Your browser is old and dusty. Try Google Chrome!

Details for sll1758

ORF sll1758
Accession NP_441013.1
Symbol
Category Other
Definition MrsA protein homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -222 -236 -1.18038 0.252
NP_440226.1_1 Reverse -306 -325 1.96607 0.282
NP_442655.1_10 Reverse -326 -345 -19.1751 0.282
NP_443002.1_5 Forward -323 -305 10.4414 0.256
NP_442173.1_1 Reverse -274 -282 7.8859 0.134
NP_440074.1_6 Reverse -162 -181 9.7334 0.27
NP_441225.1_1 Reverse -308 -327 7.47261 0.0498
NP_442909.1_7 Forward -215 -201 6.68548 0.242
NP_441054.1_2 Forward -343 -324 9.93088 0.284
NP_440878.1_9 Reverse -305 -324 0.884433 0.187
NP_440761.1_9 Forward -162 -143 12.6841 0.195
NP_441859.1_3 Reverse -236 -255 4.71854 0.215
NP_440044.1_8 Reverse -95 -114 0.491109 0.197
NP_442359.1_5 Reverse -70 -89 11.7008 0.26
NP_441935.1_2 Forward -118 -99 -4.42544 0.27
NP_440893.1_3 Reverse -226 -245 -0.197979 0.28
NP_441208.1_9 Forward -46 -32 5.70279 0.262
NP_441594.1_6 Forward -302 -283 3.34271 0.231
NP_442110.1_7 Forward -350 -336 2.35953 0.222
NP_440856.1_7 Reverse -74 -93 -1.67217 0.182
NP_442827.1_8 Reverse -229 -248 0.490334 0.206
NP_441434.1_7 Reverse -308 -322 2.85119 0.268
NP_441770.1_4 Forward -271 -252 -0.787193 0.184
NP_441025.1_6 Reverse -116 -135 3.92987 0.237
NP_441716.1_1 Reverse -347 -361 6.48943 0.198
NP_441598.1_3 Reverse -243 -262 12.0919 0.277
NP_441624.1_7 Reverse -171 -185 8.25939 0.24
NP_440438.2_8 Reverse -114 -133 1.0811 0.282
NP_442801.1_5 Forward -36 -19 16.1643 0.116
NP_440747.1_1 Reverse -255 -273 8.57394 0.246
NP_442973.1_5 Reverse -186 -205 9.93088 0.287
NP_442973.1_8 Reverse -303 -321 17.7187 0.179
NP_440944.1_2 Reverse -47 -66 -3.04881 0.282
NP_443017.1_1 Forward -131 -112 14.8375 0.274
NP_441014.1_8 Forward -349 -330 -2.0655 0.231
NP_442848.1_9 Forward -355 -336 5.11266 0.202
NP_443018.1_3 Reverse -196 -203 4.36568 0.254
NP_443018.1_3 Forward -203 -196 4.07068 0.299
NP_440376.1_1 Reverse -315 -324 2.16301 0.233
NP_442687.1_7 Reverse -89 -99 3.61828 0.299
NP_441077.1_6 Forward -156 -140 4.34438 0.255
NP_440066.1_5 Reverse -209 -228 7.96345 0.256
NP_442485.1_3 Forward -215 -196 1.27776 0.23
NP_440642.1_10 Reverse -8 -22 2.35894 0.277
NP_441013.1_1 Forward -28 -10 22.1436 0.045
NP_441013.1_3 Forward -248 -229 16.3224 0.201
NP_441013.1_7 Forward -353 -334 24.2863 0.0124
NP_442658.1_1 Reverse -193 -203 11.1893 0.0915
NP_442658.1_1 Forward -317 -307 5.28945 0.274
