Your browser is old and dusty. Try Google Chrome!

Details for sll1757

ORF sll1757
Accession NP_441017.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -246 -232 21.6324 0.00612
NP_441061.1_2 Reverse -239 -253 12.3893 0.0468
NP_440795.1_7 Forward -246 -239 14.6904 0.0123
NP_440795.1_7 Reverse -239 -246 14.6904 0.0123
NP_442100.1_4 Reverse -169 -188 14.2566 0.227
NP_441418.1_6 Reverse -238 -257 -10.0303 0.031
NP_441418.1_6 Forward -247 -228 -11.0136 0.043
NP_441418.1_6 Forward -343 -324 -28.2215 0.203
NP_442291.1_5 Reverse -237 -253 11.5633 0.0388
NP_442291.1_5 Forward -248 -232 0.943514 0.155
NP_440897.1_6 Forward -187 -168 -2.95123 0.227
NP_441453.1_4 Reverse -238 -246 16.539 0.00633
NP_441453.1_4 Forward -247 -239 16.539 0.00633
NP_442151.1_6 Forward -247 -233 11.8976 0.0886
NP_442151.1_6 Reverse -134 -148 11.7993 0.091
NP_442151.1_6 Reverse -238 -252 10.6193 0.119
NP_441818.1_1 Reverse -239 -250 18.8393 0.00301
NP_441818.1_1 Forward -317 -306 9.69459 0.232
NP_441818.1_9 Forward -343 -324 20.1573 0.0247
NP_441818.1_9 Forward -173 -154 -7.08038 0.268
NP_441818.1_9 Forward -187 -168 -9.93197 0.291
NP_440226.1_1 Reverse -238 -257 10.8159 0.0588
NP_441465.1_8 Forward -258 -240 12.0155 0.184
NP_442744.1_8 Reverse -207 -226 -6.78538 0.297
NP_442173.1_1 Forward -246 -238 15.4574 0.00633
NP_442173.1_1 Reverse -239 -247 15.4574 0.00633
NP_442752.1_4 Forward -247 -240 13.8055 0.0199
NP_442752.1_4 Reverse -238 -245 13.8055 0.0199
NP_442752.1_4 Forward -187 -180 12.1338 0.0546
NP_442752.1_4 Forward -156 -149 6.52896 0.154
NP_443027.1_4 Forward -249 -239 14.0414 0.0452
NP_443027.1_4 Reverse -236 -246 13.1564 0.0521
NP_441745.1_5 Reverse -209 -228 7.07928 0.27
NP_442975.1_10 Forward -251 -237 13.4703 0.0459
NP_442975.1_10 Reverse -234 -248 3.93223 0.249
NP_442975.1_10 Reverse -198 -212 2.5556 0.273
NP_440784.1_7 Forward -246 -239 15.9687 0.0123
NP_440784.1_7 Reverse -239 -246 15.9687 0.0123
NP_442909.1_7 Reverse -239 -253 12.9786 0.128
NP_442909.1_7 Forward -246 -232 8.84875 0.161
NP_441934.1_10 Forward -277 -263 21.0424 0.0409
NP_440061.1_9 Forward -249 -235 19.0751 0.00659
NP_440110.1_4 Reverse -227 -246 2.45773 0.253
NP_440110.1_8 Forward -172 -153 2.3594 0.211
NP_442062.1_8 Forward -247 -237 17.3846 0.00193
NP_442062.1_8 Reverse -238 -248 17.3846 0.00193
NP_442062.1_8 Reverse -134 -144 3.12662 0.285
NP_441900.1_2 Reverse -315 -333 -3.42315 0.279
NP_441859.1_3 Forward -248 -229 9.24175 0.13
NP_440304.1_4 Forward -249 -239 10.8948 0.051
NP_440304.1_4 Reverse -236 -246 9.91146 0.051
NP_440304.1_4 Forward -145 -135 5.97822 0.185
NP_442242.1_4 Forward -246 -239 14.3954 0.0124
NP_442242.1_4 Reverse -239 -246 14.3954 0.0124
NP_440044.1_8 Reverse -239 -258 6.58763 0.0891
NP_440916.1_1 Reverse -176 -190 8.55439 0.267
NP_439918.1_2 Reverse -270 -289 -4.03212 0.265
NP_441200.1_4 Forward -23 -4 6.4893 0.276
NP_441208.1_9 Reverse -235 -249 7.07942 0.227
NP_441594.1_6 Forward -256 -237 1.96607 0.259
NP_442110.1_7 Reverse -238 -252 10.0294 0.0684
NP_442110.1_7 Forward -247 -233 9.2427 0.0755
NP_442110.1_7 Forward -205 -191 9.04604 0.0782
NP_441925.1_4 Reverse -318 -337 1.27698 0.155
NP_441925.1_4 Reverse -153 -172 -10.1294 0.236
NP_441772.1_4 Reverse -110 -129 9.7334 0.17
NP_440856.1_7 Reverse -235 -254 -5.50708 0.228
NP_441083.1_5 Forward -247 -237 20.3345 0.00053
NP_441083.1_5 Reverse -238 -248 20.3345 0.00053
NP_441083.1_5 Forward -318 -308 3.91327 0.162
NP_442827.1_8 Forward -255 -236 -0.886293 0.236
NP_441434.1_1 Reverse -109 -123 8.5104 0.254
NP_441738.1_2 Forward -245 -238 15.28 0.0102
NP_441738.1_2 Reverse -240 -247 15.28 0.0102
NP_441738.1_2 Forward -94 -87 8.29857 0.176
NP_441558.1_5 Forward -249 -230 14.2574 0.0507
NP_440209.1_1 Reverse -238 -246 18.1123 0.00295
NP_440209.1_1 Forward -247 -239 18.1123 0.00295
NP_442889.1_8 Forward -250 -236 4.03056 0.27
NP_441713.1_1 Reverse -232 -251 -14.7502 0.259
NP_440178.1_7 Reverse -237 -256 -15.7335 0.163
NP_440178.1_7 Forward -248 -229 -20.8467 0.201
NP_442570.1_3 Forward -345 -326 -5.21209 0.241
NP_441792.1_5 Reverse -329 -345 22.0847 0.0844
NP_441716.1_1 Forward -247 -233 17.2075 0.0287
NP_441716.1_1 Reverse -238 -252 12.586 0.0741
NP_442111.1_4 Forward -248 -234 13.9626 0.035
NP_442111.1_4 Reverse -237 -251 3.14618 0.253
NP_440906.1_5 Forward -246 -239 15.8704 0.0124
NP_440906.1_5 Reverse -239 -246 15.8704 0.0124
NP_440832.1_10 Forward -223 -204 11.9958 0.242
NP_440747.1_10 Reverse -235 -247 17.2469 0.000522
NP_440747.1_10 Forward -250 -238 7.51213 0.00286
NP_441130.1_10 Forward -249 -235 8.16106 0.14
NP_441130.1_10 Reverse -236 -250 7.27608 0.164
NP_441486.1_1 Forward -250 -236 14.1593 0.00654
NP_441486.1_1 Reverse -235 -249 3.93283 0.0522
NP_441486.1_1 Reverse -131 -145 0.786239 0.126
NP_442634.1_4 Forward -249 -235 -2.85201 0.156
NP_442634.1_4 Reverse -236 -250 -3.63866 0.161
NP_440403.1_4 Forward -256 -237 13.8641 0.0674
NP_441014.1_10 Reverse -237 -256 21.0414 0.0349
NP_442848.1_1 Forward -253 -239 25.4673 0.00131
NP_442848.1_1 Reverse -232 -246 7.37441 0.0791
NP_442848.1_5 Reverse -155 -173 -0.964162 0.276
NP_443018.1_3 Forward -246 -239 14.8871 0.0123
NP_443018.1_3 Reverse -239 -246 14.8871 0.0123
NP_443018.1_3 Reverse -135 -142 10.7572 0.0907
NP_443018.1_3 Forward -142 -135 4.56234 0.241
NP_441316.1_7 Forward -249 -234 -1.49507 0.237
