 -231 -2.63565 0.261
NP_440983.1_5 Forward -170 -151 -1.47551 0.228
NP_440983.1_5 Reverse -196 -215 -3.63879 0.24
NP_440983.1_5 Reverse -221 -240 -7.96535 0.294
NP_440260.1_8 Forward -214 -196 -7.15901 0.295
NP_440260.1_8 Forward -194 -176 -7.25734 0.295
NP_441514.1_6 Reverse -40 -47 12.8221 0.252
NP_442281.1_1 Reverse -191 -205 15.2402 0.0132
NP_442281.1_1 Forward -210 -196 7.57046 0.0969
NP_442281.1_1 Forward -343 -329 4.52221 0.192
NP_442281.1_1 Forward -135 -121 2.5556 0.263
NP_442281.1_1 Forward -286 -272 2.45727 0.266
NP_442281.1_1 Forward -141 -127 1.5723 0.296
NP_441334.1_7 Forward -207 -188 -9.83364 0.12
NP_442575.1_8 Reverse -6 -25 0.392778 0.232
NP_440177.1_9 Forward -213 -194 15.2408 0.19
NP_442012.1_1 Reverse -190 -209 1.37609 0.217
NP_442012.1_1 Forward -344 -325 1.0811 0.224
NP_442012.1_1 Forward -375 -356 -1.7705 0.297
NP_442982.1_5 Reverse -186 -205 -1.57384 0.267
NP_442982.1_5 Forward -291 -272 -2.55715 0.286
NP_441644.1_6 Forward -205 -195 19.0557 0.000803
NP_441644.1_6 Reverse -196 -206 17.3841 0.00127
NP_441644.1_6 Reverse -121 -131 3.71617 0.267
NP_442215.1_2 Forward -207 -191 -0.728113 0.171
NP_442215.1_2 Forward -225 -209 -5.05468 0.244
NP_442029.1_6 Forward -210 -191 15.2408 0.0999
NP_442029.1_6 Reverse -311 -330 6.58763 0.238
NP_442029.1_6 Reverse -122 -141 3.24438 0.282
NP_440253.1_2 Forward -281 -263 -2.24246 0.262
NP_440929.1_8 Forward -205 -196 19.2726 0.000701
NP_440929.1_8 Reverse -196 -205 19.2726 0.000701
NP_440929.1_8 Forward -281 -272 4.0313 0.193
NP_442933.1_10 Forward -205 -196 17.601 0.00325
NP_442933.1_10 Reverse -196 -205 17.601 0.00325
NP_442933.1_10 Forward -223 -214 9.93116 0.0552
NP_441751.2_8 Forward -204 -190 5.21113 0.0448
NP_442926.1_3 Reverse -197 -216 7.86593 0.173
NP_442554.1_8 Forward -204 -194 17.2863 0.00543
NP_442554.1_8 Reverse -197 -207 15.3197 0.00882
NP_441762.1_7 Reverse -195 -207 0.530633 0.0747
NP_441762.1_7 Forward -206 -194 -6.84419 0.284
NP_442313.1_5 Forward -204 -185 6.58763 0.236
NP_442142.1_4 Reverse -193 -206 12.9 0.0406
NP_442142.1_4 Reverse -211 -224 8.08184 0.124
NP_442142.1_4 Forward -208 -195 3.55864 0.251
NP_442292.1_1 Reverse -197 -206 18.486 0.00229
NP_442292.1_1 Forward -204 -195 17.5026 0.00435
NP_442292.1_1 Reverse -122 -131 -0.68859 0.268
NP_440919.1_1 Reverse -324 -343 -7.27704 0.275
NP_442476.1_6 Reverse -197 -211 2.94952 0.169
NP_440895.1_6 Forward -211 -198 8.77074 0.246
NP_441523.1_6 Reverse -192 -211 12.2908 0.161
NP_443009.1_5 Forward -206 -195 14.5128 0.02
NP_443009.1_5 Forward -131 -120 12.1529 0.0547
NP_443009.1_5 Reverse -195 -206 10.1862 0.0792
NP_443009.1_5 Reverse -120 -131 4.28642 0.254
NP_443009.1_5 Forward -339 -328 3.40144 0.296
NP_442408.2_1 Forward -205 -186 -6.49039 0.282
NP_441715.1_4 Forward -204 -194 16.7946 0.0106
NP_441715.1_4 Reverse -197 -207 7.94484 0.107
NP_440881.1_4 Reverse -317 -336 1.37609 0.226
NP_440881.1_4 Forward -324 -305 -0.000545616 0.243
NP_440379.1_5 Forward -220 -201 -4.6221 0.215
NP_440464.1_10 Reverse -197 -207 13.0082 0.169
NP_441468.1_1 Forward -204 -197 15.8704 0.0124
NP_441468.1_1 Reverse -197 -204 15.8704 0.0124
NP_441020.2_6 Forward -207 -190 13.4119 0.0736
NP_441015.1_10 Reverse -191 -210 0.58944 0.165
NP_441015.1_10 Reverse -122 -141 -10.6203 0.286
NP_441015.1_10 Forward -210 -191 -10.817 0.288
NP_441673.1_1 Forward -205 -196 20.8459 0.000698
NP_441673.1_1 Reverse -196 -205 20.8459 0.000698
NP_441673.1_1 Forward -130 -121 1.27803 0.155
NP_441673.1_1 Reverse -121 -130 1.27803 0.155
NP_441826.1_2 Forward -136 -122 2.94952 0.117
NP_441330.1_1 Reverse -191 -210 6.39097 0.0252
NP_442490.1_9 Reverse -317 -336 -2.36049 0.21
NP_441764.1_8 Forward -56 -46 13.1291 0.284
NP_442868.1_6 Reverse -194 -204 10.4031 0.038
NP_442868.1_6 Forward -207 -197 9.81313 0.038
NP_442868.1_6 Forward -132 -122 3.71661 0.194
NP_441612.1_2 Reverse -221 -231 10.776 0.21
NP_441612.1_2 Reverse -196 -206 8.54929 0.21
NP_442559.1_3 Forward -291 -272 8.06259 0.291
NP_442227.1_2 Forward -397 -378 -0.0988766 0.253
NP_442227.1_2 Forward -364 -345 -0.4922 0.253
NP_442361.1_3 Reverse -190 -203 9.06573 0.283
NP_442427.1_8 Reverse -112 -131 11.0125 0.155
NP_442808.1_1 Reverse -195 -205 8.73102 0.0481
NP_442808.1_1 Forward -206 -196 8.63269 0.0481
NP_442808.1_1 Reverse -220 -230 6.0761 0.131
NP_442808.1_1 Forward -93 -83 3.71617 0.227
NP_440568.1_3 Reverse -215 -234 14.0608 0.0514
NP_442692.1_1 Forward -215 -196 1.37609 0.222