NP_441855.2_4 Forward -323 -304 9.71588 0.275
NP_442782.1_2 Reverse -195 -209 9.2427 0.198
NP_441414.1_2 Reverse -210 -229 9.63589 0.264
NP_440180.1_1 Reverse -193 -212 17.2074 0.179
NP_442486.1_6 Forward -222 -203 -5.60541 0.279
NP_439905.1_2 Reverse -222 -236 16.4209 0.188
NP_439905.1_2 Forward -215 -201 9.63603 0.23
NP_440984.1_7 Forward -214 -200 9.14437 0.131
NP_441162.1_3 Reverse -99 -118 9.53756 0.24
NP_441580.1_6 Reverse -295 -314 -0.590531 0.168
NP_440934.1_4 Forward -54 -35 10.6192 0.187
NP_443044.1_1 Forward -357 -338 8.16093 0.233
NP_441099.1_5 Forward -220 -201 -11.2103 0.273
NP_442002.1_1 Forward -239 -221 -8.73231 0.27
NP_442002.1_9 Forward -337 -330 12.2322 0.185
NP_440809.1_2 Reverse -325 -344 -3.93378 0.283
NP_440879.1_6 Reverse -268 -287 3.04771 0.231
NP_440377.1_1 Reverse -128 -145 13.5929 0.231
NP_441000.1_6 Forward -205 -191 -3.147 0.221
NP_442771.1_4 Reverse -178 -192 19.8624 0.23
NP_440465.1_10 Reverse -197 -216 -1.08219 0.29
NP_441041.1_4 Reverse -201 -220 -10.227 0.228
NP_439966.1_7 Forward -317 -307 4.60114 0.265
NP_439966.1_9 Forward -317 -308 9.93116 0.186
NP_441514.1_1 Forward -14 -4 14.2496 0.274
NP_442281.1_1 Reverse -259 -273 2.45727 0.266
NP_442575.1_8 Reverse -328 -347 -6.78538 0.286
NP_440647.1_9 Reverse -205 -223 6.01734 0.228
NP_442068.1_4 Reverse -291 -310 7.86512 0.23
NP_442177.1_5 Reverse -77 -91 13.9626 0.22
NP_442029.1_6 Forward -88 -69 5.40766 0.25
NP_442554.1_9 Forward -276 -257 12.4065 0.279
NP_441762.1_7 Reverse -305 -317 5.74217 0.0331
NP_442142.1_4 Reverse -260 -273 3.16532 0.265
NP_441024.1_6 Forward -200 -181 9.97848 0.219
NP_443009.1_3 Reverse -216 -234 18.5054 0.275
NP_443009.1_6 Reverse -304 -323 28.5154 0.0000204
NP_443009.1_7 Reverse -348 -367 23.5006 0.0128
NP_443009.1_8 Reverse -284 -303 18.7807 0.0619
NP_443009.1_9 Reverse -324 -343 14.2574 0.0431
NP_440183.1_9 Reverse -193 -212 -20.3551 0.282
NP_441468.1_1 Reverse -196 -203 4.36568 0.237
NP_441015.1_1 Reverse -169 -187 30.9934 0.000109
NP_441015.1_2 Reverse -193 -212 33.2353 0.00000788
NP_441015.1_3 Reverse -300 -319 34.5136 0.0000162
NP_441015.1_4 Reverse -330 -349 31.662 0.000107
NP_441015.1_5 Reverse -222 -241 29.9904 0.000183
NP_441015.1_6 Reverse -276 -295 35.5953 0.00000168
NP_441015.1_7 Reverse -357 -376 28.5154 0.000539
NP_441015.1_8 Reverse -243 -262 16.7157 0.105
NP_441172.1_1 Forward -213 -195 1.10079 0.282
