Your browser is old and dusty. Try Google Chrome!

Details for sll1746

ORF sll1746
Accession NP_440736.1
Symbol rpl12
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L12
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -227 -241 -1.8687 0.274
NP_440557.1_1 Forward -59 -40 -1.57384 0.276
NP_442100.1_1 Reverse -311 -330 5.87233 0.296
NP_440815.1_2 Reverse -38 -52 12.782 0.256
NP_441453.1_4 Reverse -226 -234 14.8674 0.00947
NP_441453.1_4 Forward -235 -227 6.80426 0.121
NP_441818.1_1 Forward -339 -328 9.10461 0.255
NP_441818.1_6 Forward -242 -228 11.0127 0.253
NP_440226.1_1 Forward -235 -216 10.1275 0.0654
NP_440226.1_1 Reverse -226 -245 6.4893 0.128
NP_441630.1_8 Forward -191 -172 17.4032 0.219
NP_442173.1_1 Forward -234 -226 13.8841 0.0225
NP_442173.1_1 Reverse -227 -235 12.0158 0.0316
NP_442752.1_4 Forward -235 -228 13.8055 0.0199
NP_443027.1_4 Forward -237 -227 5.78156 0.298
NP_442975.1_10 Reverse -222 -236 9.73373 0.0646
NP_440784.1_7 Forward -234 -227 6.23397 0.241
NP_440784.1_7 Reverse -227 -234 6.13563 0.241
NP_442000.2_10 Reverse -107 -125 4.34571 0.296
NP_440061.1_9 Reverse -224 -238 8.16044 0.18
NP_440061.1_9 Forward -177 -163 7.86545 0.189
NP_440061.1_9 Reverse -329 -343 7.66879 0.198
NP_442062.1_8 Forward -235 -225 9.7148 0.0559
NP_442062.1_8 Reverse -171 -181 8.33817 0.0769
NP_440839.1_4 Forward -185 -166 11.5033 0.268
NP_440304.1_4 Forward -237 -227 9.22315 0.06
NP_440304.1_4 Reverse -152 -162 4.60159 0.258
NP_442110.1_7 Reverse -226 -240 0.589577 0.256
NP_440300.1_1 Reverse -266 -285 10.2251 0.225
NP_441083.1_5 Reverse -226 -236 0.766681 0.218
NP_441083.1_5 Forward -235 -225 -1.00328 0.289
NP_441434.1_3 Forward -265 -246 1.76941 0.194
NP_441738.1_2 Reverse -228 -235 15.28 0.0102
NP_441558.1_2 Reverse -175 -194 9.0459 0.207
NP_441645.1_6 Reverse -273 -287 11.897 0.241
NP_440209.1_1 Forward -235 -227 8.57422 0.0425
NP_440056.1_1 Forward -252 -233 16.7157 0.0962
NP_440178.1_7 Reverse -225 -244 -21.4367 0.223
NP_440906.1_5 Forward -234 -227 6.23397 0.234
NP_440906.1_5 Reverse -227 -234 6.13563 0.241
NP_441130.1_10 Reverse -277 -291 4.71948 0.27
NP_441486.1_1 Forward -238 -224 -3.83532 0.183
NP_441486.1_1 Reverse -223 -237 -5.90027 0.266
NP_442848.1_9 Reverse -115 -134 5.50599 0.202
NP_443018.1_3 Reverse -227 -234 11.7405 0.0655
NP_443018.1_3 Forward -396 -389 7.11894 0.16
NP_443018.1_3 Forward -234 -227 5.44732 0.193
NP_441634.1_8 Reverse -119 -133 2.16287 0.17
NP_441634.1_8 Reverse -103 -117 -2.65535 0.295
NP_441643.1_8 Forward -299 -280 8.35759 0.264
NP_440376.1_1 Forward -235 -226 5.89959 0.116
NP_440376.1_1 Reverse -226 -235 -0.0986038 0.285
NP_440376.1_1 Reverse -248 -257 -0.393597 0.289
NP_441588.1_4 Forward -233 -223 7.45319 0.178