NP_440145.1_3 Reverse -186 -205 -5.21209 0.261
NP_442050.1_5 Reverse -194 -204 15.9091 0.0091
NP_442050.1_5 Forward -132 -122 11.091 0.108
NP_442050.1_5 Forward -207 -197 7.64939 0.243
NP_442050.1_5 Forward -283 -273 7.25606 0.265
NP_442342.1_9 Forward -340 -324 7.72835 0.202
NP_441114.1_3 Reverse -209 -218 7.66954 0.231
NP_440558.1_2 Reverse -187 -206 -0.688862 0.204
NP_440558.1_2 Reverse -356 -375 -3.3438 0.234
NP_440162.1_2 Forward -364 -345 8.75091 0.282
NP_441048.1_6 Forward -52 -38 16.3407 0.296
NP_442789.1_4 Forward -207 -188 -6.98204 0.289
NP_442789.1_4 Reverse -197 -216 -7.57203 0.298
NP_441518.1_3 Reverse -168 -187 -13.7669 0.264
NP_441878.1_6 Reverse -195 -205 10.5014 0.0176
NP_441878.1_6 Forward -206 -196 10.4031 0.0176
NP_441878.1_6 Forward -224 -214 0.865012 0.132
NP_441878.1_6 Reverse -120 -130 -7.49312 0.231
NP_441036.1_4 Forward -170 -151 10.4225 0.243
NP_441036.1_8 Reverse -195 -205 15.713 0.00724
NP_441036.1_8 Forward -206 -196 8.33817 0.174
NP_442650.1_2 Reverse -196 -210 8.55439 0.13
NP_441557.1_5 Forward -205 -196 19.9609 0.000699
NP_441557.1_5 Reverse -196 -205 19.9609 0.000699
NP_441557.1_5 Forward -130 -121 0.393051 0.166
NP_441557.1_5 Reverse -121 -130 0.393051 0.166
NP_441445.1_1 Forward -239 -220 0.196116 0.281
NP_441590.1_4 Reverse -192 -211 3.63691 0.29
NP_442066.2_9 Reverse -117 -130 10.1474 0.156
NP_440101.1_3 Reverse -191 -210 1.17943 0.282
NP_441458.1_10 Reverse -187 -206 13.7658 0.0856
NP_441564.1_2 Reverse -272 -291 10.7175 0.0727
NP_442183.1_1 Reverse -196 -210 7.76774 0.131
NP_442183.1_1 Forward -205 -191 7.17775 0.147
NP_442183.1_3 Forward -389 -370 14.1583 0.247
NP_442166.1_7 Forward -204 -190 22.1241 0.0164
NP_441574.1_1 Forward -217 -198 2.94938 0.151
NP_441549.1_9 Reverse -117 -135 -5.68405 0.198
NP_441238.1_10 Forward -381 -367 18.7808 0.2
NP_442347.1_2 Reverse -197 -206 12.4878 0.056
NP_442347.1_2 Forward -337 -328 6.68623 0.156
NP_442347.1_2 Forward -204 -195 3.34298 0.284
NP_442645.1_2 Reverse -206 -225 -4.32711 0.0562
NP_442645.1_2 Forward -213 -194 -12.4886 0.144
NP_442645.1_2 Reverse -188 -207 -22.42 0.291
NP_441037.1_4 Forward -207 -197 7.9999 0.237
NP_441037.1_4 Reverse -194 -204 7.22024 0.237
NP_442594.1_8 Reverse -150 -169 4.52268 0.26
NP_442508.1_8 Reverse -126 -143 10.3636 0.272
NP_441633.1_3 Forward -207 -194 1.10092 0.109
NP_441633.1_3 Forward -232 -219 -2.93064 0.177
NP_441633.1_3 Reverse -194 -207 -3.71729 0.177
NP_440136.1_2 Forward -204 -197 15.9687 0.0123
NP_440136.1_2 Reverse -197 -204 15.9687 0.0123
NP_440136.1_2 Reverse -122 -129 11.1505 0.0519
NP_442590.1_10 Forward -223 -204 10.8159 0.175
NP_442998.1_5 Forward -314 -304 9.41981 0.241
NP_442998.1_10 Forward -203 -196 15.5754 0.0102
NP_442998.1_10 Reverse -198 -205 15.5754 0.0102
NP_440899.1_2 Reverse -185 -204 6.88182 0.25
NP_440299.1_1 Forward -209 -196 22.7331 0.000547
NP_440299.1_1 Reverse -192 -205 11.1301 0.0518
NP_441799.1_1 Forward -209 -195 7.96378 0.128
NP_441799.1_1 Reverse -192 -206 7.76712 0.133
NP_441007.1_10 Reverse -191 -204 3.26421 0.182
NP_441007.1_10 Forward -210 -197 1.00259 0.209
NP_440256.1_1 Forward -208 -189 6.98095 0.0279
NP_440256.1_1 Reverse -193 -212 0.884433 0.0791
NP_440256.1_1 Reverse -118 -137 -7.17871 0.231
NP_440256.1_1 Forward -220 -201 -9.047 0.273
NP_441559.1_8 Reverse -191 -205 11.0127 0.0574
NP_441559.1_8 Forward -330 -316 2.85119 0.143
NP_441559.1_8 Reverse -116 -130 0.589577 0.165
NP_441559.1_8 Reverse -311 -325 -4.81863 0.238
NP_441559.1_8 Forward -135 -121 -6.09693 0.274
NP_441559.1_8 Forward -286 -272 -7.67023 0.297
NP_440915.1_6 Forward -209 -195 12.4876 0.0208
NP_440915.1_6 Reverse -192 -206 10.6193 0.0301
NP_440915.1_6 Reverse -325 -339 10.4227 0.0319
NP_440915.1_6 Forward -134 -120 -2.36035 0.268
NP_440915.1_6 Forward -330 -316 -3.44199 0.296
NP_440997.1_6 Reverse -18 -37 17.3057 0.0808
NP_442158.1_4 Reverse -114 -124 14.4347 0.182
NP_440717.1_3 Forward -335 -321 16.4202 0.179
NP_442785.1_7 Reverse -194 -208 10.7177 0.228
NP_442866.1_1 Reverse -139 -158 -6.88371 0.261
NP_441464.1_1 Forward -285 -266 10.6192 0.24
NP_440702.1_2 Reverse -150 -169 2.94938 0.244
NP_440306.1_8 Forward -107 -88 -1.27961 0.228
NP_440695.1_1 Forward -357 -338 18.0924 0.267
NP_440695.1_5 Forward -217 -198 7.7676 0.15
NP_441939.1_3 Forward -204 -185 22.5172 0.00342
NP_441494.1_6 Reverse -191 -204 8.77074 0.227
NP_442993.1_1 Reverse -214 -230 -8.88958 0.176