NP_441634.1_8 Forward -249 -235 3.73617 0.143
NP_441634.1_8 Reverse -236 -250 -4.52363 0.295
NP_440376.1_1 Forward -247 -238 19.4693 0.000692
NP_440376.1_1 Reverse -238 -247 19.4693 0.000692
NP_441588.1_4 Reverse -240 -250 8.63316 0.14
NP_442687.1_7 Forward -248 -238 8.92815 0.0994
NP_442687.1_7 Reverse -237 -247 8.92815 0.0994
NP_441077.1_2 Forward -123 -104 6.54077 0.196
NP_440066.1_5 Reverse -155 -174 10.9134 0.251
NP_442485.1_3 Reverse -221 -240 -0.983855 0.255
NP_441846.1_10 Forward -337 -318 -20.945 0.256
NP_441846.1_10 Forward -171 -152 -20.945 0.256
NP_442958.1_3 Reverse -227 -246 5.11266 0.233
NP_440642.1_10 Reverse -125 -139 7.17714 0.222
NP_440642.1_10 Reverse -132 -146 3.93223 0.264
NP_440642.1_10 Reverse -365 -379 3.24392 0.277
NP_441422.1_3 Reverse -212 -231 13.9357 0.297
NP_441422.1_7 Forward -249 -232 -2.71443 0.221
NP_440667.1_2 Reverse -276 -295 -7.08038 0.273
NP_441950.1_7 Forward -334 -315 -1.18052 0.191
NP_440360.1_10 Reverse -318 -332 4.32615 0.227
NP_442658.1_1 Forward -145 -135 12.3692 0.0569
NP_442658.1_1 Forward -255 -245 10.4026 0.119
NP_442658.1_1 Reverse -236 -246 9.616 0.147
NP_442658.1_1 Reverse -198 -208 7.45273 0.214
NP_442658.1_1 Forward -249 -239 6.76441 0.214
NP_440141.1_3 Forward -262 -243 2.3594 0.274
NP_440141.1_8 Forward -152 -133 4.42435 0.289
NP_441414.1_9 Forward -247 -228 4.32602 0.0546
NP_441256.1_1 Forward -244 -225 -5.31042 0.233
NP_442937.1_5 Reverse -233 -252 15.6341 0.0562
NP_442937.1_5 Forward -252 -233 8.75091 0.212
NP_441958.1_5 Forward -248 -238 12.2714 0.00183
NP_441958.1_5 Reverse -237 -247 12.2714 0.00183
NP_441127.1_1 Forward -379 -365 9.83269 0.267
NP_442836.1_5 Reverse -232 -251 7.57094 0.158
NP_440203.1_5 Forward -244 -234 13.5492 0.114
NP_440203.1_5 Reverse -331 -341 11.8776 0.171
NP_440203.1_5 Reverse -210 -220 8.43603 0.299
NP_443001.1_7 Forward -349 -330 0.58944 0.296
NP_442364.1_2 Reverse -129 -148 14.5524 0.219
NP_439990.1_5 Reverse -233 -246 13.0973 0.103
NP_439990.1_5 Forward -252 -239 10.049 0.128
NP_442911.1_2 Reverse -228 -247 25.2705 0.00397
NP_441580.1_6 Forward -258 -239 -7.96535 0.25
NP_440153.1_5 Forward -246 -232 8.06273 0.149
NP_440153.1_5 Reverse -239 -253 5.80112 0.191
NP_440153.1_5 Reverse -310 -324 1.17956 0.268
NP_442064.1_3 Reverse -147 -166 17.994 0.0587
NP_443055.1_3 Forward -256 -237 19.2393 0.0397
NP_440993.1_2 Forward -252 -236 7.33503 0.178
NP_440993.1_2 Reverse -233 -249 1.63183 0.279
NP_439975.1_2 Reverse -269 -287 8.86894 0.215
NP_441099.1_5 Reverse -228 -247 17.699 0.0135
NP_442002.1_1 Reverse -265 -283 -7.749 0.254
NP_441294.1_7 Forward -251 -237 14.242 0.0448
NP_441646.1_1 Reverse -231 -250 13.5691 0.0879
NP_442438.1_10 Reverse -233 -247 10.1277 0.0579
NP_442438.1_10 Forward -252 -238 6.29277 0.118
NP_442431.1_10 Forward -340 -322 3.75572 0.213
NP_442771.1_1 Forward -249 -231 -8.63398 0.2
NP_440147.1_4 Forward -249 -236 11.524 0.0326
NP_440147.1_4 Reverse -236 -249 2.08423 0.21
NP_441550.1_8 Reverse -236 -246 16.7941 0.00906
NP_441550.1_8 Forward -249 -239 12.3692 0.0336
NP_441916.1_7 Forward -247 -237 10.3048 0.0261
NP_441916.1_7 Reverse -238 -248 10.3048 0.0261
NP_441916.1_10 Reverse -230 -249 14.7491 0.105
NP_440206.1_4 Reverse -228 -247 18.7798 0.0591
NP_441041.1_4 Forward -247 -228 -6.49039 0.168
NP_441041.1_4 Reverse -238 -257 -7.96535 0.194
NP_441041.1_4 Reverse -370 -389 -13.0786 0.28
NP_441041.1_7 Reverse -235 -247 9.1668 0.12
NP_441041.1_7 Forward -17 -5 8.19502 0.143
NP_441041.1_7 Forward -173 -161 5.76558 0.241
NP_442996.1_1 Forward -127 -108 8.06865 0.21
NP_441547.1_2 Forward -198 -180 3.06741 0.291
NP_442004.1_6 Forward -247 -233 5.99778 0.181
NP_442004.1_6 Reverse -238 -252 1.76955 0.278
NP_440703.1_9 Forward -215 -202 7.98351 0.249
NP_440703.1_9 Forward -222 -209 4.34528 0.299
NP_441725.1_4 Reverse -233 -247 3.63724 0.278
NP_441725.1_5 Reverse -239 -249 11.2881 0.0247
NP_441725.1_5 Forward -246 -236 9.02648 0.0553
NP_441725.1_5 Reverse -135 -145 7.64985 0.0904
NP_439966.1_7 Forward -249 -239 15.8108 0.0124
NP_439966.1_7 Reverse -236 -246 14.8275 0.0177
NP_439966.1_9 Reverse -236 -245 0.884706 0.253
NP_442941.1_3 Reverse -239 -249 19.9412 0.00262
NP_442941.1_3 Forward -246 -236 10.9931 0.0116
NP_440289.1_2 Forward -250 -237 13.294 0.0132
NP_440289.1_2 Reverse -235 -248 2.08423 0.105
NP_441514.1_4 Forward -129 -110 14.5416 0.236
NP_441678.1_6 Forward -345 -326 13.2741 0.235
NP_442281.1_1 Forward -252 -238 17.5018 0.00555
NP_442281.1_1 Reverse -233 -247 15.6336 0.0113
NP_442281.1_1 Forward -148 -134 5.21053 0.166
NP_441079.1_7 Forward -127 -108 -2.36125 0.217
NP_441079.1_7 Reverse -108 -127 -2.65624 0.22
NP_442172.1_1 Forward -128 -109 10.077 0.29
NP_001035871.2_7 Forward -220 -210 12.0747 0.272
NP_443030.1_4 Forward -254 -235 -1.47551 0.231
NP_443030.1_4 Reverse -262 -281 -1.96717 0.238
NP_441644.1_6 Forward -247 -237 17.3841 0.00127
NP_441644.1_6 Reverse -238 -248 17.3841 0.00127
NP_441644.1_6 Forward -143 -133 3.91283 0.256
NP_442501.1_2 Reverse -189 -208 4.71934 0.157
NP_442215.1_2 Reverse -132 -148 14.1199 0.021
NP_442215.1_2 Reverse -236 -252 11.7599 0.0371
NP_442215.1_2 Forward -231 -215 1.73016 0.128
NP_442215.1_2 Reverse -205 -221 -2.79306 0.204
NP_442215.1_2 Forward -249 -233 -2.89139 0.206
NP_442029.1_1 Forward -339 -320 -17.6018 0.272