NP_442687.1_7 Forward -236 -226 5.78156 0.188
NP_442191.1_4 Reverse -100 -114 11.3809 0.262
NP_442485.1_3 Forward -186 -167 -4.03212 0.277
NP_442958.1_3 Forward -246 -227 -0.983855 0.268
NP_442583.1_1 Reverse -305 -324 12.0942 0.291
NP_442766.1_6 Forward -135 -121 16.5185 0.272
NP_441422.1_7 Reverse -224 -241 3.28376 0.112
NP_441422.1_7 Forward -122 -105 -3.00942 0.226
NP_441029.1_4 Reverse -167 -186 -3.93378 0.292
NP_440360.1_10 Reverse -228 -242 6.78443 0.227
NP_442658.1_1 Forward -237 -227 6.17443 0.235
NP_442658.1_1 Reverse -224 -234 5.38779 0.269
NP_442205.1_9 Forward -241 -225 -0.531451 0.264
NP_441958.1_5 Forward -236 -226 17.6796 0.00183
NP_441127.1_1 Reverse -187 -201 8.06273 0.3
NP_442836.1_5 Forward -379 -360 6.88262 0.171
NP_440373.1_2 Forward -322 -303 14.4483 0.257
NP_440950.1_8 Forward -310 -291 8.95116 0.3
NP_440950.1_8 Reverse -34 -53 8.95116 0.3
NP_440203.1_5 Forward -178 -168 14.5325 0.0886
NP_440203.1_5 Forward -160 -150 13.8442 0.11
NP_440203.1_5 Reverse -229 -239 9.51767 0.254
NP_439905.1_1 Reverse -227 -240 17.4239 0.0398
NP_440995.1_8 Reverse -216 -235 1.27776 0.264
NP_442690.1_1 Forward -330 -311 -8.752 0.189
NP_441591.1_10 Reverse -102 -121 9.93088 0.197
NP_443055.1_6 Reverse -218 -236 0.411736 0.243
NP_443055.1_6 Reverse -226 -244 -2.34152 0.294
NP_440993.1_2 Reverse -221 -237 2.12349 0.269
NP_442995.1_7 Forward -248 -229 15.5357 0.26
NP_442002.1_1 Forward -290 -272 18.5054 0.0351
NP_442002.1_9 Reverse -153 -160 12.4288 0.185
NP_441294.1_7 Reverse -222 -236 10.9784 0.161
NP_441000.1_6 Forward -236 -222 -4.81863 0.252
NP_442870.1_4 Reverse -300 -314 15.0442 0.289
NP_441110.1_1 Reverse -145 -164 5.40766 0.282
NP_441674.1_4 Reverse -364 -383 5.89931 0.228
NP_440147.1_4 Reverse -224 -237 9.55739 0.0392
NP_441550.1_8 Forward -237 -227 16.2041 0.0132
NP_441916.1_7 Reverse -226 -236 10.0098 0.0283
NP_441916.1_7 Forward -235 -225 6.66654 0.0875
NP_441916.1_10 Forward -266 -247 0.491109 0.281
NP_440345.1_3 Forward -306 -292 10.1338 0.29
NP_441041.1_4 Reverse -226 -245 -10.227 0.228
NP_441041.1_7 Reverse -223 -235 8.38938 0.137
NP_442004.1_6 Reverse -226 -240 7.9644 0.15
NP_441725.1_5 Forward -162 -152 -0.0199663 0.223
NP_441725.1_5 Reverse -227 -237 -0.904945 0.274
NP_439966.1_7 Forward -237 -227 4.10949 0.289
NP_439966.1_9 Forward -237 -228 0.983037 0.253
NP_440736.1_1 Forward -153 -134 29.5971 0.000599
NP_440736.1_2 Forward -195 -176 30.4821 0.000274
NP_440736.1_3 Forward -237 -218 28.4171 0.00157
NP_440736.1_4 Forward -306 -287 29.5962 0.000476
NP_440736.1_5 Forward -282 -263 24.4839 0.0165
NP_440736.1_6 Forward -174 -155 26.9421 0.00342
NP_440736.1_7 Forward -216 -197 26.1555 0.00445
NP_440736.1_8 Forward -329 -310 22.0377 0.095