NP_442993.1_1 Reverse -354 -370 -9.18458 0.179
NP_442386.1_9 Forward -206 -197 13.8639 0.0289
NP_442386.1_9 Forward -137 -128 7.76745 0.217
NP_442386.1_9 Forward -131 -122 7.37413 0.219
NP_442386.1_9 Reverse -195 -204 6.39082 0.219
NP_440570.1_5 Forward -215 -196 4.03102 0.231
NP_441340.1_5 Forward -204 -197 15.6737 0.0124
NP_441340.1_5 Reverse -197 -204 15.6737 0.0124
NP_441340.1_9 Forward -55 -45 7.48397 0.256
NP_442484.1_2 Forward -216 -197 16.6174 0.0323
NP_442484.1_2 Forward -141 -122 -1.67217 0.295
NP_440168.1_8 Reverse -202 -221 3.83436 0.242
NP_440327.1_3 Forward -392 -373 11.9958 0.297
NP_442240.1_1 Reverse -352 -371 9.14342 0.231
NP_442240.1_2 Forward -204 -185 -20.3551 0.295
NP_440586.1_1 Forward -221 -202 -3.14714 0.263
NP_440586.1_1 Forward -209 -190 -5.9004 0.291
NP_440586.1_8 Forward -204 -197 13.2151 0.026
NP_440586.1_8 Reverse -197 -204 13.2151 0.026
NP_440586.1_9 Forward -331 -312 7.57094 0.273
NP_442251.1_6 Forward -204 -197 15.2804 0.0124
NP_442251.1_6 Reverse -197 -204 15.2804 0.0124
NP_440684.1_9 Forward -211 -197 8.16106 0.235
NP_441262.1_3 Reverse -196 -203 14.7888 0.0223
NP_441262.1_3 Forward -205 -198 14.7888 0.0223
NP_440027.1_3 Reverse -344 -362 1.69003 0.299
NP_440027.1_8 Forward -145 -126 5.2102 0.282
NP_443051.1_1 Reverse -195 -204 19.5676 0.00335
NP_443051.1_1 Forward -206 -197 10.4228 0.00754
NP_443051.1_1 Reverse -120 -129 -0.000272808 0.245
NP_443051.1_5 Reverse -34 -53 11.7008 0.209
NP_443051.1_5 Reverse -33 -52 8.75091 0.235
NP_441232.1_10 Forward -216 -197 10.9142 0.105
NP_439937.1_4 Reverse -273 -292 13.0775 0.252
NP_439937.1_9 Reverse -359 -376 -8.41828 0.176
NP_439937.1_9 Forward -166 -149 -9.00826 0.179
NP_439937.1_9 Reverse -360 -377 -9.20492 0.183
NP_439937.1_9 Forward -339 -322 -17.0714 0.291
NP_441595.1_5 Reverse -322 -340 6.214 0.229
NP_440408.1_7 Reverse -202 -221 9.63589 0.255
NP_440408.1_7 Forward -217 -198 8.55425 0.276
NP_440439.1_1 Reverse -193 -206 10.934 0.0339
NP_439943.1_7 Forward -210 -191 24.0905 0.0303
NP_439943.1_7 Forward -222 -203 3.04771 0.29
NP_439943.1_7 Reverse -191 -210 1.86774 0.299
NP_440372.1_2 Forward -204 -197 16.3621 0.0124
NP_440372.1_2 Reverse -197 -204 16.3621 0.0124
NP_441138.1_5 Forward -39 -26 10.1839 0.238
NP_441789.1_7 Forward -347 -328 -5.60616 0.299
NP_441803.1_2 Reverse -191 -210 6.09597 0.159
NP_441803.1_2 Reverse -209 -228 -1.27885 0.297
NP_439977.1_5 Reverse -190 -209 12.2908 0.0597
NP_439977.1_5 Forward -211 -192 2.55606 0.171
NP_439977.1_7 Forward -216 -197 11.7 0.262
NP_442384.1_10 Forward -205 -192 18.8988 0.00338
NP_442384.1_10 Reverse -196 -209 17.7189 0.00567
NP_442384.1_10 Forward -338 -325 6.01747 0.113
NP_442384.1_10 Forward -130 -117 5.62415 0.124
NP_442384.1_10 Reverse -208 -221 1.88757 0.243
NP_442384.1_10 Reverse -221 -234 1.00259 0.271
NP_441877.1_7 Reverse -191 -210 4.81688 0.218
NP_441018.1_7 Reverse -117 -136 14.8474 0.118
NP_441018.1_7 Forward -209 -190 12.3892 0.161
NP_441018.1_7 Forward -240 -221 8.65258 0.241
NP_441018.1_7 Forward -221 -202 7.47261 0.269
NP_442790.1_4 Reverse -187 -206 -14.7502 0.281
NP_442262.1_10 Forward -204 -197 14.1988 0.0123
NP_442262.1_10 Reverse -197 -204 14.1988 0.0123
NP_441689.1_5 Forward -132 -122 9.91099 0.132
NP_441689.1_5 Reverse -194 -204 8.3377 0.132
NP_441689.1_5 Forward -207 -197 5.78111 0.197
NP_442244.1_3 Forward -227 -208 11.7992 0.148
NP_440344.1_10 Reverse -189 -206 0.137172 0.0369
NP_440344.1_10 Forward -212 -195 -7.53264 0.118
NP_440282.1_10 Reverse -198 -217 -2.55715 0.232
NP_440531.1_6 Reverse -188 -207 -3.24547 0.264
NP_441060.1_9 Forward -205 -186 13.0775 0.179
NP_441965.1_3 Forward -215 -196 6.29264 0.149
NP_441965.1_10 Forward -208 -192 2.41848 0.288
NP_442556.1_10 Reverse -73 -92 9.78572 0.273
NP_440297.1_9 Reverse -197 -207 -0.118297 0.282
NP_440297.1_9 Forward -204 -194 -0.216628 0.282
NP_440350.1_1 Reverse -267 -286 2.55606 0.21
NP_441592.1_4 Reverse -214 -233 4.71934 0.144
NP_441896.1_5 Forward -236 -229 15.3787 0.268
NP_440894.1_10 Forward -228 -209 9.24257 0.163
NP_440999.1_2 Forward -381 -362 13.6675 0.177
NP_440999.1_9 Reverse -192 -206 10.226 0.0548
NP_440999.1_9 Forward -350 -336 -0.295402 0.203
NP_440999.1_9 Forward -330 -316 -1.27871 0.232
NP_440888.1_2 Forward -205 -191 14.1586 0.02
NP_440888.1_2 Reverse -121 -135 12.782 0.0389
NP_440888.1_2 Reverse -196 -210 11.602 0.0635
NP_440888.1_2 Forward -338 -324 7.47213 0.194