NP_442029.1_1 Reverse -236 -255 -19.6667 0.297
NP_440253.1_2 Reverse -238 -256 3.3624 0.118
NP_440929.1_8 Forward -247 -238 19.2726 0.000701
NP_440929.1_8 Reverse -238 -247 19.2726 0.000701
NP_442933.1_1 Forward -63 -44 10.1695 0.253
NP_442933.1_1 Reverse -104 -123 8.25963 0.253
NP_442933.1_10 Forward -247 -238 17.601 0.00325
NP_442933.1_10 Reverse -238 -247 17.601 0.00325
NP_441751.2_8 Forward -246 -232 16.3225 0.00876
NP_441751.2_8 Reverse -239 -253 5.60446 0.0419
NP_442554.1_8 Forward -246 -236 18.0729 0.00543
NP_442554.1_8 Reverse -239 -249 15.9097 0.00747
NP_442554.1_8 Reverse -135 -145 3.91327 0.203
NP_442554.1_8 Forward -142 -132 1.74999 0.298
NP_441762.1_7 Forward -248 -236 2.69391 0.0676
NP_441762.1_7 Reverse -237 -249 -6.84419 0.284
NP_442142.1_4 Forward -250 -237 14.1783 0.0311
NP_442142.1_4 Reverse -235 -248 13.49 0.0348
NP_442292.1_1 Forward -246 -237 18.486 0.00229
NP_442292.1_1 Reverse -239 -248 18.486 0.00229
NP_442292.1_5 Forward -329 -310 -2.65548 0.296
NP_441525.1_1 Forward -257 -244 11.229 0.296
NP_442476.1_6 Forward -246 -232 0.982901 0.233
NP_441711.1_4 Reverse -229 -248 7.86593 0.144
NP_443009.1_5 Reverse -237 -248 8.90795 0.0965
NP_443009.1_5 Forward -248 -237 8.90795 0.0965
NP_443009.1_5 Reverse -177 -188 4.18809 0.259
NP_442408.2_1 Forward -277 -258 1.37609 0.191
NP_441715.1_4 Reverse -239 -249 14.828 0.0268
NP_441715.1_4 Forward -246 -236 7.84651 0.107
NP_440158.1_8 Reverse -236 -255 10.3242 0.249
NP_441198.1_4 Reverse -268 -287 10.9142 0.241
NP_441198.1_8 Forward -145 -135 10.6345 0.254
NP_441468.1_1 Forward -246 -239 15.8704 0.0124
NP_441468.1_1 Reverse -239 -246 15.8704 0.0124
NP_441468.1_1 Forward -142 -135 4.07068 0.263
NP_441020.2_6 Reverse -236 -253 8.59364 0.195
NP_441020.2_7 Reverse -328 -347 15.7316 0.146
NP_441015.1_10 Reverse -233 -252 -6.78538 0.256
NP_441015.1_10 Forward -169 -150 -11.1119 0.291
NP_441673.1_1 Forward -247 -238 20.8459 0.000698
NP_441673.1_1 Reverse -238 -247 20.8459 0.000698
NP_441826.1_2 Reverse -232 -246 22.2224 0.00317
NP_441826.1_2 Forward -253 -239 20.1574 0.00771
NP_441826.1_2 Reverse -238 -252 -0.590395 0.215
NP_442811.1_2 Forward -339 -320 -2.55715 0.281
NP_441637.1_9 Reverse -119 -137 -1.84914 0.292
NP_441764.1_8 Reverse -56 -66 13.3205 0.284
NP_442868.1_6 Reverse -236 -246 17.4829 0.012
NP_442868.1_6 Forward -249 -239 9.91146 0.038
NP_441056.1_1 Reverse -238 -257 -8.26035 0.282
NP_441612.1_2 Reverse -238 -248 8.54929 0.21
NP_441612.1_2 Forward -247 -237 8.54929 0.21
NP_442227.1_2 Reverse -184 -203 -1.47551 0.262
NP_443058.1_7 Forward -248 -229 3.34271 0.263
NP_442361.1_3 Reverse -190 -203 15.4572 0.0906
NP_442361.1_3 Forward -253 -240 14.0806 0.129
NP_442808.1_1 Reverse -327 -337 11.1893 0.0481
NP_442808.1_1 Reverse -237 -247 8.63269 0.0481
NP_442808.1_1 Forward -248 -238 8.63269 0.0481
NP_442808.1_1 Forward -24 -14 4.20782 0.203
NP_441101.1_1 Forward -249 -231 14.7688 0.231
NP_441101.1_10 Forward -251 -232 -7.86702 0.293
NP_441882.1_6 Forward -345 -326 2.75272 0.174
NP_440145.1_3 Forward -257 -238 7.57094 0.0466
NP_442542.1_2 Reverse -236 -249 13.1956 0.114
NP_442050.1_5 Forward -249 -239 16.4991 0.00812
NP_442050.1_5 Reverse -236 -246 15.6142 0.01
NP_442050.1_5 Reverse -194 -204 6.86274 0.28
NP_440334.1_2 Forward -134 -121 14.2773 0.256
NP_441114.1_3 Reverse -136 -145 17.1093 0.113
NP_440558.1_2 Reverse -229 -248 -0.295539 0.2
NP_440558.1_2 Forward -256 -237 -1.57384 0.215
NP_440558.1_2 Reverse -131 -150 -4.32711 0.244
NP_440558.1_2 Reverse -235 -254 -5.01543 0.251
NP_442789.1_4 Reverse -252 -271 -7.67036 0.299
NP_441518.1_3 Forward -257 -238 2.75272 0.0578
NP_441878.1_6 Forward -248 -238 10.4031 0.0176
NP_441878.1_6 Reverse -237 -247 10.4031 0.0176
NP_441878.1_6 Forward -144 -134 2.33998 0.0405
NP_441878.1_6 Forward -217 -207 0.766681 0.134
NP_441878.1_6 Reverse -206 -216 0.57002 0.14
NP_441036.1_8 Forward -248 -238 8.33817 0.174
NP_441036.1_8 Reverse -237 -247 8.33817 0.174
NP_442650.1_2 Forward -247 -233 6.78443 0.13
NP_441557.1_5 Forward -247 -238 19.9609 0.000699
NP_441557.1_5 Reverse -238 -247 19.9609 0.000699
NP_441445.1_1 Forward -256 -237 7.37428 0.135
NP_441590.1_4 Reverse -324 -343 5.30853 0.279
NP_441590.1_4 Reverse -143 -162 1.76863 0.299
NP_441433.1_3 Reverse -158 -177 16.7157 0.115
NP_441433.1_8 Forward -149 -130 -0.983855 0.256
NP_442777.1_3 Forward -392 -374 1.10005 0.292
NP_441308.1_8 Reverse -272 -282 9.22315 0.226
NP_441458.1_10 Forward -256 -237 11.2092 0.116
NP_442183.1_1 Reverse -238 -252 18.3875 0.00758
NP_442183.1_1 Forward -247 -233 15.7325 0.0187
NP_442397.1_9 Forward -247 -228 4.42435 0.254
NP_440595.1_8 Forward -156 -137 11.8975 0.247
NP_441238.1_7 Reverse -115 -134 14.8486 0.24
NP_442347.1_2 Forward -246 -237 12.4878 0.056
NP_442347.1_2 Reverse -239 -248 12.4878 0.056
NP_442645.1_2 Reverse -236 -255 -13.4719 0.154
NP_442645.1_2 Forward -31 -12 -18.4868 0.274
NP_442645.1_2 Reverse -301 -320 -22.3217 0.29
NP_442888.1_9 Forward -247 -228 14.2574 0.22
NP_441037.1_4 Reverse -236 -246 9.55921 0.21
NP_441037.1_4 Forward -145 -135 6.44058 0.263
NP_442594.1_8 Forward -189 -170 12.9791 0.147
NP_441633.1_3 Forward -249 -236 3.75586 0.0699
NP_441633.1_3 Reverse -236 -249 -6.07724 0.236
NP_441633.1_3 Reverse -132 -145 -6.56889 0.259
NP_442764.1_6 Reverse -336 -354 2.96908 0.241
NP_440136.1_2 Forward -246 -239 15.9687 0.0123
