Your browser is old and dusty. Try Google Chrome!

Details for sll1749a

ORF sll1749a
Accession YP_680420.1
Symbol
Category
Definition
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Reverse -81 -100 11.6018 0.177
NP_440561.1_1 Reverse -149 -168 9.34008 0.284
NP_440784.1_7 Forward -238 -231 7.51227 0.138
NP_442861.1_4 Reverse -333 -352 0.686995 0.297
NP_442289.1_4 Reverse -49 -65 12.5466 0.219
NP_441054.1_2 Forward -107 -88 12.7825 0.225
NP_442062.1_8 Forward -66 -56 3.91327 0.243
NP_441594.1_6 Reverse -227 -246 0.884433 0.279
NP_442110.1_2 Forward -318 -305 16.8404 0.151
NP_441925.1_4 Reverse -161 -180 -17.6025 0.297
NP_440769.1_8 Reverse -91 -110 7.57094 0.261
NP_440769.1_8 Forward -201 -182 6.68596 0.289
NP_440856.1_7 Reverse -126 -145 -8.35868 0.27
NP_441434.1_1 Forward -97 -83 9.46532 0.24
NP_441434.1_1 Reverse -82 -96 8.41491 0.257
NP_441738.1_2 Reverse -59 -66 8.29857 0.176
NP_442596.1_10 Forward -217 -198 12.9791 0.234
NP_442145.1_3 Reverse -49 -68 6.39097 0.243
NP_442145.1_4 Reverse -76 -95 3.19856 0.299
NP_441667.1_1 Reverse -81 -96 15.4514 0.284
NP_440403.1_4 Forward -254 -235 -1.67217 0.174
NP_440376.1_1 Reverse -299 -308 5.3096 0.137
NP_440781.1_1 Reverse -239 -253 11.996 0.27
NP_441013.1_2 Reverse -219 -237 0.117479 0.254
NP_441080.1_7 Forward -96 -78 5.72158 0.296
NP_442161.1_7 Reverse -164 -183 7.47261 0.18
NP_442782.1_2 Forward -147 -133 1.08123 0.282
NP_442782.1_2 Reverse -246 -260 0.196253 0.293
NP_439905.1_1 Reverse -146 -159 14.3756 0.127
NP_439905.1_1 Forward -254 -241 6.4108 0.288
NP_439905.1_5 Forward -345 -331 11.406 0.288
NP_441162.1_3 Forward -54 -35 7.47261 0.293
NP_442690.1_1 Forward -100 -81 1.67108 0.107
NP_442690.1_1 Forward -110 -91 -16.5201 0.289
NP_441580.1_6 Forward -134 -115 -7.86702 0.247
NP_440153.1_8 Forward -239 -226 -2.53732 0.244
NP_442064.1_4 Reverse -226 -245 5.50519 0.267
NP_440993.1_4 Forward -260 -243 12.4285 0.171
NP_441429.1_4 Reverse -76 -95 13.0766 0.158
NP_439975.1_2 Forward -183 -165 8.27895 0.215
NP_441294.1_7 Reverse -301 -315 10.4985 0.185
NP_442438.1_10 Reverse -52 -66 0.589577 0.221
NP_441125.1_6 Forward -350 -337 11.229 0.25
NP_441916.1_7 Forward -235 -225 3.51995 0.213
NP_441041.1_4 Forward -301 -282 -9.93197 0.226
NP_442396.1_5 Forward -312 -299 18.6038 0.0171
NP_440736.1_6 Reverse -127 -146 18.3873 0.206
NP_441514.1_4 Forward -349 -330 16.4832 0.185
NP_442500.1_4 Forward -199 -180 23.5989 0.0422
NP_442215.1_2 Forward -310 -294 6.25339 0.0723
NP_442142.1_4 Forward -236 -223 7.68852 0.132
NP_442292.1_5 Forward -331 -312 2.3594 0.257
NP_440405.1_2 Reverse -262 -281 19.4681 0.123
NP_440405.1_3 Reverse -348 -367 18.9543 0.0618
NP_441865.1_3 Forward -108 -90 14.9655 0.235
NP_442408.2_1 Forward -307 -288 -6.98204 0.287
NP_440620.1_4 Reverse -91 -105 15.5768 0.236