NP_440736.1_10 Forward -125 -107 23.5203 0.0306
NP_440736.1_10 Forward -341 -323 14.5721 0.293
NP_440736.1_10 Forward -158 -140 12.9988 0.293
NP_442941.1_3 Reverse -227 -237 1.16001 0.15
NP_442281.1_1 Reverse -221 -235 20.3534 0.00192
NP_442281.1_1 Forward -296 -282 1.67063 0.293
NP_441334.1_7 Reverse -224 -243 -12.6852 0.166
NP_442012.1_1 Reverse -165 -184 7.7676 0.108
NP_441556.1_7 Forward -124 -105 0.785326 0.29
NP_442068.1_4 Reverse -337 -356 11.2084 0.16
NP_441644.1_6 Reverse -226 -236 16.4008 0.00405
NP_441644.1_6 Forward -123 -113 8.3377 0.103
NP_443049.1_1 Forward -118 -99 14.8474 0.29
NP_442215.1_2 Forward -165 -149 -5.74299 0.256
NP_440253.1_2 Forward -235 -217 7.39397 0.0717
NP_440929.1_8 Reverse -226 -235 7.17789 0.0713
NP_442933.1_10 Reverse -226 -235 8.06287 0.0885
NP_442933.1_10 Forward -235 -226 7.96454 0.0937
NP_441751.2_8 Reverse -227 -241 -6.68692 0.277
NP_442926.1_3 Forward -246 -227 2.16274 0.295
NP_442554.1_8 Reverse -227 -237 9.32148 0.0608
NP_442554.1_8 Reverse -167 -177 2.04498 0.285
NP_442554.1_8 Forward -156 -146 1.84832 0.292
NP_442863.1_5 Forward -246 -227 17.5024 0.169
NP_441762.1_7 Reverse -225 -237 3.67722 0.0676
NP_441762.1_7 Forward -236 -224 -6.94252 0.284
NP_442292.1_1 Reverse -227 -236 7.66954 0.0634
NP_442292.1_5 Forward -200 -181 7.57094 0.15
NP_440919.1_1 Forward -240 -221 -0.197208 0.221
NP_443009.1_5 Forward -236 -225 8.80962 0.099
NP_440183.1_1 Forward -168 -149 5.40766 0.282
NP_440183.1_9 Forward -194 -175 -8.26035 0.226
NP_441198.1_4 Forward -282 -263 11.8975 0.241
NP_441198.1_8 Forward -237 -227 11.0251 0.228
NP_441468.1_1 Forward -234 -227 6.13563 0.209
NP_441468.1_1 Reverse -227 -234 6.0373 0.223
NP_441020.2_6 Forward -237 -220 13.0185 0.0819
NP_441015.1_10 Forward -246 -227 -4.32711 0.202
NP_441015.1_10 Forward -240 -221 -5.01543 0.215
NP_441673.1_1 Forward -235 -226 1.27803 0.155
NP_441673.1_1 Reverse -226 -235 1.27803 0.155
NP_441826.1_2 Reverse -148 -162 -4.4253 0.296
NP_442719.1_2 Forward -326 -308 -11.2896 0.291
NP_441251.1_7 Reverse -305 -318 14.7689 0.266
NP_442808.1_1 Reverse -225 -235 10.501 0.0481
NP_442050.1_5 Forward -237 -227 7.45273 0.256
NP_440630.1_3 Forward -186 -167 6.78429 0.168
NP_440558.1_2 Forward -184 -165 2.26107 0.169
NP_440558.1_2 Reverse -162 -181 -2.55715 0.229
NP_440558.1_2 Reverse -183 -202 -3.14714 0.234
NP_440558.1_2 Forward -127 -108 -5.01543 0.251
NP_440558.1_2 Reverse -144 -163 -5.99873 0.269
NP_442593.1_1 Forward -376 -357 19.9606 0.193
NP_442593.1_9 Forward -203 -184 18.8944 0.257
NP_441036.1_8 Forward -236 -226 10.5014 0.167
NP_441036.1_8 Reverse -225 -235 8.1415 0.176
NP_441557.1_5 Forward -235 -226 8.94785 0.0289
NP_441557.1_5 Reverse -226 -235 0.688044 0.128