NP_441330.1_1 Forward -341 -322 -8.16202 0.183
NP_442719.1_2 Reverse -119 -137 -6.37307 0.225
NP_442677.1_5 Forward -228 -209 13.7658 0.251
NP_441612.1_2 Reverse -254 -264 8.74291 0.21
NP_440789.1_8 Forward -326 -307 15.5357 0.197
NP_442427.1_8 Forward -136 -117 6.98095 0.224
NP_442808.1_1 Forward -97 -87 1.15957 0.292
NP_441315.1_2 Reverse -185 -203 15.0845 0.245
NP_440038.1_5 Forward -291 -272 16.8141 0.209
NP_440558.1_2 Forward -359 -340 0.491109 0.19
NP_440558.1_2 Forward -213 -194 -2.75381 0.229
NP_440558.1_2 Forward -303 -284 -7.37537 0.293
NP_440558.1_8 Forward -321 -302 18.289 0.0827
NP_442593.1_6 Forward -242 -223 16.5608 0.279
NP_442503.1_9 Reverse -314 -333 6.68596 0.272
NP_442066.2_4 Forward -315 -296 -0.39387 0.173
NP_442777.1_3 Forward -223 -205 0.116744 0.297
NP_442419.1_2 Reverse -301 -320 10.3242 0.122
NP_440084.1_8 Reverse -140 -154 15.1948 0.18
NP_441739.1_2 Reverse -127 -143 3.59778 0.264
NP_440101.1_10 Forward -215 -196 3.44104 0.236
NP_440356.1_10 Forward -363 -345 11.5239 0.253
NP_441574.1_1 Forward -327 -308 6.4893 0.112
NP_440276.1_8 Reverse -72 -91 7.07928 0.274
NP_442645.1_2 Reverse -198 -217 -22.5183 0.291
NP_441633.1_3 Reverse -235 -248 13.9823 0.018
NP_442590.1_10 Reverse -267 -286 5.60432 0.258
NP_442998.1_5 Reverse -125 -135 10.2065 0.222
NP_440899.1_1 Forward -215 -196 6.16283 0.287
NP_440299.1_1 Reverse -265 -278 2.67367 0.279
NP_441799.1_1 Forward -208 -194 9.34041 0.0942
NP_442852.1_2 Reverse -297 -316 20.354 0.0524
NP_441559.1_8 Reverse -232 -246 -3.04867 0.197
NP_440915.1_6 Reverse -357 -371 -0.295402 0.189
NP_440915.1_6 Forward -87 -73 -0.688726 0.205
NP_441704.1_8 Forward -94 -75 6.58682 0.258
NP_442452.1_8 Forward -89 -75 11.602 0.273
NP_441494.1_6 Reverse -356 -369 9.36073 0.227
NP_442386.1_9 Reverse -194 -203 10.324 0.132
NP_441750.1_4 Forward -216 -197 3.14605 0.233
NP_441340.1_5 Forward -203 -196 3.97235 0.274
NP_442791.1_5 Forward -49 -30 -10.1286 0.279
NP_441160.1_1 Reverse -353 -372 -11.3086 0.292
NP_440586.1_8 Reverse -196 -203 5.8403 0.283
NP_442251.1_6 Reverse -307 -314 8.69224 0.199
NP_442959.1_5 Reverse -126 -145 8.55425 0.224
NP_440027.1_3 Reverse -236 -254 5.32826 0.245
NP_439937.1_9 Reverse -313 -330 -2.61678 0.152
NP_442294.1_3 Forward -269 -255 13.7653 0.252
NP_441595.1_2 Reverse -52 -65 9.99293 0.277
NP_441595.1_2 Forward -19 -6 8.75154 0.28
NP_441167.1_1 Reverse -112 -131 8.06259 0.213
NP_440819.1_5 Reverse -254 -262 17.424 0.185