NP_440888.1_2 Forward -397 -383 5.89884 0.258
NP_440888.1_2 Reverse -317 -331 5.70218 0.267
NP_440052.1_5 Forward -216 -197 8.55425 0.095
NP_442277.1_4 Reverse -187 -206 1.57197 0.272
NP_441543.1_2 Reverse -197 -206 16.9127 0.00359
NP_441543.1_2 Forward -204 -195 15.9293 0.00518
NP_441543.1_2 Reverse -215 -224 4.91628 0.213
NP_442845.1_2 Forward -211 -197 15.2409 0.0752
NP_442845.1_2 Reverse -121 -135 8.16106 0.195
NP_441304.1_10 Reverse -39 -48 15.1427 0.164
NP_441304.1_10 Reverse -40 -49 13.0777 0.255
NP_441918.1_7 Reverse -350 -369 -2.16383 0.297
NP_441469.1_8 Reverse -195 -204 6.5879 0.227
NP_441469.1_8 Forward -206 -197 6.48957 0.227
NP_441548.1_8 Reverse -346 -364 24.0119 0.0207
NP_442315.1_2 Reverse -116 -128 8.29878 0.297
NP_442315.1_3 Forward -217 -198 16.9124 0.0784
NP_443064.1_6 Reverse -329 -339 16.3482 0.0796
NP_443064.1_6 Reverse -196 -206 12.5669 0.0796
NP_443064.1_6 Forward -205 -195 10.8217 0.13
NP_443064.1_6 Reverse -121 -131 8.78555 0.271
NP_443064.1_6 Forward -130 -120 8.78555 0.271
NP_442578.1_7 Forward -204 -197 14.5921 0.026
NP_442578.1_7 Reverse -197 -204 14.5921 0.026
NP_440710.1_1 Forward -296 -278 -0.374176 0.163
NP_440710.1_1 Reverse -188 -206 -0.570838 0.164
NP_440220.1_4 Reverse -201 -220 -2.36125 0.27
NP_440220.1_4 Forward -218 -199 -3.14789 0.285
NP_441462.1_2 Forward -205 -195 20.2362 0.000805
NP_441462.1_2 Reverse -196 -206 11.5831 0.00406
NP_441462.1_2 Forward -130 -120 0.668351 0.135
NP_441462.1_2 Reverse -272 -282 -0.904945 0.265
NP_441462.1_2 Reverse -329 -339 -1.10161 0.281
NP_441621.1_7 Forward -207 -193 -5.21195 0.248
NP_443062.1_1 Reverse -196 -214 8.44842 0.153
NP_441410.1_4 Reverse -74 -93 7.27514 0.297
NP_442204.1_1 Reverse -192 -203 21.1015 0.0035
NP_442204.1_2 Reverse -186 -205 12.2908 0.223
NP_442204.1_5 Forward -356 -337 2.75272 0.206
NP_440516.1_2 Forward -229 -211 1.88744 0.184
NP_440516.1_8 Forward -205 -196 16.9127 0.00442
NP_440516.1_8 Reverse -196 -205 16.9127 0.00442
NP_442428.1_4 Forward -224 -205 10.2259 0.147
NP_442428.1_5 Forward -204 -197 15.8704 0.0124
NP_442428.1_5 Reverse -197 -204 15.8704 0.0124
NP_440673.1_3 Forward -203 -196 12.4288 0.0426
NP_440673.1_3 Reverse -198 -205 12.4288 0.0426
NP_440673.1_3 Forward -225 -218 8.20058 0.234
NP_441052.1_2 Reverse -196 -206 19.9412 0.00106
NP_441052.1_2 Forward -205 -195 10.4031 0.0285
NP_441052.1_2 Reverse -121 -131 0.865012 0.256
NP_442219.1_9 Reverse -197 -206 17.7976 0.00718
NP_442219.1_9 Forward -204 -195 8.25953 0.0681
NP_440436.1_4 Reverse -197 -206 17.2072 0.00233
NP_440436.1_4 Forward -204 -195 9.24241 0.0871
NP_440436.1_4 Reverse -122 -131 4.22755 0.277
NP_441884.1_2 Forward -120 -106 15.3858 0.248
NP_441884.1_9 Forward -372 -353 -25.1733 0.29
NP_440689.1_1 Forward -136 -118 6.41066 0.297
NP_442864.1_3 Forward -211 -192 11.7008 0.181
NP_440314.1_9 Reverse -197 -216 -0.885524 0.117
NP_440314.1_9 Forward -172 -153 -8.85033 0.254
NP_442414.1_2 Reverse -133 -152 15.0441 0.134
NP_442414.1_8 Reverse -365 -384 6.4893 0.293
NP_442907.1_9 Reverse -191 -210 9.14423 0.11
NP_441719.1_4 Forward -204 -197 16.3621 0.0124
NP_441719.1_4 Reverse -197 -204 16.3621 0.0124
NP_441733.1_10 Reverse -326 -339 3.46087 0.3
NP_441004.1_1 Forward -211 -192 -6.98204 0.193
NP_441004.1_1 Forward -235 -216 -11.4069 0.238
NP_442366.1_3 Forward -206 -188 -3.81576 0.258
NP_442366.1_5 Forward -208 -198 15.4175 0.0374
NP_441034.1_4 Reverse -191 -210 16.7738 0.143
NP_442206.1_10 Forward -205 -190 4.30646 0.178
NP_440094.1_2 Reverse -191 -210 -2.85214 0.281
NP_443054.1_2 Reverse -194 -208 -0.393733 0.294
NP_441851.1_10 Forward -206 -196 15.8113 0.00552
NP_441851.1_10 Reverse -195 -205 8.53483 0.114
NP_441851.1_10 Reverse -120 -130 5.5849 0.207
NP_441851.1_10 Forward -131 -121 4.20827 0.282
NP_442208.1_5 Forward -207 -188 -5.31042 0.261
NP_441542.1_4 Forward -38 -24 4.52282 0.264
NP_442856.1_7 Reverse -187 -206 5.40766 0.131
NP_441668.1_4 Reverse -108 -127 -0.983855 0.265
NP_442515.1_1 Forward -131 -117 1.67122 0.152
NP_442515.1_1 Reverse -195 -209 -4.22864 0.298
NP_442515.1_1 Forward -206 -192 -4.62196 0.298
NP_441396.1_5 Reverse -150 -159 8.25953 0.224
NP_440593.1_3 Forward -210 -191 6.19431 0.114
NP_440593.1_3 Reverse -6 -25 -2.36049 0.224
NP_440593.1_3 Reverse -191 -210 -3.04881 0.231
NP_440593.1_3 Reverse -216 -235 -6.78538 0.28
NP_441046.1_2 Forward -216 -197 1.47442 0.256
NP_441349.1_10 Reverse -273 -292 -5.01543 0.189
NP_441409.1_6 Forward -211 -192 -8.752 0.174