NP_442076.1_5 Reverse -34 -53 9.14423 0.21
NP_441468.1_1 Reverse -225 -232 6.72562 0.126
NP_441020.2_6 Reverse -222 -239 8.59364 0.195
NP_441731.1_7 Reverse -238 -257 1.37609 0.298
NP_441339.1_4 Forward -161 -142 -4.32711 0.249
NP_441764.1_8 Forward -350 -340 15.7131 0.284
NP_441176.1_6 Reverse -172 -186 21.3374 0.0958
NP_441849.1_2 Reverse -331 -350 1.86167 0.245
NP_442820.1_10 Reverse -230 -248 9.85225 0.245
NP_442542.1_2 Forward -179 -166 5.32916 0.272
NP_442342.1_1 Reverse -42 -56 16.6591 0.259
NP_441114.1_3 Reverse -170 -179 7.57121 0.231
NP_442789.1_4 Reverse -127 -146 -5.21209 0.268
NP_441878.1_6 Reverse -115 -125 -7.49312 0.231
NP_441445.1_1 Forward -323 -304 0.196116 0.281
NP_441445.1_1 Forward -248 -229 0.0977854 0.283
NP_441433.1_8 Reverse -359 -378 -0.197208 0.244
NP_441564.1_10 Reverse -130 -149 3.34271 0.269
NP_442135.1_3 Forward -133 -114 4.71934 0.274
NP_442645.1_2 Reverse -297 -316 -17.4051 0.254
NP_440899.1_8 Forward -97 -78 -9.34199 0.262
NP_440640.1_6 Forward -307 -288 8.06259 0.17
NP_442333.2_5 Reverse -202 -221 -7.17871 0.227
NP_440256.1_1 Forward -242 -223 -7.76869 0.245
NP_441559.1_8 Reverse -294 -308 -6.58858 0.279
NP_440997.1_6 Forward -397 -378 10.6192 0.263
NP_442452.1_3 Forward -52 -33 4.32602 0.259
NP_440306.1_5 Forward -350 -331 -2.16383 0.298
NP_440695.1_6 Reverse -89 -103 15.3562 0.188
NP_441199.1_7 Forward -346 -327 3.93269 0.245
NP_442993.1_1 Reverse -230 -246 -9.5779 0.188
NP_442054.1_4 Forward -266 -247 8.55425 0.299
NP_441340.1_9 Forward -350 -340 14.6181 0.194
NP_440161.1_3 Forward -257 -238 8.75091 0.264
NP_442294.1_3 Forward -146 -132 12.5853 0.282
NP_441595.1_2 Reverse -94 -107 13.3352 0.277
NP_441595.1_2 Reverse -83 -96 10.2794 0.277
NP_440408.1_7 Reverse -245 -264 8.06259 0.282
NP_442416.1_1 Forward -107 -88 7.01823 0.255
NP_442384.1_10 Forward -239 -226 0.707601 0.282
NP_440693.1_6 Forward -248 -229 14.5524 0.253
NP_441018.1_7 Reverse -242 -261 7.37428 0.272
NP_440531.1_6 Reverse -205 -224 -1.57384 0.234
NP_441060.1_4 Forward -356 -338 3.85406 0.252
NP_440350.1_5 Reverse -318 -337 -5.21209 0.289
NP_439926.1_7 Forward -335 -317 9.65558 0.204
NP_441592.1_4 Forward -125 -106 -2.16383 0.261
NP_440894.1_2 Forward -146 -127 -0.590531 0.277
NP_443036.1_1 Reverse -173 -192 9.93006 0.269
YP_680420.1_6 Forward -123 -104 20.2548 0.171
NP_440888.1_2 Forward -239 -225 8.75042 0.149
NP_440888.1_2 Forward -228 -214 8.75042 0.149
NP_440060.1_2 Forward -185 -166 16.7149 0.191
NP_440060.1_2 Reverse -238 -257 13.7649 0.288
NP_440237.1_5 Forward -151 -137 10.8154 0.295
NP_441917.1_2 Forward -304 -286 4.73903 0.288
NP_442845.1_2 Reverse -218 -232 4.91614 0.249
NP_441469.1_8 Reverse -56 -65 11.8978 0.141
NP_442337.1_7 Forward -248 -230 19.882 0.0581
NP_441223.1_5 Forward -351 -337 16.7213 0.162
NP_440710.1_1 Forward -236 -218 -9.12563 0.294