NP_440316.1_10 Forward -237 -227 6.96153 0.251
NP_441803.1_2 Forward -254 -235 0.786102 0.244
NP_441803.1_2 Forward -332 -313 -0.000545616 0.263
NP_439977.1_5 Reverse -215 -234 0.294447 0.211
NP_439977.1_5 Forward -216 -197 -1.67217 0.257
NP_441572.1_1 Forward -275 -256 -3.54046 0.212
NP_442790.1_4 Reverse -306 -325 -1.57384 0.104
NP_442790.1_4 Reverse -186 -205 -14.0619 0.271
NP_442244.1_6 Reverse -213 -232 10.8159 0.225
NP_442244.1_7 Reverse -67 -86 13.2741 0.214
NP_440531.1_8 Forward -174 -155 4.42435 0.269
YP_680420.1_4 Reverse -378 -397 18.584 0.299
NP_440888.1_2 Reverse -221 -235 9.53707 0.123
NP_440803.1_3 Forward -86 -67 5.70265 0.23
NP_440803.1_8 Forward -338 -319 13.7658 0.238
NP_442077.1_8 Forward -275 -256 11.7983 0.26
NP_441543.1_2 Forward -314 -305 4.52295 0.234
NP_440208.1_1 Forward -286 -267 -10.522 0.257
NP_441304.1_10 Reverse -344 -353 14.356 0.175
NP_442710.1_8 Forward -237 -218 17.0107 0.248
NP_441469.1_8 Reverse -194 -203 5.89959 0.246
NP_442337.1_8 Reverse -69 -88 -1.27885 0.28
NP_442204.1_1 Reverse -245 -256 0.353664 0.281
NP_440255.1_5 Forward -19 -5 17.2002 0.211
NP_442428.1_5 Reverse -196 -203 4.759 0.223
NP_440783.1_5 Reverse -297 -316 -4.32711 0.276
NP_441443.1_1 Reverse -338 -357 -5.11376 0.297
NP_441443.1_2 Forward -217 -198 -5.40875 0.29
NP_441443.1_7 Reverse -344 -363 14.4541 0.0924
NP_442120.1_10 Reverse -309 -328 -16.1268 0.296
NP_440673.1_2 Reverse -296 -315 10.0969 0.224
NP_440673.1_3 Reverse -308 -315 10.4622 0.139
NP_440865.1_9 Reverse -341 -360 -3.54046 0.194
NP_442219.1_8 Reverse -108 -127 6.42771 0.298
NP_441884.1_8 Forward -316 -297 -5.01543 0.172
NP_441884.1_9 Forward -353 -334 -20.8467 0.211
NP_440689.1_7 Reverse -311 -329 14.2763 0.3
NP_440222.1_6 Reverse -374 -387 20.5705 0.0977
NP_441719.1_4 Forward -314 -307 3.77569 0.285
NP_441733.1_10 Forward -318 -305 4.34585 0.266
NP_441004.1_1 Reverse -329 -348 -16.6185 0.286
NP_441004.1_1 Forward -89 -70 -17.8968 0.295
NP_441004.1_5 Forward -249 -235 10.816 0.241
NP_442139.1_7 Forward -241 -222 7.27595 0.287
NP_440129.1_10 Reverse -242 -256 4.12949 0.185
NP_442694.1_9 Reverse -153 -172 11.7992 0.207
NP_441542.1_4 Forward -362 -348 5.60446 0.264
NP_442709.1_3 Forward -376 -357 25.3688 0.0063
NP_442843.1_1 Reverse -341 -360 -3.83545 0.23
NP_442843.1_1 Reverse -265 -284 -11.8003 0.293
NP_440431.1_3 Reverse -175 -194 -6.78538 0.195
NP_441031.1_1 Reverse -110 -129 9.61851 0.212