NP_440432.1_9 Forward -204 -189 -2.08505 0.167
NP_439960.1_10 Reverse -189 -207 1.49411 0.198
NP_440474.1_8 Reverse -355 -369 8.3571 0.189
NP_440726.1_2 Forward -291 -272 0.884433 0.285
NP_440431.1_3 Reverse -195 -214 -1.7705 0.162
NP_442450.1_5 Forward -207 -197 7.55152 0.13
NP_442168.1_5 Reverse -330 -349 -1.27885 0.264
NP_442168.1_5 Reverse -197 -216 -2.95047 0.272
NP_442243.1_1 Reverse -190 -208 2.96833 0.204
NP_442243.1_1 Reverse -337 -355 -1.35821 0.277
NP_441570.1_1 Reverse -121 -139 1.19912 0.0325
NP_441570.1_1 Forward -205 -187 -0.669169 0.0498
NP_441570.1_1 Reverse -311 -329 -16.3038 0.242
NP_441570.1_1 Reverse -196 -214 -16.6971 0.252
NP_441078.1_4 Forward -205 -196 19.6659 0.0007
NP_441078.1_4 Reverse -196 -205 19.6659 0.0007
NP_441078.1_4 Forward -130 -121 7.86621 0.0432
NP_441078.1_4 Reverse -121 -130 0.589713 0.174
NP_441078.1_4 Forward -230 -221 -1.57357 0.266
NP_441078.1_4 Forward -223 -214 -1.96689 0.282
NP_442729.1_8 Reverse -325 -338 10.049 0.125
NP_442729.1_8 Forward -209 -196 9.36073 0.125
NP_441663.1_8 Forward -332 -313 6.98095 0.11
NP_441663.1_8 Forward -287 -268 -2.75381 0.272
NP_441663.1_8 Forward -353 -334 -3.44213 0.289
NP_442348.1_2 Reverse -42 -51 14.7494 0.146
NP_442348.1_2 Reverse -41 -50 7.57121 0.28
NP_440707.1_9 Forward -198 -179 -0.0988766 0.299
NP_441091.1_5 Reverse -192 -211 1.67108 0.29
NP_440526.1_3 Reverse -197 -208 1.04151 0.267
NP_441432.1_5 Forward -339 -325 8.16106 0.271
NP_441432.1_8 Reverse -195 -204 16.8143 0.00595
NP_441432.1_8 Forward -206 -197 16.8143 0.00595
NP_441432.1_8 Forward -131 -122 8.1612 0.0815
NP_441432.1_8 Forward -86 -77 2.65466 0.292
NP_441432.1_8 Reverse -207 -216 2.55633 0.298
NP_442320.1_8 Forward -211 -197 15.7325 0.0102
NP_441732.1_2 Reverse -192 -208 3.00846 0.0141
NP_441732.1_2 Forward -209 -193 -16.3627 0.165
NP_441732.1_2 Reverse -204 -220 -16.4611 0.167
NP_441732.1_5 Forward -318 -304 11.3077 0.21
NP_440313.1_5 Forward -334 -316 10.6381 0.294
NP_440760.1_1 Reverse -196 -215 6.39097 0.0115
NP_440760.1_1 Forward -205 -186 -4.91709 0.0475
NP_442797.1_7 Reverse -189 -207 1.78911 0.25
NP_442353.1_4 Reverse -215 -234 1.76863 0.242
NP_442353.1_4 Reverse -273 -292 -0.591301 0.29
NP_442510.1_5 Forward -214 -195 13.5691 0.224
NP_440913.1_1 Forward -207 -189 11.3272 0.168
NP_440713.1_4 Reverse -186 -205 7.37428 0.182
NP_440713.1_4 Forward -140 -121 5.211 0.214
NP_440713.1_4 Reverse -198 -217 3.53937 0.242
NP_440713.1_4 Forward -221 -202 2.26107 0.266
NP_440713.1_4 Forward -395 -376 1.96607 0.273
NP_442489.1_7 Forward -205 -196 20.1576 0.000695
NP_442489.1_7 Reverse -196 -205 20.1576 0.000695
NP_442489.1_7 Reverse -121 -130 7.86621 0.0448
NP_442489.1_7 Forward -223 -214 5.50626 0.0641
NP_442489.1_7 Forward -130 -121 0.589713 0.17
NP_442489.1_7 Reverse -272 -281 -1.6719 0.235
NP_441830.1_2 Reverse -123 -142 -4.03212 0.275
NP_441706.1_10 Reverse -211 -230 18.584 0.0784
NP_441706.1_10 Forward -233 -214 12.6841 0.166
NP_440559.1_1 Reverse -197 -206 17.4043 0.00658
NP_440559.1_1 Forward -204 -195 8.65285 0.0586
NP_441659.2_8 Forward -205 -195 20.9245 0.000805
NP_441659.2_8 Reverse -196 -206 18.1713 0.00133
NP_441659.2_8 Forward -130 -120 1.65166 0.233
NP_441022.1_1 Forward -310 -301 10.587 0.294
NP_442776.1_1 Forward -216 -197 6.19431 0.233
NP_442346.1_5 Forward -206 -196 16.6963 0.00248
NP_442346.1_5 Reverse -195 -205 16.303 0.00248
NP_442346.1_5 Forward -231 -221 7.15819 0.178
NP_442346.1_5 Forward -131 -121 4.3066 0.291
NP_440545.1_3 Forward -209 -192 12.2319 0.0214
NP_440831.1_1 Reverse -298 -317 9.53756 0.29
NP_440486.1_6 Reverse -304 -323 5.211 0.3
NP_440459.1_2 Reverse -205 -222 10.9536 0.185
NP_440459.1_2 Forward -214 -197 8.98696 0.243
NP_440459.1_2 Reverse -194 -211 8.20031 0.267
NP_442603.1_7 Forward -338 -324 12.2903 0.1
NP_442603.1_9 Reverse -189 -207 0.510803 0.293
NP_441585.1_5 Reverse -353 -372 4.81688 0.227
NP_441888.1_7 Reverse -191 -205 3.93283 0.225
NP_440449.1_6 Forward -213 -195 7.86678 0.208
NP_441948.1_4 Forward -137 -119 -4.11075 0.217
NP_441833.1_4 Forward -204 -197 15.9687 0.0124
NP_441833.1_4 Reverse -197 -204 15.9687 0.0124
NP_442162.1_9 Forward -204 -197 16.2637 0.0124
NP_442162.1_9 Reverse -197 -204 16.2637 0.0124
NP_440671.1_4 Reverse -266 -280 5.50613 0.281
NP_442199.1_5 Reverse -188 -207 -0.590531 0.177
NP_442140.1_3 Reverse -197 -207 12.2714 0.0632
NP_442140.1_3 Forward -204 -194 4.69992 0.238