NP_440136.1_2 Reverse -239 -246 15.9687 0.0123
NP_442590.1_10 Forward -229 -210 11.5042 0.158
NP_442590.1_10 Reverse -200 -219 8.45592 0.208
NP_442998.1_5 Forward -138 -128 8.33817 0.264
NP_442998.1_10 Forward -245 -238 15.5754 0.0102
NP_442998.1_10 Reverse -240 -247 15.5754 0.0102
NP_440299.1_1 Reverse -234 -247 21.8481 0.000628
NP_440299.1_1 Forward -251 -238 14.08 0.0259
NP_440299.1_1 Reverse -174 -187 5.52525 0.172
NP_441799.1_1 Forward -322 -308 6.0955 0.183
NP_441799.1_1 Reverse -234 -248 5.60385 0.201
NP_441799.1_1 Forward -251 -237 3.44058 0.298
NP_441007.1_10 Reverse -233 -246 8.86907 0.108
NP_441007.1_10 Forward -252 -239 0.412608 0.23
NP_442334.1_2 Reverse -228 -245 -5.46769 0.205
NP_442333.2_5 Forward -258 -239 -14.3569 0.272
NP_442333.2_5 Reverse -189 -208 -15.4385 0.294
NP_440256.1_1 Reverse -235 -254 10.4225 0.0184
NP_440709.1_1 Forward -125 -106 1.57197 0.237
NP_441559.1_8 Reverse -233 -247 -6.68692 0.279
NP_440915.1_6 Reverse -234 -248 13.3726 0.0187
NP_440915.1_6 Forward -251 -237 4.52282 0.0953
NP_442158.1_4 Forward -63 -53 10.4031 0.297
NP_441296.1_9 Forward -282 -269 8.77016 0.294
NP_441866.1_6 Reverse -176 -195 6.09517 0.298
NP_442866.1_1 Reverse -233 -252 -7.17871 0.264
NP_441464.1_10 Forward -345 -331 11.6026 0.219
NP_441464.1_10 Forward -339 -325 8.94771 0.267
NP_441464.1_10 Reverse -12 -26 8.16106 0.287
NP_440026.1_4 Forward -190 -171 15.3391 0.239
NP_441939.1_3 Forward -246 -227 13.0775 0.0928
NP_440677.1_1 Reverse -229 -248 12.5858 0.136
NP_440677.1_1 Forward -152 -133 5.99764 0.285
NP_442386.1_9 Reverse -237 -246 13.8639 0.0289
NP_442386.1_9 Forward -248 -239 13.8639 0.0289
NP_442386.1_9 Forward -284 -275 6.19416 0.23
NP_442386.1_10 Reverse -268 -281 3.65753 0.27
NP_440570.1_5 Reverse -228 -247 2.85105 0.234
NP_441750.1_4 Forward -397 -378 7.47261 0.159
NP_441340.1_5 Forward -246 -239 15.6737 0.0124
NP_441340.1_5 Reverse -239 -246 15.6737 0.0124
NP_441340.1_5 Reverse -135 -142 3.97235 0.274
NP_441947.1_1 Reverse -202 -221 11.6025 0.205
NP_441947.1_4 Forward -258 -239 10.2259 0.3
NP_441947.1_10 Forward -249 -231 7.00065 0.252
NP_440168.1_8 Forward -253 -234 7.17762 0.187
NP_440327.1_6 Forward -354 -335 6.88262 0.229
NP_440327.1_6 Forward -349 -330 4.32602 0.274
NP_440327.1_6 Forward -203 -184 3.53937 0.284
NP_440327.1_6 Reverse -123 -142 3.24438 0.285
NP_440194.1_3 Forward -257 -238 2.26107 0.271
NP_440586.1_8 Forward -246 -239 13.2151 0.026
NP_440586.1_8 Reverse -239 -246 13.2151 0.026
NP_440586.1_8 Forward -256 -249 7.1186 0.272
NP_440586.1_8 Reverse -97 -104 5.93863 0.283
NP_442251.1_6 Forward -246 -239 15.2804 0.0124
NP_442251.1_6 Reverse -239 -246 15.2804 0.0124
NP_442959.1_7 Forward -24 -5 -0.688862 0.245
NP_441912.1_2 Forward -216 -197 16.3704 0.232
NP_440684.1_9 Reverse -232 -246 9.04604 0.221
NP_440684.1_9 Forward -253 -239 8.35772 0.233
NP_441262.1_3 Reverse -238 -245 14.7888 0.0223
NP_441262.1_3 Forward -247 -240 14.7888 0.0223
NP_440027.1_3 Forward -257 -239 5.1316 0.246
NP_440027.1_8 Reverse -175 -194 4.32522 0.291
NP_443051.1_1 Reverse -237 -246 10.4228 0.00754
NP_443051.1_1 Forward -248 -239 10.4228 0.00754
NP_439996.1_6 Forward -344 -325 8.49636 0.251
NP_440439.1_1 Reverse -235 -248 1.39592 0.156
NP_439943.1_2 Reverse -332 -351 17.2074 0.147
NP_440372.1_2 Forward -246 -239 16.3621 0.0124
NP_440372.1_2 Reverse -239 -246 16.3621 0.0124
NP_441789.1_7 Reverse -324 -343 -1.18128 0.251
NP_441789.1_7 Reverse -151 -170 -1.37794 0.251
NP_440316.1_10 Reverse -231 -241 11.7798 0.214
NP_440316.1_10 Forward -144 -134 6.96153 0.251
NP_441803.1_2 Reverse -233 -252 3.44104 0.191
NP_439977.1_5 Reverse -232 -251 4.32602 0.153
NP_439977.1_5 Forward -253 -234 0.392778 0.21
NP_439977.1_5 Reverse -322 -341 -1.47551 0.253
NP_441572.1_7 Forward -222 -203 -4.81876 0.244
NP_442384.1_10 Forward -247 -234 11.3273 0.0367
NP_442384.1_10 Reverse -238 -251 10.049 0.047
NP_442384.1_10 Reverse -178 -191 3.75586 0.179
NP_442384.1_10 Reverse -207 -220 3.16588 0.199
NP_441877.1_7 Reverse -365 -384 12.6833 0.109
NP_440476.1_2 Reverse -116 -135 11.995 0.284
NP_441018.1_7 Reverse -10 -29 13.3725 0.136
NP_441018.1_7 Reverse -234 -253 10.3242 0.209
NP_441018.1_7 Forward -48 -29 6.19431 0.297
NP_442790.1_4 Forward -256 -237 -8.94866 0.176
NP_442262.1_10 Forward -246 -239 14.1988 0.0123
NP_442262.1_10 Reverse -239 -246 14.1988 0.0123
NP_442262.1_10 Reverse -135 -142 9.87221 0.164
NP_441689.1_5 Forward -249 -239 15.3192 0.0403
NP_441689.1_5 Reverse -236 -246 5.87944 0.197
NP_440163.1_10 Forward -250 -240 11.3864 0.169
NP_440344.1_10 Forward -254 -237 9.77361 0.00808
NP_440344.1_10 Reverse -231 -248 -8.51595 0.129
NP_440344.1_10 Forward -150 -133 -12.5475 0.257
NP_440531.1_6 Forward -255 -236 1.86774 0.166
NP_440531.1_6 Reverse -192 -211 -0.4922 0.214
NP_440562.1_3 Forward -246 -229 2.98877 0.25
NP_441965.1_3 Reverse -228 -247 17.3057 0.0461
NP_441965.1_7 Reverse -191 -210 12.4867 0.285
NP_440297.1_9 Reverse -239 -249 9.32148 0.0917
NP_440297.1_9 Reverse -135 -145 7.35486 0.126
NP_440297.1_9 Forward -246 -236 -0.216628 0.282
NP_440297.1_9 Reverse -208 -218 -0.609952 0.292
NP_442280.1_10 Forward -353 -335 8.37644 0.258
NP_441103.1_9 Reverse -180 -190 13.0755 0.27
NP_441679.1_6 Reverse -233 -252 2.0644 0.243
NP_440999.1_9 Reverse -234 -248 12.8809 0.035