NP_441590.1_4 Reverse -167 -186 7.4718 0.249
NP_442777.1_3 Forward -182 -164 13.7847 0.147
NP_441308.1_8 Forward -237 -227 10.7964 0.22
NP_442183.1_1 Reverse -226 -240 5.50613 0.215
NP_441574.1_1 Forward -247 -228 -0.983855 0.211
NP_442347.1_2 Reverse -143 -152 8.06287 0.116
NP_442645.1_2 Forward -243 -224 -12.1936 0.144
NP_440547.1_5 Forward -162 -143 9.24257 0.225
NP_442888.1_6 Reverse -47 -66 1.17943 0.298
NP_441037.1_4 Forward -237 -227 7.51261 0.237
NP_441633.1_3 Reverse -224 -237 -4.11062 0.181
NP_440136.1_2 Forward -234 -227 6.23397 0.171
NP_440136.1_2 Reverse -227 -234 6.13563 0.193
NP_442998.1_10 Reverse -228 -235 15.5754 0.0102
NP_442998.1_10 Forward -161 -154 9.28223 0.117
NP_440899.1_1 Forward -186 -167 21.0944 0.0147
NP_440299.1_1 Forward -377 -364 5.32859 0.18
NP_441799.1_1 Forward -239 -225 9.53707 0.0901
NP_441799.1_1 Reverse -222 -236 8.55376 0.112
NP_441799.1_4 Reverse -172 -191 -1.96717 0.203
NP_441007.1_10 Forward -240 -227 13.1956 0.0499
NP_441559.1_8 Forward -125 -111 -7.37523 0.291
NP_441179.1_6 Reverse -292 -311 16.7157 0.295
NP_442069.1_7 Reverse -224 -243 15.3382 0.201
NP_442866.1_1 Forward -240 -221 -7.76869 0.268
NP_441464.1_8 Reverse -187 -201 5.89945 0.248
NP_440695.1_6 Forward -318 -304 12.3505 0.26
NP_440695.1_6 Forward -37 -23 9.92656 0.276
NP_441494.1_6 Forward -240 -227 8.57408 0.23
NP_442993.1_1 Forward -235 -219 1.73016 0.0502
NP_442386.1_9 Reverse -225 -234 12.8806 0.0501
NP_440570.1_5 Forward -251 -232 -2.45882 0.279
NP_441340.1_5 Forward -234 -227 13.5105 0.0314
NP_441340.1_5 Reverse -227 -234 5.84064 0.208
NP_442791.1_5 Forward -188 -169 -9.24366 0.279
NP_440327.1_6 Reverse -232 -251 8.55425 0.218
NP_440586.1_8 Reverse -227 -234 9.47853 0.146
NP_440586.1_8 Forward -234 -227 5.74197 0.283
NP_442251.1_6 Forward -162 -155 6.43063 0.298
NP_440684.1_9 Reverse -105 -119 6.88276 0.288
NP_441262.1_3 Forward -235 -228 14.7888 0.0223
NP_440027.1_3 Reverse -114 -132 7.09821 0.214
NP_440027.1_3 Reverse -171 -189 3.36165 0.273
NP_443051.1_1 Forward -236 -227 16.6177 0.00754
NP_439937.1_8 Forward -246 -227 4.916 0.199
NP_439937.1_9 Forward -78 -61 -12.9415 0.278
NP_440408.1_3 Reverse -154 -173 -6.1954 0.295
NP_440439.1_1 Forward -238 -225 18.2105 0.0105
NP_440372.1_2 Forward -234 -227 13.8055 0.0214
NP_440372.1_2 Reverse -227 -234 6.52896 0.188
NP_440372.1_3 Forward -324 -310 15.0993 0.165
NP_440171.1_3 Reverse -63 -82 1.67108 0.294
NP_441138.1_5 Forward -56 -43 9.89744 0.238
NP_440139.1_1 Forward -169 -150 0.490334 0.291
NP_442384.1_10 Reverse -226 -239 5.42749 0.13
NP_442114.1_8 Reverse -41 -55 9.53707 0.234
NP_442262.1_10 Reverse -227 -234 13.2155 0.0213
NP_442262.1_10 Forward -396 -389 8.20058 0.25