NP_442021.1_3 Forward -211 -192 4.916 0.126
NP_442021.1_3 Forward -236 -217 -1.96717 0.251
NP_440875.1_9 Forward -203 -193 16.5483 0.0145
NP_441813.1_5 Reverse -194 -204 18.1713 0.00743
NP_441813.1_5 Forward -207 -197 8.63316 0.0367
NP_440594.1_8 Forward -129 -116 8.86849 0.21
NP_441259.1_1 Forward -384 -365 12.9791 0.279
NP_441490.1_1 Forward -170 -151 12.3892 0.253
NP_440590.1_4 Reverse -197 -210 17.6205 0.00882
NP_440590.1_4 Forward -204 -191 4.44418 0.0601
NP_440590.1_4 Reverse -209 -222 -5.68391 0.286
NP_440567.1_1 Reverse -197 -211 14.4542 0.0187
NP_440567.1_1 Forward -204 -190 7.86607 0.0642
NP_442497.1_10 Forward -204 -195 17.601 0.00813
NP_442497.1_10 Reverse -197 -206 10.4228 0.0087
NP_440821.1_4 Forward -207 -197 9.41981 0.0286
NP_440821.1_4 Reverse -194 -204 2.24165 0.131
NP_441239.1_9 Reverse -194 -206 13.0187 0.0389
NP_441239.1_9 Forward -207 -195 3.38223 0.285
NP_441951.1_9 Reverse -213 -232 1.37609 0.254
NP_441727.1_3 Forward -212 -193 4.62101 0.262
NP_440400.1_1 Forward -140 -121 -2.45958 0.285
NP_441892.1_1 Reverse -187 -204 5.9387 0.0995
NP_440604.1_6 Reverse -152 -171 -5.80207 0.287
NP_442193.1_1 Reverse -127 -145 8.18062 0.274
NP_440219.1_4 Forward -194 -181 16.1203 0.223
NP_442643.1_1 Forward -211 -192 7.96426 0.085
NP_442772.1_6 Reverse -109 -128 16.85 0.196
NP_440833.1_6 Forward -53 -39 17.4035 0.134
NP_442216.1_4 Forward -49 -41 8.1805 0.255
NP_440876.1_5 Reverse -198 -217 7.86593 0.277
NP_441567.1_2 Forward -358 -339 12.6841 0.0972
NP_442138.1_9 Forward -288 -269 8.65176 0.262
NP_442138.1_10 Forward -205 -186 -0.39387 0.153
NP_441782.1_10 Forward -219 -205 14.5896 0.295
NP_440546.1_4 Forward -205 -195 13.5365 0.0459
NP_440546.1_4 Reverse -196 -206 10.046 0.109
NP_441230.1_5 Reverse -191 -210 4.81767 0.185
NP_440462.1_6 Reverse -194 -204 18.7612 0.00454
NP_440462.1_6 Reverse -119 -129 7.15819 0.089
NP_440462.1_6 Forward -207 -197 1.35667 0.294
NP_442611.1_1 Forward -205 -186 3.53937 0.208
NP_442611.1_1 Reverse -272 -291 -0.688862 0.268
NP_442592.1_3 Reverse -200 -219 11.5042 0.219
NP_442144.1_1 Forward -208 -192 19.2331 0.119
NP_442144.1_1 Reverse -73 -89 13.4315 0.204
NP_440868.1_4 Reverse -192 -204 8.00379 0.0602
NP_440868.1_4 Forward -209 -197 -0.944332 0.284
NP_442479.1_9 Forward -118 -99 -9.14533 0.266
NP_442402.1_4 Reverse -188 -207 -8.85106 0.284
NP_442402.1_10 Reverse -364 -374 12.1726 0.222
NP_441848.1_4 Forward -61 -45 8.60108 0.288
NP_441084.1_6 Reverse -194 -208 17.1007 0.0523
NP_440653.1_10 Reverse -305 -324 10.2259 0.154
NP_442039.1_4 Forward -204 -197 15.1821 0.0124
NP_442039.1_4 Reverse -197 -204 15.1821 0.0124
NP_442679.1_1 Reverse -21 -40 -5.70374 0.296
NP_442679.1_1 Reverse -27 -46 -5.80207 0.298
NP_442409.1_8 Reverse -324 -342 19.4887 0.184
NP_441926.1_3 Forward -346 -330 5.56507 0.17
NP_440825.1_7 Reverse -197 -207 12.9096 0.152
NP_442837.1_3 Forward -204 -197 15.7721 0.0124
NP_442837.1_3 Reverse -197 -204 15.7721 0.0124
NP_442053.1_1 Forward -205 -196 18.3876 0.0007
NP_442053.1_1 Reverse -196 -205 18.3876 0.0007
NP_442053.1_1 Reverse -121 -130 5.21127 0.203
NP_440505.1_3 Reverse -194 -204 17.188 0.00332
NP_440505.1_3 Reverse -119 -129 13.353 0.0331
NP_440505.1_3 Forward -132 -122 11.2881 0.0803
NP_440505.1_3 Forward -207 -197 9.22315 0.122
NP_440505.1_3 Reverse -314 -324 5.28991 0.236
NP_441959.1_5 Forward -298 -279 7.86593 0.26
NP_441102.1_2 Reverse -34 -53 7.66927 0.298
NP_441203.1_1 Forward -204 -185 -13.3736 0.163
NP_441203.1_1 Forward -31 -12 -15.6352 0.236
NP_440013.1_1 Reverse -101 -120 7.07848 0.295
NP_441408.2_7 Reverse -194 -213 -1.7705 0.258
NP_440914.1_1 Reverse -196 -206 17.5935 0.000537
NP_440914.1_1 Forward -205 -195 16.3248 0.00196
NP_440914.1_1 Forward -130 -120 13.7874 0.0256
NP_440914.1_1 Forward -281 -271 10.5669 0.132
NP_441011.1_8 Forward -204 -195 16.6177 0.00602
NP_441011.1_8 Reverse -197 -206 8.25953 0.144
NP_442533.1_1 Reverse -124 -143 -16.4218 0.268
NP_442533.1_6 Forward -205 -196 17.2076 0.00137
NP_442533.1_6 Reverse -196 -205 17.2076 0.00137
NP_442533.1_6 Forward -130 -121 7.96454 0.0838
NP_442533.1_6 Reverse -214 -223 5.11294 0.155
NP_442533.1_6 Forward -338 -329 3.7363 0.204
NP_442533.1_6 Reverse -279 -288 2.26134 0.266
NP_442322.1_4 Reverse -188 -205 -1.43681 0.226
NP_441482.1_7 Reverse -190 -204 16.3225 0.00702
NP_441482.1_7 Forward -211 -197 -0.983719 0.0612
NP_441482.1_7 Reverse -311 -325 -11.4068 0.262