NP_442006.1_2 Forward -324 -307 -16.7758 0.264
NP_440483.1_1 Reverse -334 -353 -5.80207 0.234
NP_441663.1_8 Reverse -354 -373 9.3409 0.0868
NP_442348.1_2 Forward -137 -128 7.17789 0.285
NP_442348.1_2 Forward -173 -164 6.5879 0.299
NP_440707.1_9 Reverse -336 -355 0.294447 0.293
NP_442443.1_1 Reverse -354 -373 5.89931 0.157
NP_442320.1_8 Reverse -300 -314 -5.11362 0.206
NP_442320.1_8 Forward -288 -274 -6.58858 0.296
NP_441057.1_4 Reverse -346 -364 -2.53746 0.274
NP_442079.1_7 Reverse -307 -326 5.70265 0.17
NP_442749.1_5 Reverse -129 -146 6.58478 0.298
NP_440708.1_6 Forward -364 -345 -10.3253 0.278
NP_441856.1_8 Reverse -220 -239 14.1591 0.215
NP_440025.1_4 Forward -366 -347 12.5858 0.233
NP_440831.1_3 Forward -366 -347 8.81407 0.221
NP_440459.1_2 Forward -218 -201 7.41366 0.291
NP_441653.1_2 Reverse -196 -215 3.14308 0.274
NP_442137.1_1 Reverse -212 -231 17.7974 0.0601
NP_442603.1_9 Reverse -193 -211 15.5554 0.173
NP_442603.1_9 Forward -363 -345 6.70565 0.279
NP_440946.1_6 Forward -326 -307 2.75272 0.294
NP_441047.1_1 Reverse -298 -317 0.392778 0.269
NP_441329.1_6 Forward -27 -8 -2.14899 0.293
NP_442162.1_9 Reverse -274 -281 5.93897 0.214
NP_440224.1_4 Forward -279 -260 1.57275 0.244
NP_440875.1_9 Forward -202 -192 7.59334 0.255
NP_442547.1_7 Reverse -233 -252 13.9211 0.177
NP_441813.1_5 Reverse -193 -203 -0.511621 0.247
NP_440590.1_4 Reverse -264 -277 0.412608 0.157
NP_441239.1_9 Reverse -198 -210 3.18557 0.292
NP_440665.1_2 Forward -92 -73 -4.72043 0.246
NP_442044.1_1 Reverse -249 -268 -14.4552 0.291
NP_442643.1_5 Reverse -276 -295 -6.09707 0.293
NP_442629.1_3 Forward -319 -300 5.11266 0.272
NP_440354.1_7 Reverse -300 -318 5.72234 0.297
NP_440462.1_6 Forward -317 -307 4.0116 0.219
NP_441848.1_7 Reverse -15 -34 -1.57461 0.253
NP_440653.1_5 Forward -323 -304 7.17762 0.271
NP_439942.1_5 Forward -154 -140 18.4416 0.173
NP_440696.1_3 Reverse -280 -298 -2.14413 0.274
NP_442380.1_10 Forward -244 -226 10.8356 0.242
NP_441926.1_3 Forward -272 -256 2.8118 0.256
NP_441102.1_2 Forward -145 -126 12.8808 0.159
NP_440914.1_1 Forward -299 -289 6.66328 0.269
NP_441011.1_8 Reverse -196 -205 7.96454 0.163
NP_440037.1_2 Reverse -36 -55 15.6341 0.186
NP_442533.1_6 Forward -209 -200 4.42462 0.179
NP_442533.1_6 Forward -370 -361 2.85133 0.236
NP_440661.1_6 Forward -108 -89 1.86774 0.279
NP_442541.1_10 Forward -350 -336 2.16228 0.265
NP_442541.1_10 Reverse -290 -304 2.06395 0.269