NP_443062.1_6 Reverse -39 -58 0.58944 0.292
NP_442428.1_8 Reverse -241 -260 1.57275 0.228
NP_440673.1_3 Forward -54 -47 6.23397 0.283
NP_440077.1_7 Reverse -116 -135 13.6675 0.268
NP_442577.1_9 Reverse -270 -284 10.0287 0.289
NP_442694.1_9 Reverse -342 -361 12.6841 0.207
NP_442206.1_10 Forward -307 -292 0.176559 0.269
NP_442854.1_6 Reverse -219 -238 8.06259 0.229
NP_443054.1_2 Forward -127 -113 4.12949 0.24
NP_441851.1_10 Forward -309 -299 9.7148 0.114
NP_441157.1_1 Reverse -85 -99 7.27547 0.187
NP_442856.1_7 Reverse -142 -161 -3.54046 0.244
NP_440593.1_3 Reverse -294 -313 -7.17871 0.288
NP_441982.1_6 Reverse -131 -140 12.5809 0.274
NP_442689.1_8 Forward -96 -79 7.90532 0.144
NP_442689.1_8 Forward -107 -90 -7.92597 0.292
NP_440431.1_3 Forward -57 -38 -0.4922 0.144
NP_440431.1_4 Forward -350 -331 -8.92892 0.275
NP_442450.1_5 Forward -235 -225 13.2547 0.115
NP_441031.1_8 Reverse -213 -232 4.62101 0.177
NP_440195.1_4 Forward -307 -288 4.52268 0.294
NP_442038.1_1 Forward -107 -88 -0.590531 0.278
NP_441078.1_4 Forward -308 -299 -1.6719 0.266
NP_442729.1_8 Forward -70 -57 7.19745 0.161
NP_441663.1_6 Reverse -238 -257 16.7157 0.196
NP_442348.1_2 Reverse -245 -254 11.6028 0.232
NP_442443.1_1 Forward -262 -243 3.14605 0.177
NP_442443.1_1 Reverse -130 -149 2.16274 0.193
NP_440793.1_1 Reverse -315 -329 9.34041 0.293
NP_441432.1_8 Reverse -298 -307 5.3096 0.17
NP_441030.1_4 Forward -357 -338 5.68135 0.277
NP_440760.1_1 Reverse -299 -318 -16.1268 0.166
NP_442400.1_10 Reverse -81 -94 14.672 0.173
NP_442489.1_7 Forward -308 -299 -1.6719 0.235
NP_441040.1_2 Reverse -241 -260 1.67108 0.119
NP_439956.1_7 Reverse -240 -259 6.39097 0.257
NP_439956.1_7 Reverse -213 -232 2.16274 0.276
NP_440486.1_6 Forward -209 -190 9.93088 0.219
NP_442551.1_2 Forward -91 -73 16.9313 0.182
NP_442311.1_5 Reverse -120 -139 8.45592 0.23
NP_440449.1_6 Forward -316 -298 6.69963 0.241
NP_442140.1_3 Forward -300 -290 3.71661 0.283
NP_441609.1_1 Forward -153 -134 -0.983855 0.251
NP_441239.1_9 Reverse -167 -179 4.66053 0.248
NP_440400.1_1 Reverse -159 -178 4.03023 0.22
NP_440665.1_1 Forward -307 -288 -7.67036 0.224
NP_441617.1_6 Forward -315 -296 -7.27704 0.292
NP_442284.1_3 Reverse -33 -51 15.8504 0.216
NP_440546.1_4 Reverse -224 -234 6.8464 0.276
NP_440546.1_6 Reverse -128 -147 16.5191 0.122
NP_442899.1_4 Reverse -80 -96 10.2842 0.232
NP_441497.1_2 Reverse -331 -350 10.5209 0.221
NP_442679.1_1 Forward -352 -333 2.85105 0.158
NP_442679.1_2 Forward -340 -321 10.0292 0.215
NP_440160.1_2 Forward -234 -215 -0.787193 0.232
NP_441959.1_8 Reverse -83 -96 11.6979 0.286
NP_442532.1_1 Reverse -82 -96 11.3769 0.226
NP_440724.1_5 Forward -338 -320 14.8671 0.262
NP_442533.1_6 Reverse -230 -239 2.26134 0.266
NP_442533.1_6 Forward -233 -224 2.26134 0.266
NP_442533.1_6 Forward -118 -109 1.47469 0.298