NP_440999.1_9 Forward -251 -237 4.32615 0.116
NP_440888.1_2 Reverse -238 -252 18.0918 0.00261
NP_440888.1_2 Forward -247 -233 16.9119 0.00511
NP_440600.1_4 Forward -255 -237 1.29745 0.128
NP_440491.1_1 Forward -250 -231 9.15853 0.219
NP_441748.1_9 Reverse -124 -143 9.34008 0.185
NP_442033.1_10 Reverse -236 -255 -13.4719 0.287
NP_441543.1_2 Forward -246 -237 16.9127 0.00359
NP_441543.1_2 Reverse -239 -248 16.9127 0.00359
NP_442845.1_2 Reverse -207 -221 13.6676 0.0934
NP_442845.1_2 Reverse -232 -246 13.5693 0.0949
NP_442845.1_2 Forward -253 -239 4.62115 0.256
NP_441304.1_10 Reverse -2 -11 13.3727 0.249
NP_441178.1_6 Reverse -324 -343 3.9319 0.269
NP_441178.1_6 Reverse -315 -334 3.04693 0.269
NP_441918.1_7 Forward -248 -229 0.0977854 0.297
NP_441469.1_8 Forward -144 -135 9.63616 0.227
NP_441469.1_8 Forward -248 -239 6.48957 0.227
NP_441469.1_8 Reverse -237 -246 6.48957 0.227
NP_443064.1_6 Forward -247 -237 12.5669 0.0796
NP_443064.1_6 Reverse -238 -248 12.5669 0.0796
NP_443064.1_6 Forward -30 -20 8.39772 0.292
NP_442578.1_7 Forward -246 -239 14.5921 0.026
NP_442578.1_7 Reverse -239 -246 14.5921 0.026
NP_440710.1_1 Forward -255 -237 -4.20908 0.208
NP_441462.1_2 Forward -247 -237 11.5831 0.00406
NP_441462.1_2 Reverse -238 -248 11.5831 0.00406
NP_441621.1_7 Forward -249 -235 -2.85201 0.188
NP_443062.1_1 Forward -247 -229 14.2989 0.0493
NP_443062.1_1 Reverse -238 -256 7.76586 0.168
NP_443062.1_6 Forward -255 -236 1.67108 0.271
NP_442204.1_1 Reverse -234 -245 2.41861 0.266
NP_442204.1_1 Forward -191 -180 1.4353 0.271
NP_442204.1_1 Forward -251 -240 0.353664 0.281
NP_441560.1_8 Reverse -233 -252 11.6101 0.292
NP_441560.1_10 Forward -255 -236 15.9291 0.0867
NP_442872.1_1 Reverse -323 -342 0.0977854 0.184
NP_440516.1_8 Forward -247 -238 16.9127 0.00442
NP_440516.1_8 Reverse -238 -247 16.9127 0.00442
NP_441785.1_1 Reverse -238 -252 18.5558 0.06
NP_442428.1_4 Forward -248 -229 1.86774 0.278
NP_442428.1_5 Forward -246 -239 15.8704 0.0124
NP_442428.1_5 Reverse -239 -246 15.8704 0.0124
NP_442428.1_5 Forward -142 -135 4.46401 0.267
NP_441443.1_2 Reverse -126 -145 -2.95047 0.26
NP_442120.1_10 Forward -253 -234 -9.24366 0.242
NP_440673.1_2 Forward -257 -238 8.92631 0.26
NP_440673.1_3 Forward -245 -238 12.4288 0.0426
NP_440673.1_3 Reverse -240 -247 12.4288 0.0426
NP_440673.1_3 Reverse -136 -143 8.98723 0.203
NP_441714.1_3 Reverse -231 -249 15.8496 0.138
NP_441052.1_2 Forward -247 -237 19.9412 0.00106
NP_441052.1_2 Reverse -238 -248 19.9412 0.00106
NP_442219.1_9 Forward -246 -237 17.7976 0.00718
NP_442219.1_9 Reverse -239 -248 17.7976 0.00718
NP_440436.1_4 Forward -246 -237 17.2072 0.00233
NP_440436.1_4 Reverse -239 -248 17.2072 0.00233
NP_440436.1_4 Reverse -135 -144 9.73406 0.0871
NP_440436.1_4 Reverse -245 -254 7.47246 0.129
NP_441884.1_9 Reverse -235 -254 -14.3569 0.138
NP_441884.1_9 Forward -250 -231 -14.4552 0.138
NP_441719.1_4 Forward -246 -239 16.3621 0.0124
NP_441719.1_4 Reverse -239 -246 16.3621 0.0124
NP_441733.1_10 Reverse -235 -248 7.88576 0.148
NP_440746.1_2 Reverse -226 -245 16.0274 0.173
NP_441004.1_1 Forward -343 -324 -9.24366 0.206
NP_441004.1_1 Reverse -220 -239 -14.4552 0.268
NP_441004.1_2 Forward -108 -89 -4.52377 0.291
NP_442366.1_3 Forward -248 -230 -2.73412 0.232
NP_441115.1_4 Reverse -95 -113 9.94979 0.194
NP_442694.1_3 Forward -342 -324 -4.79907 0.276
NP_442206.1_10 Forward -247 -232 4.30646 0.178
NP_442206.1_10 Reverse -238 -253 3.02816 0.195
NP_442854.1_6 Forward -247 -228 10.2259 0.213
NP_443054.1_2 Forward -249 -235 2.85119 0.24
NP_443054.1_2 Forward -173 -159 0.0979218 0.278
NP_441851.1_10 Forward -248 -238 15.8113 0.00552
NP_441851.1_10 Reverse -237 -247 15.8113 0.00552
NP_441851.1_10 Forward -144 -134 6.07655 0.187
NP_442001.1_4 Reverse -182 -201 12.6833 0.194
NP_442856.1_7 Reverse -20 -39 -1.86883 0.231
NP_441668.1_4 Reverse -228 -247 8.06259 0.151
NP_441668.1_5 Forward -138 -119 9.14423 0.232
NP_442515.1_1 Forward -248 -234 4.42448 0.107
NP_442515.1_1 Reverse -237 -251 1.76955 0.149
NP_442515.1_1 Forward -144 -130 -1.37704 0.253
NP_441396.1_5 Forward -333 -324 18.0926 0.141
NP_440593.1_3 Forward -252 -233 -1.18052 0.211
NP_440593.1_3 Reverse -136 -155 -7.37537 0.293
NP_440165.1_5 Reverse -237 -256 -5.21209 0.22
NP_440940.1_7 Reverse -228 -246 5.81991 0.225
NP_441349.1_10 Forward -257 -238 -0.000545616 0.0918
NP_441349.1_10 Reverse -228 -247 -5.11376 0.192
NP_441409.1_6 Forward -253 -234 -10.227 0.202
NP_441409.1_6 Reverse -232 -251 -10.3253 0.203
NP_440432.1_9 Reverse -239 -254 -2.08505 0.167
NP_442843.1_1 Forward -208 -189 -11.5053 0.291
NP_439960.1_4 Forward -344 -325 14.9449 0.164
NP_440726.1_2 Forward -239 -220 -0.000545616 0.288
NP_441477.1_10 Reverse -206 -224 1.00246 0.267
NP_442450.1_5 Forward -249 -239 9.32148 0.115
NP_442237.1_3 Forward -125 -111 16.1498 0.289
NP_442006.1_2 Forward -144 -127 -11.0726 0.197
NP_441003.1_9 Reverse -229 -248 13.4708 0.213
NP_442243.1_1 Reverse -232 -250 2.18168 0.204
NP_441570.1_1 Reverse -238 -256 28.0435 0.00108
NP_441570.1_1 Forward -247 -229 -8.43732 0.112
NP_441570.1_1 Forward -343 -325 -9.22396 0.132
NP_440078.1_10 Forward -247 -228 12.4875 0.155
NP_441078.1_4 Forward -247 -238 19.6659 0.0007
NP_441078.1_4 Reverse -238 -247 19.6659 0.0007
NP_441078.1_4 Forward -143 -134 -1.57357 0.266
NP_442729.1_8 Reverse -234 -247 8.67241 0.125