NP_441689.1_5 Forward -237 -227 5.87944 0.197
NP_442244.1_6 Forward -169 -150 -0.0988766 0.291
NP_440163.1_10 Reverse -361 -371 9.61647 0.229
NP_440297.1_9 Reverse -167 -177 0.176696 0.282
NP_440350.1_5 Forward -55 -36 5.01433 0.158
NP_441896.1_3 Forward -244 -225 -0.39387 0.239
NP_442378.1_7 Forward -73 -60 20.5698 0.171
NP_440834.1_8 Reverse -178 -197 17.109 0.207
NP_440999.1_9 Forward -124 -110 -1.77037 0.249
NP_440999.1_9 Reverse -225 -239 -1.96703 0.254
NP_440888.1_2 Reverse -226 -240 10.422 0.0946
NP_440792.1_5 Forward -234 -215 7.57094 0.237
NP_442147.1_7 Forward -237 -218 9.93088 0.253
NP_439969.1_3 Forward -135 -116 -0.590531 0.271
NP_441257.1_1 Reverse -304 -321 16.4593 0.213
NP_441543.1_2 Reverse -227 -236 6.09625 0.153
NP_441543.1_2 Forward -234 -225 6.09625 0.153
NP_441543.1_4 Reverse -107 -125 6.70565 0.171
NP_442845.1_2 Forward -241 -227 8.65272 0.19
NP_441551.1_5 Reverse -162 -178 7.92432 0.241
NP_442701.1_2 Forward -319 -301 3.26407 0.282
NP_442710.1_6 Forward -332 -313 9.73422 0.204
NP_442578.1_7 Forward -234 -227 6.0373 0.18
NP_440220.1_4 Reverse -375 -394 7.96345 0.176
NP_441462.1_2 Forward -235 -225 8.82982 0.03
NP_441462.1_2 Reverse -226 -236 0.668351 0.135
NP_443062.1_1 Reverse -142 -160 3.37804 0.3
NP_443062.1_6 Reverse -356 -375 8.35759 0.146
NP_442204.1_1 Forward -239 -228 0.353664 0.281
NP_441351.1_8 Forward -189 -170 11.7008 0.141
NP_440454.1_1 Reverse -299 -318 8.44315 0.291
NP_440516.1_8 Forward -235 -226 9.4395 0.0183
NP_440516.1_8 Reverse -226 -235 5.11294 0.118
NP_442428.1_5 Forward -234 -227 6.13563 0.209
NP_442428.1_5 Reverse -227 -234 6.0373 0.212
NP_441443.1_1 Reverse -67 -86 -5.60541 0.298
NP_440618.1_1 Forward -187 -168 -1.7705 0.182
NP_442120.1_10 Reverse -127 -146 -5.80207 0.203
NP_440673.1_3 Reverse -228 -235 12.4288 0.0426
NP_441052.1_2 Forward -120 -110 -0.511621 0.282
NP_442219.1_8 Forward -191 -172 8.55364 0.245
NP_440436.1_4 Forward -234 -225 7.37413 0.132
NP_441884.1_8 Reverse -237 -256 -9.34199 0.268
NP_441884.1_9 Reverse -223 -242 -24.0916 0.284
NP_441719.1_4 Forward -234 -227 6.82395 0.0855
NP_441719.1_4 Reverse -227 -234 6.52896 0.188
NP_441733.1_10 Forward -238 -225 8.77074 0.135
NP_441004.1_1 Reverse -148 -167 -16.2252 0.283
NP_442366.1_3 Forward -236 -218 0.117479 0.178
NP_442206.1_10 Reverse -166 -181 2.73316 0.198
NP_442206.1_10 Forward -235 -220 0.963207 0.241
NP_440328.1_4 Reverse -220 -239 3.04771 0.186
NP_443054.1_2 Reverse -217 -231 3.14618 0.24
NP_443054.1_2 Forward -378 -364 2.06454 0.245
NP_441851.1_3 Reverse -94 -113 8.45592 0.299
NP_441851.1_9 Forward -160 -141 7.17762 0.282
NP_442622.1_1 Forward -236 -217 -11.9969 0.257
NP_442515.1_1 Reverse -77 -91 -2.16369 0.271
NP_441683.1_7 Forward -276 -257 -8.55534 0.284