NP_442322.1_4 Reverse -376 -393 -4.38673 0.259
NP_442322.1_4 Reverse -213 -230 -9.30325 0.29
NP_442202.1_10 Reverse -226 -240 13.8643 0.222
NP_442664.1_3 Reverse -386 -400 17.6992 0.223
NP_440116.1_8 Reverse -238 -257 -6.98204 0.22
NP_440903.1_1 Forward -21 -11 18.2696 0.14
NP_441170.1_3 Reverse -85 -104 13.7658 0.0632
NP_441972.1_5 Reverse -64 -83 -1.47551 0.177
NP_441106.1_3 Reverse -112 -131 12.3892 0.217
NP_441825.1_4 Forward -389 -379 15.713 0.195
NP_442306.1_10 Forward -329 -310 -20.5517 0.213
NP_440886.1_7 Forward -348 -338 4.7978 0.218
NP_440828.1_1 Reverse -265 -284 2.6536 0.231
NP_441399.1_6 Forward -102 -83 13.3716 0.185
NP_440513.1_4 Reverse -348 -367 7.7676 0.295
NP_441808.1_8 Forward -317 -298 11.3075 0.222
NP_441021.1_1 Forward -215 -196 -6.68705 0.18
NP_442221.1_6 Reverse -363 -380 14.4935 0.177
NP_441962.1_4 Reverse -356 -375 -13.7669 0.277
NP_441431.1_2 Reverse -270 -284 10.0287 0.17
NP_441993.1_1 Reverse -213 -232 3.11618 0.241
NP_441174.1_1 Forward -238 -223 11.7796 0.247
NP_440114.1_10 Forward -356 -342 9.34103 0.177
NP_441425.1_3 Forward -145 -135 16.4996 0.273
NP_442323.1_7 Reverse -69 -88 8.25844 0.163
NP_442323.1_7 Reverse -274 -293 5.99684 0.201
NP_440766.1_5 Forward -18 -6 6.50989 0.299
NP_439988.1_3 Forward -184 -170 5.80112 0.278
NP_439988.1_3 Reverse -310 -324 4.03116 0.296
NP_441531.1_7 Reverse -328 -347 14.3558 0.272
NP_440457.1_1 Reverse -356 -368 0.530633 0.25
NP_441332.1_6 Reverse -226 -236 12.8085 0.209
NP_441332.1_6 Reverse -170 -180 10.8723 0.282
NP_442509.1_9 Reverse -360 -370 12.5659 0.0871
YP_003858595.1_7 Forward -27 -9 11.5239 0.151
NP_442514.1_5 Forward -350 -331 -3.14789 0.222
NP_440554.1_4 Forward -203 -193 5.28991 0.153
NP_441173.1_9 Forward -131 -123 11.8187 0.222
NP_441307.1_4 Reverse -271 -290 -1.08219 0.273
NP_442638.1_2 Forward -185 -166 16.8141 0.0728
NP_439962.1_4 Reverse -298 -317 0.294447 0.197
NP_439962.1_4 Forward -323 -304 -7.4737 0.289
NP_441105.1_3 Forward -355 -336 -7.4737 0.254
NP_441105.1_3 Reverse -165 -184 -9.24366 0.286
NP_440172.1_1 Reverse -207 -217 3.02829 0.251
NP_440198.1_3 Forward -353 -334 14.2566 0.277
NP_441766.1_8 Forward -102 -83 21.7125 0.0544
NP_440416.1_9 Forward -211 -192 -15.7335 0.198
NP_443052.1_9 Forward -372 -353 -2.85214 0.242
NP_443052.1_9 Reverse -298 -317 -5.31042 0.266
NP_441940.1_4 Forward -372 -353 8.35759 0.266
NP_440591.1_9 Reverse -188 -206 4.54237 0.275
NP_440988.1_10 Forward -307 -293 4.99564 0.247