NP_439944.1_9 Reverse -197 -207 10.5014 0.0887
NP_439944.1_9 Forward -204 -194 9.12481 0.1
NP_441028.1_6 Reverse -365 -375 6.37109 0.23
NP_440116.1_5 Forward -208 -191 5.9387 0.172
NP_440116.1_8 Reverse -122 -141 -2.36049 0.13
NP_440116.1_8 Reverse -197 -216 -2.95047 0.144
NP_440115.1_6 Reverse -193 -203 14.0414 0.0615
NP_440115.1_6 Forward -133 -123 5.78156 0.221
NP_440007.1_9 Reverse -192 -206 10.226 0.163
NP_439965.1_1 Forward -239 -220 -8.26035 0.26
NP_441602.1_3 Forward -210 -191 4.81767 0.15
NP_441602.1_3 Reverse -122 -141 -4.81876 0.274
NP_441602.1_4 Reverse -185 -204 11.4058 0.278
NP_441170.1_4 Forward -214 -196 6.01734 0.217
NP_441170.1_4 Forward -392 -374 2.18243 0.285
NP_441972.1_3 Reverse -328 -347 10.9142 0.293
NP_441972.1_5 Reverse -197 -216 17.3057 0.0236
NP_441972.1_5 Forward -222 -203 8.84924 0.0695
NP_441972.1_5 Forward -337 -318 -7.17871 0.244
NP_441106.1_1 Reverse -195 -204 18.486 0.0028
NP_441106.1_1 Forward -206 -197 9.63616 0.0311
NP_439903.1_6 Reverse -193 -212 10.7167 0.102
NP_439903.1_7 Reverse -338 -357 2.55606 0.287
NP_442306.1_10 Reverse -191 -210 -18.6834 0.197
NP_441286.1_1 Forward -206 -194 5.93884 0.0258
NP_441286.1_1 Reverse -195 -207 3.48056 0.0467
NP_440670.1_8 Forward -205 -196 18.3876 0.000699
NP_440670.1_8 Reverse -196 -205 18.3876 0.000699
NP_440670.1_8 Reverse -121 -130 5.40793 0.158
NP_440670.1_8 Reverse -272 -281 5.3096 0.167
NP_440886.1_7 Reverse -195 -205 8.04271 0.0805
NP_440886.1_7 Forward -206 -196 7.94438 0.0805
NP_442614.1_2 Reverse -121 -135 5.70279 0.298
NP_441399.1_6 Forward -136 -117 10.9134 0.295
NP_440767.1_5 Reverse -32 -51 8.84924 0.243
NP_442072.1_9 Reverse -195 -213 -21.712 0.212
NP_442072.1_9 Forward -231 -213 -23.3836 0.292
NP_440513.1_4 Forward -390 -371 8.16093 0.295
NP_441427.1_5 Forward -181 -162 14.9458 0.207
NP_441753.1_10 Reverse -345 -364 2.55606 0.232
NP_440907.2_8 Forward -204 -194 9.616 0.103
NP_440907.2_8 Reverse -197 -207 7.64939 0.117
NP_440907.2_8 Forward -337 -327 7.0594 0.132
NP_441021.1_1 Reverse -197 -216 11.0125 0.0299
NP_441021.1_1 Reverse -179 -198 -12.2919 0.283
NP_440841.1_4 Reverse -194 -213 -9.63698 0.26
NP_442459.1_2 Reverse -165 -184 16.3224 0.123
NP_441463.1_3 Forward -215 -196 -0.4922 0.133
NP_441463.1_6 Reverse -119 -133 8.54187 0.25
NP_441626.1_2 Forward -204 -197 15.7721 0.0124
NP_441626.1_2 Reverse -197 -204 15.7721 0.0124
NP_440107.1_5 Forward -206 -187 0.884433 0.178
NP_442794.1_1 Forward -209 -197 19.1152 0.00716
NP_442794.1_1 Reverse -192 -204 10.5604 0.0721
NP_442615.1_1 Forward -214 -196 -0.472507 0.116
NP_442615.1_1 Reverse -187 -205 -5.38906 0.212
NP_441962.1_4 Forward -374 -355 -9.73531 0.22
NP_441962.1_4 Forward -210 -191 -11.5053 0.241
NP_441962.1_4 Reverse -191 -210 -11.8986 0.248
NP_441742.1_7 Reverse -192 -211 13.2741 0.261
NP_440387.1_1 Reverse -196 -212 14.3165 0.00649
NP_440387.1_1 Forward -205 -189 6.64671 0.0282
NP_441431.1_2 Reverse -193 -207 16.0269 0.04
NP_441488.1_8 Forward -210 -196 10.2254 0.146
NP_441488.1_8 Reverse -191 -205 9.04542 0.169
NP_441836.1_2 Reverse -190 -209 -2.0655 0.224
NP_441836.1_2 Forward -211 -192 -4.6221 0.261
NP_441993.1_1 Forward -211 -192 21.828 0.0133
NP_441993.1_1 Reverse -128 -147 7.4043 0.166
NP_441993.1_1 Forward -205 -186 3.01872 0.244
NP_440935.1_1 Forward -242 -223 14.4541 0.289
NP_442090.1_2 Reverse -253 -272 7.01823 0.281
NP_442323.1_7 Forward -222 -203 4.71854 0.215
NP_442323.1_7 Reverse -191 -210 2.16195 0.271
NP_442323.1_7 Forward -331 -312 1.47364 0.279
NP_440754.1_3 Reverse -134 -152 11.5239 0.262
NP_439988.1_3 Reverse -274 -288 6.29277 0.278
NP_439988.1_3 Forward -384 -370 3.53951 0.298
NP_441237.1_9 Reverse -197 -207 14.828 0.0242
NP_441311.1_2 Reverse -190 -204 12.192 0.236
NP_440643.1_6 Reverse -191 -210 6.88262 0.212
NP_442930.1_1 Forward -52 -42 15.9091 0.19
NP_439910.1_2 Forward -213 -196 -22.2823 0.22
NP_440502.1_3 Forward -290 -280 13.7899 0.292
NP_440457.1_1 Reverse -192 -204 7.70879 0.101
NP_440457.1_1 Reverse -325 -337 5.15219 0.145
NP_441801.1_4 Forward -334 -324 2.83163 0.231
NP_442509.1_9 Forward -338 -328 13.8442 0.0448
NP_442509.1_9 Reverse -196 -206 8.14104 0.192
NP_442509.1_9 Forward -205 -195 8.04271 0.192
NP_442514.1_5 Forward -295 -276 -3.63955 0.231
NP_441440.1_8 Forward -382 -369 20.1771 0.138
NP_440554.1_4 Forward -204 -194 17.9746 0.0131
NP_441885.1_5 Reverse -196 -206 20.9245 0.000538
NP_441885.1_5 Forward -205 -195 11.3864 0.00668