NP_440355.1_2 Reverse -303 -322 11.8967 0.285
NP_442689.1_8 Forward -205 -188 -6.746 0.288
NP_441349.1_10 Reverse -167 -186 -6.1954 0.223
NP_442843.1_1 Forward -204 -185 -2.26216 0.203
NP_442843.1_1 Forward -234 -215 -10.817 0.281
NP_440474.1_8 Reverse -227 -241 4.91554 0.263
NP_440588.1_2 Reverse -102 -121 -4.6221 0.223
NP_442006.1_2 Forward -253 -236 -14.8091 0.21
NP_441078.1_4 Reverse -226 -235 0.0980582 0.205
NP_441078.1_4 Forward -235 -226 0.0980582 0.205
NP_440539.1_9 Forward -251 -232 -1.37718 0.286
NP_440707.1_9 Forward -243 -224 1.27776 0.292
NP_441432.1_8 Forward -236 -227 14.0611 0.0258
NP_442320.1_8 Reverse -220 -234 -5.21195 0.209
NP_440131.1_2 Forward -196 -177 7.96426 0.279
NP_442489.1_7 Reverse -226 -235 0.786375 0.152
NP_442489.1_7 Forward -235 -226 0.589713 0.17
NP_440559.1_1 Forward -234 -225 6.09625 0.134
NP_441659.2_8 Reverse -226 -236 15.5163 0.006
NP_441040.1_2 Reverse -179 -198 -12.6852 0.26
NP_442008.1_2 Reverse -117 -136 5.30933 0.226
NP_440335.1_9 Reverse -39 -57 15.6538 0.184
NP_442346.1_5 Forward -236 -226 6.66654 0.195
NP_442346.1_10 Forward -186 -167 0.392778 0.242
NP_440459.1_2 Reverse -112 -129 8.10198 0.27
NP_440449.1_6 Forward -131 -113 10.0066 0.164
NP_441833.1_4 Reverse -227 -234 6.52896 0.0924
NP_441833.1_4 Forward -234 -227 6.23397 0.163
NP_441329.1_6 Forward -272 -253 -3.10391 0.296
NP_442162.1_9 Forward -234 -227 12.9205 0.0282
NP_442162.1_9 Reverse -227 -234 12.9205 0.0282
NP_440671.1_2 Forward -193 -179 14.3559 0.265
NP_442199.1_5 Reverse -329 -348 -7.17871 0.288
NP_442140.1_3 Forward -234 -224 6.66654 0.159
NP_442140.1_3 Reverse -227 -237 5.87989 0.194
NP_440875.1_9 Reverse -228 -238 14.5042 0.0411
NP_440875.1_9 Forward -178 -168 8.5667 0.233
NP_441813.1_5 Reverse -224 -234 5.97822 0.105
NP_440567.1_1 Reverse -227 -241 8.84938 0.0528
NP_442497.1_10 Reverse -227 -236 7.76787 0.0731
NP_442497.1_10 Forward -234 -225 -1.18024 0.256
NP_440821.1_4 Forward -237 -227 1.06167 0.142
NP_441239.1_9 Reverse -224 -236 9.47875 0.105
NP_441239.1_9 Forward -177 -165 7.11881 0.169
NP_441239.1_9 Forward -237 -225 3.57889 0.283
NP_442193.1_8 Forward -123 -104 13.47 0.214
NP_441541.1_5 Forward -64 -45 12.5858 0.276
NP_442216.1_4 Reverse -268 -276 8.1805 0.255
NP_440354.1_7 Forward -241 -223 17.3254 0.167
NP_440546.1_4 Forward -235 -225 14.5061 0.0459
NP_440546.1_4 Reverse -226 -236 11.6943 0.0748
NP_442041.1_5 Forward -186 -167 6.19431 0.218
NP_440462.1_4 Forward -289 -275 11.996 0.205
NP_440462.1_6 Forward -237 -227 9.91146 0.0429
NP_440462.1_6 Reverse -224 -234 5.38824 0.156
NP_442340.1_3 Forward -173 -154 -9.83364 0.275
NP_442340.1_3 Reverse -228 -247 -10.227 0.284
NP_440868.1_4 Forward -239 -227 16.4603 0.0149