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAACCCTAGGCAGGGCTTTTCTGTAAATCAGGCCGTTCCTCCGGCAGAATGGCCCCTTCCACCGGGCAAACTTGGAGGCAGATGCCGCAATCGATGCAGGTGGCAAAGTCAATCCAGTACCAATCGGTGCCAATGGTGTTTTTCCCGTCTCCGGGGTGAATGCAGGCTACGGGGCAGGCTTCAACGCAGTCGGCCACGCCTTCGCAGGTTTCCGTAACAATGGTATGGGGCATATTTCGCCGGAATCAGAATTTAAAAATTGGGCGGATTTTTACAAATCGTCACAGTTCTAAGGGTAGCGGACGTTCAACCCCTGAGGCAATCCAGTGGGGCGTGATTTACCTGAAATTTCCCGGAGCAGTTATCCTGAGAGGAAGAATTGTGTGAGGAAAATTTTCAG

CDS

ATGGTTGCTTCCCCCATCCACAGTCGTGGTTTAGATCTGCCTTTGCCGTCAACGATGGGAGAATTCGGCTTGAGCTTGCCCCGATCGCCATTGTTTGGCACGGACGGTATCCGGGGTAAGGCTGGGGAATTGTTGACGGCTCCTTTGGCTTTATCCTTGGGCTTTTGGGCGGGGCAGGTATTACGGGAACAAACTGATACTGCTGGACCAGTGATTATCGGCCAGGATTCCCGACTTTCCAGTGACATGCTAGCCAACGCCATGGCCGCCGGTTTGAACAGTGCCGGGGTAGAGGTGTGGCAACTCGGACTTTGTCCGACTCCCTGTGTGGCCTATCTCACCAGAAAAACAGCGGCAATCGGGGGCATTATGATTTCCGCTAGCCATAATCCGCCGGAAGACAATGGCATCAAGTTTTTTGATCACCAAGGGCTAAAATTACCCAAATCCCTAGCCACGGCGATCGAAGCAGGACTGCGGGGACAAAATCAAACCTCCGGGCTGAATGCCAGTCAATGGGGAAGGAGTTATGGCCAGCCCCATCGTGTCCAATATTACCAAGATTTTTTGCTAGGTAGTTTGCCCCAACCCTTGAATTTTCAAGGGCTAAAAGTGGTGTTGGATCTAGCCTGGGGAGCTTCGGTCAATTTGGCACCCCATATTTTTCGCAGTTTGGGAGCGGAGGTCATAGCTCTGCACGATTTGGCCGATGGCAGTCAAATTAACGTTGATTGCGGCTCCACCCATTTACATCGTTTGCAAAGGGCTGTGCGGGAAACCGGGGCGGATTTAGGTTTTGCCTTTGACGGCGATGCAGACCGGGTGATGGCGGTGGATGCCCAGGGCCGCCCGGTGGACGGAGATTACATTCTCTTTTTATGGGGCAAAACTCTCCAGGAGAGCAACCATCTGCCCGATAACCTAATTGTCGGCACTGTCATGGCCAACTTAGCCTTTGAGCGAGCTTGGGAAAAACTGGGGGGTAAATTAATTCGCACTGCGGTGGGGGACCAAAACGTCCAAGCCCAAATGTGGGAAACCGGAGCCATGCTAGGGGGAGAACAGTCAGGACACATTATTTGCCACCACCACAGTTATTCCGGGGATGGCCTGCAGGCGGCCTTGCATTTAGCCACCCTAGTGCAAAAGTCCGGTTTATCTTTGAGCGAACTGCTGTCGGAAAGTTTCCAACCCTATCCCCAAATTCTCCGCAACGTCAGGGTACTAGACCGGGAGCGCCGCTTACATTGGCAAGAATGCGCCCCTTTGCAACAGGCGATCGCCACGGCGGAAAAGTCCATGGGCACCACCGGAAGAATTTTAGTGCGGGCTTCGGGCACAGAACCATTAATTCGGGTCATGGTGGAGGCGGCCTGTGCGGAGACGGCGGCCCATTGGTCGGACCAACTCACCAGCACTGTGCAATGCCATTTGGGGGATAGTTAA

Protein

MVASPIHSRGLDLPLPSTMGEFGLSLPRSPLFGTDGIRGKAGELLTAPLALSLGFWAGQVLREQTDTAGPVIIGQDSRLSSDMLANAMAAGLNSAGVEVWQLGLCPTPCVAYLTRKTAAIGGIMISASHNPPEDNGIKFFDHQGLKLPKSLATAIEAGLRGQNQTSGLNASQWGRSYGQPHRVQYYQDFLLGSLPQPLNFQGLKVVLDLAWGASVNLAPHIFRSLGAEVIALHDLADGSQINVDCGSTHLHRLQRAVRETGADLGFAFDGDADRVMAVDAQGRPVDGDYILFLWGKTLQESNHLPDNLIVGTVMANLAFERAWEKLGGKLIRTAVGDQNVQAQMWETGAMLGGEQSGHIICHHHSYSGDGLQAALHLATLVQKSGLSLSELLSESFQPYPQILRNVRVLDRERRLHWQECAPLQQAIATAEKSMGTTGRILVRASGTEPLIRVMVEAACAETAAHWSDQLTSTVQCHLGDS