NP_441885.1_5 Reverse -121 -131 1.35667 0.11
NP_441885.1_5 Forward -130 -120 -0.0199663 0.186
NP_440898.1_5 Forward -388 -369 15.3391 0.161
NP_442341.1_7 Reverse -195 -209 8.94771 0.0801
NP_442341.1_7 Forward -206 -192 1.67122 0.282
NP_442341.1_9 Reverse -194 -208 12.6836 0.0984
NP_442341.1_9 Reverse -119 -133 10.717 0.133
NP_442341.1_9 Forward -145 -131 7.76712 0.187
NP_443000.1_7 Reverse -194 -204 20.3345 0.00223
NP_443000.1_7 Forward -207 -197 10.3048 0.0345
NP_443000.1_7 Reverse -119 -129 0.963343 0.278
NP_441842.1_7 Forward -299 -280 18.9765 0.148
NP_440275.1_3 Reverse -194 -204 16.1063 0.0155
NP_440275.1_3 Forward -207 -197 8.04317 0.0602
NP_440275.1_3 Reverse -341 -351 1.94665 0.277
NP_439962.1_4 Reverse -188 -207 -7.57203 0.29
NP_440175.1_7 Forward -221 -203 11.5101 0.23
NP_442495.1_4 Forward -201 -191 14.4347 0.16
NP_440149.1_8 Reverse -121 -140 5.30933 0.0746
NP_440149.1_8 Reverse -196 -215 0.687771 0.134
NP_440149.1_8 Forward -205 -186 -2.16383 0.166
NP_441875.1_10 Reverse -368 -382 19.9608 0.167
NP_441105.1_3 Reverse -185 -204 9.0459 0.0472
NP_441105.1_3 Forward -216 -197 -4.13045 0.192
NP_440216.1_1 Forward -205 -191 7.27608 0.00942
NP_440216.1_1 Reverse -196 -210 -10.6202 0.145
NP_440216.1_1 Reverse -121 -135 -11.0135 0.159
NP_440216.1_1 Reverse -272 -286 -11.9968 0.236
NP_440216.1_1 Forward -130 -116 -12.4884 0.274
NP_440216.1_9 Reverse -19 -28 7.37455 0.286
NP_440047.1_3 Forward -300 -281 -0.295539 0.296
NP_440172.1_1 Forward -205 -195 17.5813 0.00421
NP_440172.1_1 Reverse -196 -206 15.0247 0.00945
NP_440172.1_1 Forward -130 -120 5.09324 0.153
NP_440172.1_1 Reverse -121 -131 2.24165 0.279
NP_442371.1_1 Forward -55 -45 11.8776 0.273
NP_442015.1_10 Reverse -192 -205 13.4906 0.0354
NP_442015.1_10 Forward -209 -196 11.229 0.0372
NP_442015.1_10 Forward -330 -317 0.0192843 0.245
NP_441045.1_6 Reverse -198 -216 14.473 0.295
NP_441226.1_7 Forward -204 -197 14.4934 0.0123
NP_441226.1_7 Reverse -197 -204 14.4934 0.0123
NP_441111.1_7 Forward -204 -196 18.7023 0.00294
NP_441111.1_7 Reverse -197 -205 18.7023 0.00294
NP_441766.1_2 Forward -205 -196 17.5026 0.00297
NP_441766.1_2 Reverse -196 -205 17.5026 0.00297
NP_442417.1_5 Forward -205 -191 6.98109 0.197
NP_440416.1_1 Reverse -329 -348 -10.3253 0.272
NP_440416.1_9 Forward -212 -193 -7.76869 0.106
NP_440416.1_9 Reverse -189 -208 -12.7836 0.16
NP_440416.1_9 Reverse -343 -362 -13.8652 0.171
NP_440416.1_9 Forward -333 -314 -14.8485 0.18
NP_440416.1_9 Forward -137 -118 -18.7818 0.264
NP_440416.1_9 Reverse -201 -220 -19.8634 0.279
NP_440261.1_5 Forward -204 -191 -2.73398 0.0924
NP_440988.1_4 Reverse -148 -167 13.0775 0.185
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAACCACACCTCCATTCGGGCCGCTTCGGGGGGAAACTGCCACCGTTGTCCGGCCGTAACGGGCTGATCCCCCCAGGGAACTCCCTGGTCCAAAACCTGTTGAGAAACGTCTGGCCCCAGCCAAACGCCATTTTTTTGAATATAAAAAGGGCTTACTTGATATTTGGTTTGGTTATCGTCGCTGGCCAATGCTTTGGCGATCGCCTGGGCGGATTTGATCGAGACTTCATGCTCCCCAGAACACCCACCAAATAACAGCCCCACACGCATGGCAATCCCCTGAAAAATTAAGCTTAGATCGGTTTATCTCGCATAGCCTATCACAAAAGTTTAAGCTGTCAGTTACAGAAAAAATTCCCCTTTTTGTGCTTAATTGCCTTGGTGCGTCCCACTGTTATCT

CDS

ATGCCCATGTCCCCCTTGCCCCCTGCCGTTGGCCTGATCTGTAAACGTTTGGCGATCGCCGTCATCACCTTGTTGGGCATTAGTTTAGTGATTTTTAGTTTGTTAGCCCTCGCCCCGGGCAATCCTTTGGGGGAATTGGCCACTAACCCCTCCATTTCCCAGGAAGTGCGGGACAATTTGCGCCGCAGTTTGGGGCTGGACCAAGCGTTACCCATCCGTTACCTAAAATGGTTATGGAGTCTTTTGCAGGGGGATTTGGGTTATTCCTTCACCAGCCGTAGTCCCGTAATTGATTTGATTGGTCAAAGGCTACCGACAACGTTGTGGTTAATGGGCACGGCCTACCTGATCAGTTTGGCGATCGCCATTCCTTTGGGAGTGACAGCGGCATTGTACCGGGGACGGTGGTGGGAACCGTTAATCAGTGGCATCAGTTTAATGGGCTTTTCCCTGCCCACTTTTTTGACCGGGTTACTGTTCATCCTAATTTTTAGTGTGCAGTTGAGGTGGTTACCCTTCATTTACGACAGCACTCTGACGGTGGATAGCATGGCTAGTTTGGGAACCCAAATCCGTCAACTATTGATGCCAGTGGGGGTGTTAGTGTTCTATCAATCGGCGGTAATTCTACGCTTTGTCCGTTCCGCCGCGTTGGAAGAGTTGCCCCAAAATTACATTCGCACCGCCTATGCCAAAGGTTTAGGCACCTGGGGAATGTTGAAAAACCATCTTTTAAAAAATGCTTCTTTGCCCCTAATCACCCTTATTGCCCTGGATGTACCCACCATTTTCACCGGAGCTTTAGTAACTGAGCAGGTTTTCCGAGTACCAGGCATTGGAGCTTTGTTAATTGAATCCATTTATCGCAGTGACACCCCCGTGGTGATGGCGGTCACTTTTCTTTATGCCGTTTTAATTGTCTTTTTCAGTAGTTTGGCGGATTTGATTTACCAACTGGTGGACCCCCGCATTCGTTGGTAA

Protein

MPMSPLPPAVGLICKRLAIAVITLLGISLVIFSLLALAPGNPLGELATNPSISQEVRDNLRRSLGLDQALPIRYLKWLWSLLQGDLGYSFTSRSPVIDLIGQRLPTTLWLMGTAYLISLAIAIPLGVTAALYRGRWWEPLISGISLMGFSLPTFLTGLLFILIFSVQLRWLPFIYDSTLTVDSMASLGTQIRQLLMPVGVLVFYQSAVILRFVRSAALEELPQNYIRTAYAKGLGTWGMLKNHLLKNASLPLITLIALDVPTIFTGALVTEQVFRVPGIGALLIESIYRSDTPVVMAVTFLYAVLIVFFSSLADLIYQLVDPRIRW