NP_442729.1_8 Forward -251 -238 8.47575 0.125
NP_440539.1_9 Reverse -215 -234 -6.68705 0.287
NP_442443.1_1 Forward -342 -323 3.93269 0.163
NP_442443.1_1 Forward -333 -314 -0.4922 0.224
NP_440526.1_3 Forward -246 -235 17.7577 0.0398
NP_440526.1_3 Reverse -239 -250 10.1862 0.0646
NP_440526.1_3 Reverse -135 -146 1.13984 0.267
NP_441432.1_8 Reverse -237 -246 16.8143 0.00595
NP_441432.1_8 Forward -248 -239 16.8143 0.00595
NP_441432.1_8 Forward -144 -135 6.5879 0.112
NP_443024.1_3 Forward -16 -6 14.238 0.255
NP_442320.1_8 Forward -253 -239 11.996 0.0175
NP_442320.1_8 Reverse -232 -246 4.71948 0.0472
NP_441732.1_2 Forward -251 -235 3.00846 0.0141
NP_441732.1_2 Reverse -234 -250 -6.62797 0.0495
NP_442447.1_1 Reverse -79 -98 5.70265 0.258
NP_441030.1_6 Reverse -205 -224 13.044 0.23
NP_440497.1_2 Reverse -239 -258 3.83436 0.293
NP_440685.1_8 Reverse -202 -221 13.2741 0.281
NP_440760.1_1 Forward -247 -228 -5.31042 0.0493
NP_440760.1_1 Reverse -238 -257 -14.5535 0.133
NP_440199.1_4 Forward -126 -108 20.1508 0.156
NP_440199.1_10 Forward -250 -240 16.7946 0.0381
NP_441945.1_10 Forward -278 -259 14.4541 0.168
NP_442353.1_4 Forward -149 -130 -0.591301 0.29
NP_442510.1_3 Reverse -229 -248 13.4708 0.245
NP_440913.1_1 Reverse -236 -254 15.3588 0.103
NP_440713.1_4 Forward -257 -238 7.47261 0.18
NP_442489.1_7 Forward -247 -238 20.1576 0.000695
NP_442489.1_7 Reverse -238 -247 20.1576 0.000695
NP_442489.1_7 Forward -143 -134 -1.57357 0.213
NP_442489.1_7 Reverse -134 -143 -2.06522 0.288
NP_442079.1_7 Forward -186 -167 -0.295539 0.29
NP_440559.1_1 Forward -246 -237 17.4043 0.00658
NP_440559.1_1 Reverse -239 -248 17.4043 0.00658
NP_441659.2_8 Forward -247 -237 18.1713 0.00133
NP_441659.2_8 Reverse -238 -248 18.1713 0.00133
NP_441659.2_8 Reverse -96 -106 3.91327 0.149
NP_442913.1_10 Reverse -229 -248 -5.01543 0.254
NP_441040.1_2 Forward -166 -147 -13.4719 0.281
NP_441800.1_7 Reverse -156 -174 -1.65248 0.246
NP_442346.1_1 Forward -343 -324 11.6025 0.27
NP_442346.1_5 Forward -248 -238 16.6963 0.00248
NP_442346.1_5 Reverse -237 -247 16.6963 0.00248
NP_442346.1_5 Forward -144 -134 13.1564 0.029
NP_442346.1_5 Forward -242 -232 5.68323 0.234
NP_440352.1_5 Forward -148 -129 18.1066 0.0576
NP_440352.1_5 Forward -380 -361 12.3637 0.229
NP_440352.1_5 Forward -110 -91 9.73562 0.289
NP_440545.1_3 Reverse -234 -251 6.52869 0.0551
NP_440545.1_3 Forward -251 -234 -0.354483 0.152
NP_440545.1_3 Reverse -203 -220 -0.747806 0.157
NP_440025.1_3 Forward -101 -87 10.998 0.29
NP_441629.1_1 Forward -151 -132 5.80098 0.29
NP_440486.1_9 Reverse -228 -242 13.9626 0.228
NP_440459.1_2 Forward -152 -135 10.5603 0.196
NP_441653.1_2 Reverse -227 -246 8.65121 0.175
NP_441653.1_2 Forward -258 -239 4.01279 0.264
NP_440010.1_3 Forward -163 -144 -8.26035 0.295
NP_440010.1_4 Reverse -228 -247 11.8967 0.157
NP_440010.1_4 Forward -257 -238 10.7167 0.157
NP_440010.1_10 Reverse -138 -157 10.0292 0.209
NP_442551.1_4 Reverse -132 -147 -2.97003 0.278
NP_442603.1_7 Forward -247 -233 17.0102 0.0273
NP_442603.1_7 Reverse -238 -252 10.422 0.126
NP_441888.1_7 Reverse -233 -247 3.53951 0.225
NP_441888.1_7 Forward -252 -238 2.2612 0.225
NP_441047.1_2 Forward -28 -9 -2.16383 0.273
NP_441833.1_4 Forward -246 -239 15.9687 0.0124
NP_441833.1_4 Reverse -239 -246 15.9687 0.0124
NP_441895.1_2 Reverse -335 -354 -26.8449 0.256
NP_442162.1_9 Forward -246 -239 16.2637 0.0124
NP_442162.1_9 Reverse -239 -246 16.2637 0.0124
NP_440671.1_4 Forward -253 -239 17.4042 0.0208
NP_440671.1_4 Reverse -232 -246 12.0943 0.117
NP_440224.1_1 Forward -258 -239 1.76941 0.132
NP_440772.1_8 Forward -253 -234 10.3242 0.253
NP_442073.1_6 Reverse -229 -248 -1.08219 0.271
NP_442140.1_3 Forward -246 -236 13.5497 0.0542
NP_442140.1_3 Reverse -239 -249 4.40493 0.243
NP_442723.1_1 Forward -288 -269 1.17865 0.298
NP_440875.1_9 Forward -245 -235 9.3454 0.233
NP_441813.1_5 Forward -249 -239 15.9097 0.01
NP_441813.1_5 Reverse -236 -246 8.73149 0.0367
NP_440590.1_4 Forward -246 -233 5.72248 0.0585
NP_440590.1_4 Reverse -239 -252 5.32916 0.0585
NP_440567.1_1 Forward -246 -232 13.4709 0.0213
NP_440567.1_1 Reverse -239 -253 3.53951 0.141
NP_440567.1_4 Forward -155 -136 0.491109 0.281
NP_442497.1_1 Forward -34 -15 13.0766 0.146
NP_442497.1_10 Forward -246 -237 10.4228 0.0087
NP_442497.1_10 Reverse -239 -248 10.4228 0.0087
NP_442497.1_10 Reverse -135 -144 0.196389 0.208
NP_440821.1_4 Forward -249 -239 18.2696 0.00448
NP_440821.1_4 Reverse -236 -246 17.9746 0.00497
NP_441239.1_9 Reverse -236 -248 7.11881 0.169
NP_441239.1_9 Reverse -181 -193 4.5622 0.251
NP_441239.1_9 Forward -249 -237 4.36554 0.253
NP_441239.1_9 Forward -145 -133 4.26721 0.256
NP_441239.1_9 Reverse -205 -217 3.48056 0.285
NP_441727.1_3 Forward -254 -235 3.34271 0.291
NP_440400.1_1 Reverse -155 -174 -0.787962 0.285
NP_440400.1_1 Reverse -153 -172 -3.44288 0.298
NP_441892.1_1 Forward -256 -239 11.7402 0.0546
NP_441892.1_1 Forward -152 -135 -5.56602 0.283
NP_440604.1_6 Forward -247 -228 -4.42544 0.249
NP_442193.1_1 Forward -171 -153 7.29564 0.295
NP_442193.1_8 Forward -250 -231 11.0117 0.269
NP_442193.1_8 Reverse -235 -254 10.2251 0.286
NP_441017.1_6 Forward -251 -237 18.0918 0.0376
NP_441017.1_8 Forward -175 -160 17.9745 0.174
NP_442629.1_3 Forward -339 -320 2.65439 0.275
NP_442216.1_4 Reverse -319 -327 8.08217 0.255
NP_440949.1_7 Reverse -230 -249 14.3549 0.192