NP_442541.1_10 Reverse -145 -159 2.35894 0.262
NP_440263.1_5 Forward -95 -81 9.93102 0.294
NP_440854.1_2 Reverse -299 -318 9.83255 0.26
NP_442229.1_9 Forward -387 -368 17.4032 0.12
NP_441527.1_4 Forward -349 -330 6.06331 0.106
NP_441527.1_4 Forward -340 -321 -6.7326 0.224
NP_441527.1_4 Forward -337 -318 -12.5576 0.291
NP_440007.1_9 Forward -59 -45 5.1128 0.265
NP_440608.1_1 Forward -355 -336 9.99995 0.213
NP_441602.1_3 Forward -313 -294 -2.55715 0.233
NP_441972.1_5 Reverse -115 -134 -6.78538 0.235
NP_441705.1_3 Forward -343 -324 -4.91709 0.291
NP_440028.1_6 Forward -300 -282 12.5072 0.24
NP_442238.1_3 Reverse -219 -238 12.1925 0.133
NP_442238.1_6 Reverse -47 -66 8.69072 0.274
NP_441962.1_4 Reverse -141 -160 -7.96535 0.195
NP_441431.1_2 Forward -232 -218 8.25877 0.221
NP_440358.1_8 Reverse -333 -352 -1.18052 0.274
NP_441272.1_7 Forward -314 -304 13.943 0.257
NP_440293.1_9 Reverse -225 -239 16.2726 0.144
NP_440293.1_10 Forward -163 -144 -0.295539 0.251
NP_441421.1_9 Reverse -82 -101 4.22769 0.226
NP_441246.1_7 Forward -295 -276 9.0459 0.197
NP_439910.1_2 Forward -243 -226 -13.7275 0.162
NP_442867.1_8 Reverse -114 -133 12.8808 0.196
NP_440987.1_4 Reverse -79 -98 3.53937 0.278
NP_441489.1_3 Forward -105 -91 7.84196 0.244
NP_440524.1_2 Forward -54 -35 -3.54046 0.27
NP_442703.1_1 Forward -353 -334 6.63627 0.266
NP_440119.1_1 Reverse -283 -299 2.32015 0.222
NP_442395.2_4 Reverse -145 -164 -0.197979 0.287
NP_440552.1_8 Reverse -338 -355 10.6517 0.262
NP_440312.1_6 Reverse -338 -357 17.0481 0.271
NP_441902.1_3 Forward -331 -321 13.8563 0.226
NP_441207.1_7 Forward -347 -333 10.8044 0.253
NP_440216.1_9 Forward -352 -343 6.39124 0.289
NP_440172.1_1 Reverse -230 -240 2.14332 0.283
NP_440167.1_3 Forward -249 -230 8.16093 0.281
NP_441045.1_1 Reverse -80 -99 14.8474 0.26
NP_441045.1_1 Forward -336 -317 11.1109 0.3
NP_441226.1_7 Reverse -109 -116 7.1186 0.218
NP_442034.1_7 Reverse -131 -149 12.1139 0.218
NP_443052.1_9 Reverse -282 -301 -5.01543 0.265
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATAGCTGTAGGTATCAAGCACAATTTATTGCTATGTAAGGGCTTATTTCCAAAGAAAAATTAAAGAAAGTAGAGGAGAAACGAATTGGTTTTGGCGAATCCCTATGGTGGAGGAGTAGGATTTTAGTAGTTCCGATGAGTGGTCCAACCAATGCCGGAAATAGTCAGCGCCAGCCCTGTGCCAGTGATATGAGTGGTGCAGAGTGGATGAAAAAACTGATAGGGGCATTGGGTCGACTGTAGTGCTGACATTGGGCCACCTTTTTGGCCACTCCAGGCAGGAGCCCGTCCGCTAACTTTGCTGAAATTTTGCTTAATTTTGCGTCTTGATCTACGGGGATTTCAGACCGTTGCCGTTAAAATTAGGGCTAGTGATTAATTGTGACCCTGACTGGTAATCT

CDS

ATGCCTCCTCGTTGGCCCCGTAAACCCGACCGTAATGACCCTGCCTTTCGCCGTTTGGATGACCGGATGAATTTTGCTGTCCATGTGGCAGTATTTTTAGCGATTAACTCTGGCCTATGGTTTGTTCATAACTTAAACAAGGCCGATTGGTCTTGGTTGACACCTCTTTCGGGCATCTGGCTAGGGGGTTTGCTTTTGCACCTGTTGTACATTGCCGTTATTGCCGATTATTCCCCTGCCACTGGTAAGAGTTAA

Protein

MPPRWPRKPDRNDPAFRRLDDRMNFAVHVAVFLAINSGLWFVHNLNKADWSWLTPLSGIWLGGLLLHLLYIAVIADYSPATGKS