NP_440949.1_7 Forward -255 -236 14.0599 0.197
NP_440354.1_7 Reverse -238 -256 6.80398 0.278
NP_442138.1_10 Reverse -238 -257 17.699 0.0204
NP_442052.1_8 Forward -145 -135 15.3197 0.253
NP_440546.1_4 Forward -247 -237 10.046 0.109
NP_440546.1_4 Reverse -238 -248 10.046 0.109
NP_440546.1_4 Reverse -213 -223 9.85209 0.118
NP_440462.1_6 Reverse -236 -246 10.3048 0.0396
NP_440462.1_6 Forward -249 -239 7.74818 0.0699
NP_440868.1_4 Reverse -234 -246 7.4138 0.0691
NP_440868.1_4 Forward -251 -239 -0.846001 0.282
NP_440401.1_9 Reverse -332 -339 14.5917 0.287
NP_442499.1_3 Forward -248 -230 9.65558 0.252
NP_441474.1_1 Reverse -324 -343 -0.29631 0.255
NP_442039.1_4 Forward -246 -239 15.1821 0.0124
NP_442039.1_4 Reverse -239 -246 15.1821 0.0124
NP_442039.1_7 Forward -141 -131 13.943 0.211
NP_442837.1_2 Forward -149 -130 15.1424 0.293
NP_442837.1_3 Forward -246 -239 15.7721 0.0124
NP_442837.1_3 Reverse -239 -246 15.7721 0.0124
NP_441760.1_4 Forward -343 -325 7.68896 0.275
NP_439994.1_3 Reverse -40 -59 10.0969 0.222
NP_442053.1_1 Forward -247 -238 18.3876 0.0007
NP_442053.1_1 Reverse -238 -247 18.3876 0.0007
NP_440505.1_3 Reverse -236 -246 16.598 0.00683
NP_440505.1_3 Forward -249 -239 16.303 0.00696
NP_440505.1_3 Forward -189 -179 6.07655 0.197
NP_440505.1_7 Reverse -214 -233 -1.47551 0.276
NP_441203.1_1 Reverse -135 -154 -20.3551 0.297
NP_440013.1_1 Reverse -91 -110 11.2084 0.222
NP_442532.1_1 Forward -124 -110 10.308 0.249
NP_442532.1_4 Reverse -108 -126 7.86797 0.289
NP_441576.1_10 Reverse -107 -126 9.83255 0.291
NP_441408.2_7 Forward -31 -12 -4.81876 0.286
NP_440914.1_1 Forward -247 -237 17.5935 0.000537
NP_440914.1_1 Reverse -238 -248 17.5935 0.000537
NP_440914.1_1 Forward -143 -133 12.226 0.0652
NP_440914.1_1 Forward -253 -243 10.3717 0.142
NP_441011.1_8 Forward -246 -237 8.25953 0.144
NP_441011.1_8 Reverse -239 -248 8.25953 0.144
NP_442533.1_1 Forward -334 -315 -12.3902 0.236
NP_442533.1_6 Forward -247 -238 17.2076 0.00137
NP_442533.1_6 Reverse -238 -247 17.2076 0.00137
NP_442533.1_6 Forward -216 -207 4.22796 0.186
NP_442533.1_6 Reverse -207 -216 3.7363 0.204
NP_442322.1_4 Reverse -325 -342 -7.33664 0.28
NP_442322.1_4 Reverse -170 -187 -8.31994 0.286
NP_442229.1_1 Reverse -132 -146 6.88214 0.202
NP_441482.1_7 Forward -253 -239 8.35772 0.0173
NP_441482.1_7 Reverse -232 -246 -0.787057 0.0612
NP_439944.1_9 Forward -246 -236 19.1546 0.00329
NP_439944.1_9 Reverse -239 -249 19.0562 0.00329
NP_441697.1_5 Reverse -108 -127 -1.38506 0.206
NP_440816.1_2 Forward -139 -120 15.3417 0.141
NP_440115.1_6 Reverse -235 -245 18.9579 0.0139
NP_440007.1_9 Forward -251 -237 10.3243 0.163
NP_440007.1_9 Forward -147 -133 4.42448 0.267
NP_440007.1_9 Reverse -234 -248 0.88457 0.29
NP_441972.1_5 Reverse -239 -258 -4.52377 0.211
NP_441972.1_5 Forward -246 -227 -9.14533 0.281
NP_441106.1_1 Forward -248 -239 9.63616 0.0311
NP_441106.1_1 Reverse -237 -246 9.63616 0.0311
NP_441106.1_1 Forward -106 -97 2.458 0.283
NP_440429.1_9 Reverse -4 -23 7.27595 0.211
NP_439903.1_6 Reverse -235 -254 10.815 0.101
NP_439903.1_6 Reverse -229 -248 0.392004 0.264
NP_439903.1_6 Forward -250 -231 0.195343 0.268
NP_442588.1_6 Forward -244 -225 -2.36049 0.294
NP_441286.1_1 Forward -248 -236 21.6718 0.00196
NP_441286.1_1 Reverse -237 -249 21.3768 0.00196
NP_441286.1_1 Reverse -133 -145 -5.46756 0.203
NP_442674.1_2 Reverse -75 -94 7.27595 0.283
NP_442674.1_3 Forward -255 -236 16.8132 0.174
NP_442674.1_3 Reverse -230 -249 3.53858 0.294
NP_440670.1_8 Forward -247 -238 18.3876 0.000699
NP_440670.1_8 Reverse -238 -247 18.3876 0.000699
NP_441930.1_2 Forward -144 -134 12.2714 0.262
NP_440886.1_7 Forward -248 -238 7.94438 0.0805
NP_440886.1_7 Reverse -237 -247 7.94438 0.0805
NP_440886.1_7 Reverse -324 -334 4.99446 0.205
NP_442614.1_2 Forward -216 -202 5.99778 0.295
NP_442072.1_9 Forward -248 -230 -2.93078 0.0325
NP_442072.1_9 Reverse -237 -255 -23.482 0.297
NP_442213.1_5 Forward -198 -179 8.45592 0.161
NP_442022.1_4 Forward -340 -321 12.6841 0.172
NP_440907.2_8 Forward -246 -236 10.8943 0.0969
NP_441021.1_1 Forward -246 -227 0.294447 0.0924
NP_441021.1_1 Reverse -135 -154 -7.76869 0.189
NP_440841.1_4 Forward -145 -126 -0.787193 0.142
NP_441463.1_3 Reverse -228 -247 -9.53865 0.28
NP_441463.1_6 Forward -249 -235 20.7177 0.0553
NP_441626.1_2 Forward -246 -239 15.7721 0.0124
NP_441626.1_2 Reverse -239 -246 15.7721 0.0124
NP_442365.1_7 Forward -251 -232 0.392778 0.177
NP_442365.1_7 Reverse -234 -253 -3.54046 0.221
NP_442365.1_7 Reverse -174 -193 -6.39206 0.292
NP_442362.1_7 Forward -220 -202 13.6872 0.22
NP_440107.1_5 Reverse -237 -256 -1.47551 0.178
NP_442794.1_1 Reverse -234 -246 13.0187 0.0721
NP_442794.1_1 Forward -251 -239 10.1671 0.0721
NP_442615.1_1 Reverse -125 -143 -6.37237 0.244
NP_441962.1_4 Forward -252 -233 5.70265 0.0932
NP_441962.1_4 Reverse -233 -252 5.60432 0.0932
NP_440387.1_1 Forward -247 -231 23.4613 0.00159
NP_440387.1_1 Reverse -238 -254 4.97508 0.0365
NP_441431.1_3 Forward -199 -180 5.80098 0.254
NP_442647.1_7 Reverse -186 -199 5.62415 0.275
NP_441993.1_1 Reverse -207 -226 3.79838 0.228
NP_441993.1_1 Reverse -238 -257 0.679741 0.294
NP_442805.1_5 Reverse -319 -338 -1.8696 0.262
NP_442323.1_7 Forward -283 -264 3.73524 0.238
NP_441510.2_6 Forward -257 -238 17.6982 0.104
NP_441510.2_7 Forward -253 -239 12.6836 0.28
NP_442087.1_5 Reverse -346 -365 14.9458 0.294
NP_440293.1_3 Reverse -12 -31 -2.16383 0.239
NP_440293.1_3 Reverse -211 -230 -3.3438 0.244
NP_440766.1_4 Forward -251 -237 8.25939 0.0871
NP_440766.1_4 Reverse -234 -248 7.86607 0.0871
NP_440766.1_4 Reverse -192 -206 5.89945 0.108
NP_439988.1_3 Forward -220 -206 3.63784 0.298
NP_441237.1_9 Forward -246 -236 14.9263 0.0242
NP_441237.1_9 Reverse -135 -145 14.0414 0.0535
NP_442930.1_1 Reverse -360 -370 15.3192 0.202
NP_442930.1_1 Reverse -119 -129 11.4843 0.258
NP_440457.1_1 Forward -251 -239 7.02048 0.105
NP_440457.1_1 Reverse -234 -246 6.62715 0.116
NP_442940.1_2 Reverse -146 -165 0.786102 0.296
NP_442509.1_9 Forward -247 -237 8.14104 0.192
NP_442509.1_9 Reverse -238 -248 8.14104 0.192
NP_442514.1_5 Reverse -176 -195 -0.787962 0.189
NP_440554.1_4 Reverse -239 -249 7.05986 0.106
NP_440554.1_4 Forward -246 -236 6.37155 0.123
NP_441325.1_3 Reverse -237 -256 15.7324 0.108
NP_442737.1_5 Reverse -237 -256 12.2972 0.264
NP_441885.1_5 Forward -247 -237 20.9245 0.000538
NP_441885.1_5 Reverse -238 -248 20.9245 0.000538
NP_440898.1_5 Reverse -5 -24 12.8808 0.244
NP_442341.1_7 Forward -248 -234 18.3875 0.0111
NP_442341.1_7 Reverse -237 -251 18.0925 0.0111
NP_440423.1_6 Forward -255 -236 -15.8318 0.229
NP_443000.1_7 Forward -249 -239 17.0896 0.00865
NP_443000.1_7 Reverse -236 -246 10.4031 0.0345
NP_440507.2_3 Reverse -229 -248 9.53674 0.218
NP_440552.1_8 Forward -121 -104 12.3706 0.231
NP_440275.1_3 Reverse -236 -246 17.6796 0.0102
NP_440275.1_3 Forward -249 -239 8.1415 0.0602
NP_442932.1_9 Forward -331 -312 4.62101 0.279
NP_440091.1_1 Forward -251 -239 8.88877 0.0567
NP_440091.1_1 Reverse -234 -246 1.41561 0.197
NP_442354.1_7 Forward -250 -231 11.0125 0.202
NP_441359.1_5 Forward -153 -134 1.27776 0.29
NP_442451.1_2 Forward -255 -236 -1.18052 0.169
NP_442638.1_3 Forward -131 -112 11.2199 0.298
NP_441122.1_1 Reverse -130 -145 5.58476 0.28
NP_439962.1_4 Reverse -183 -202 2.94938 0.196
NP_442495.1_5 Forward -154 -135 6.78429 0.291
NP_440804.1_7 Reverse -81 -98 6.3313 0.291
NP_440149.1_8 Reverse -238 -257 -4.72043 0.213
NP_441105.1_3 Reverse -227 -246 6.88262 0.0569
NP_441105.1_3 Forward -348 -329 -9.34199 0.288
NP_441105.1_3 Reverse -129 -148 -9.34199 0.288
NP_442373.1_2 Forward -334 -315 -8.85033 0.253
NP_440216.1_1 Reverse -238 -252 -9.73518 0.145
NP_440216.1_1 Forward -247 -233 -10.4235 0.145
NP_440216.1_9 Reverse -336 -345 13.9627 0.184
NP_440216.1_9 Forward -141 -132 7.17789 0.286
NP_440172.1_1 Forward -247 -237 15.0247 0.00945
NP_440172.1_1 Reverse -238 -248 15.0247 0.00945
NP_440172.1_1 Forward -143 -133 2.43831 0.279
NP_442015.1_10 Reverse -234 -247 12.2123 0.0372
NP_442015.1_10 Forward -251 -238 10.344 0.0391
NP_441226.1_7 Forward -246 -239 14.4934 0.0123
NP_441226.1_7 Reverse -239 -246 14.4934 0.0123
NP_441226.1_7 Reverse -335 -342 8.29857 0.205
NP_441111.1_7 Forward -246 -238 18.7023 0.00294
NP_441111.1_7 Reverse -239 -247 18.7023 0.00294
NP_442379.1_10 Reverse -231 -248 10.1669 0.0936
NP_441766.1_2 Forward -247 -238 17.5026 0.00297
NP_441766.1_2 Reverse -238 -247 17.5026 0.00297
NP_440416.1_9 Reverse -189 -208 -16.3235 0.212
NP_440416.1_9 Reverse -127 -146 -17.7001 0.245
NP_440416.1_9 Forward -45 -26 -17.7001 0.245
NP_440416.1_9 Reverse -237 -256 -18.2901 0.256
NP_443052.1_9 Reverse -324 -343 -2.95047 0.244
NP_443052.1_9 Reverse -315 -334 -5.70374 0.273
NP_442154.1_1 Forward -336 -318 -7.65067 0.146
NP_442154.1_1 Forward -172 -154 -8.04399 0.155
NP_442154.1_1 Forward -342 -324 -11.7806 0.216
NP_442154.1_1 Forward -345 -327 -16.6971 0.244
NP_440261.1_5 Forward -246 -233 -1.06236 0.0655
NP_440988.1_10 Forward -249 -235 17.7749 0.099
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGACCGCAGCTTCCACGTCTTGGCGACTGAGGGAATATTTAAAGCTCCGCACCACTTTGCGTTGGGGTTGGTGGGGGAAGTAGCAGATCACAAGTTCTTCTGTGTCCAAACTCAGTTCCGCATCCCAGTCCCCTTGATGGAGTAGCCAACAATGGCGATCGCCACGGTCTTGCTGACAACCCAGGGCCATGAGCCAGCGTTCTAATTGGGGCAGGGGATGGTTATAGAGGGGAGTTTCCGGTGCGGGGAGGCTCATGGGCAATGGCAAAATGGAAATAATTTAGATAATTTGACAGACGTTGGCTTAATTCGCCTAATCTAATCTAGACCATCTAACTTTGATCTTGGATCTTGTTTGCACTTTCGATAGGAGGCACCCCCAAAGCTGAAATTGCGCCTC

CDS

ATGGGGGGAAAGTGCTTAGCTAAGATGGCGTATAGTATATTGCGTTGCTCTCTGGAATTTATGAACATCCCTGCCTTTACCGCCCTGACATTAAAGTTGTTTGGCGTTATTTTCGTCCTCATTGCCCTGCTGGATTTTTTTAGCCTCATCTTCCCTCTGCAAATGGCTGATCCCCAGTGGCAGTTGACAACGATCACGGGCATTGTTGACCGGGGTATAGTGCCGATGTTGGGCATGGGGTTGATTTCCCTTGGTTACTTGGTGGATACCATGGCAAAAACCGCCGGAGCTTCCCCTAAAAATGGCTTTGATTTGCGGATGCCGATTTATATTTTGGCGATCGCCTTGGGGTTGGTCTTTTTATTGTTGATCCCCATACATTTGACCAATGTGAACCAAATTAAGACAGCGGAGTTGGCCCGACTGGAAACCCAGATTGGCCAGGGGCAAGAACAGGTGGAAGGGGCCCTGAGACAATTTGATGCCCTGTCCCAAAATCCAGAGGCGTTGGAACAACAAATCCAAGAAGGGGAGCAACTTTTGGCCTCCGGTCAAGCGAATGGTAATCCCCTCAACCAAGAGCAGCTGGCTAATATTGAACGCCAAGTGAACGAACTCAAAGGTTTACGGGAAATGTCTAAAGATCCTGCCGCCCTGAAGTCAAAAATGGAAGAAATTAAAACTAATTTAGAAAACCAGGTGACGGAGCAACGGCAAAAAGTAGAAAGCCAAGCCTCTAACCAAGCTCTTAAACAAGGCTTACGGGTGGGACTGAGCAGTTTGATGCTTTCCATCGGCTTCGCCGCCTTTGGTTCTTTGGGCCTGAGAAATTTGCTTTCTGCTCCCCCGACTCCCCCCAGTGCCGATCCCCTCGCCTAG

Protein

MGGKCLAKMAYSILRCSLEFMNIPAFTALTLKLFGVIFVLIALLDFFSLIFPLQMADPQWQLTTITGIVDRGIVPMLGMGLISLGYLVDTMAKTAGASPKNGFDLRMPIYILAIALGLVFLLLIPIHLTNVNQIKTAELARLETQIGQGQEQVEGALRQFDALSQNPEALEQQIQEGEQLLASGQANGNPLNQEQLANIERQVNELKGLREMSKDPAALKSKMEEIKTNLENQVTEQRQKVESQASNQALKQGLRVGLSSLMLSIGFAAFGSLGLRNLLSAPPTPPSADPLA