NP_442402.1_4 Forward -81 -62 -5.99948 0.249
NP_442402.1_4 Forward -80 -61 -6.49113 0.259
NP_441084.1_6 Forward -237 -223 10.7985 0.228
NP_441084.1_6 Reverse -145 -159 9.24716 0.29
NP_442039.1_4 Forward -234 -227 11.6422 0.0747
NP_442039.1_7 Reverse -390 -400 10.5998 0.257
NP_442829.1_2 Forward -318 -302 9.20406 0.287
NP_442837.1_3 Forward -234 -227 6.0373 0.25
NP_442837.1_3 Reverse -227 -234 6.0373 0.25
NP_440160.1_2 Reverse -153 -172 -5.11376 0.269
NP_440160.1_9 Forward -163 -144 9.3409 0.241
NP_442053.1_1 Reverse -226 -235 7.17789 0.104
NP_440505.1_3 Forward -237 -227 13.8447 0.0247
NP_441102.1_2 Forward -95 -76 5.70265 0.298
NP_442532.1_4 Reverse -300 -318 11.6493 0.234
NP_440914.1_1 Reverse -226 -236 13.1043 0.0386
NP_441011.1_8 Forward -234 -225 14.651 0.023
NP_441011.1_8 Reverse -227 -236 6.78456 0.184
NP_442533.1_6 Forward -235 -226 5.40793 0.14
NP_442533.1_6 Reverse -226 -235 4.52295 0.179
NP_442533.1_6 Reverse -148 -157 1.57302 0.294
NP_442232.1_3 Forward -342 -323 -0.4922 0.151
NP_442232.1_3 Reverse -103 -122 -15.8318 0.296
NP_442229.1_1 Forward -237 -223 11.012 0.18
NP_443016.1_1 Reverse -220 -239 -8.26035 0.296
NP_439944.1_9 Reverse -227 -237 7.94484 0.123
NP_441028.1_6 Forward -81 -71 3.51951 0.292
NP_441527.1_4 Forward -307 -288 -8.92892 0.253
NP_440115.1_6 Forward -238 -228 16.008 0.0325
NP_440608.1_1 Forward -313 -294 5.7204 0.268
NP_441602.1_3 Forward -240 -221 -1.37718 0.226
NP_441106.1_1 Forward -236 -227 8.75118 0.0469
NP_441106.1_1 Reverse -225 -234 7.66954 0.0776
NP_439903.1_6 Forward -184 -165 -0.886293 0.287
NP_442588.1_6 Reverse -145 -164 -1.96717 0.28
NP_440670.1_8 Forward -235 -226 8.65285 0.0627
NP_440670.1_8 Reverse -226 -235 6.29291 0.124
NP_441930.1_3 Forward -320 -301 4.0221 0.276
NP_440886.1_7 Reverse -225 -235 7.74772 0.0843
NP_440886.1_7 Forward -377 -367 3.91283 0.26
NP_440828.1_4 Forward -191 -172 -3.04956 0.229
NP_442072.1_9 Reverse -218 -236 -22.9903 0.271
NP_441808.1_8 Forward -198 -179 6.4893 0.288
NP_440907.2_8 Reverse -227 -237 17.3841 0.00764
NP_441021.1_1 Reverse -227 -246 -10.3253 0.234
NP_442893.1_4 Forward -209 -190 -0.29631 0.252
NP_441626.1_2 Forward -234 -227 12.2322 0.0511
NP_441626.1_2 Reverse -227 -234 5.93897 0.231
NP_442365.1_5 Reverse -365 -384 15.6341 0.0883
NP_442365.1_7 Reverse -144 -163 -2.26216 0.199
NP_441962.1_4 Reverse -116 -135 -13.3736 0.272
NP_440387.1_1 Reverse -226 -242 3.00846 0.0671
NP_441431.1_2 Forward -238 -224 14.0603 0.0743
NP_441431.1_2 Reverse -223 -237 9.83206 0.176
NP_441488.1_7 Forward -241 -222 3.44104 0.226
NP_440634.1_7 Reverse -145 -164 18.0924 0.0885
NP_441174.1_2 Reverse -168 -182 11.701 0.286
NP_440467.1_3 Reverse -143 -162 11.4516 0.275
NP_440114.1_10 Reverse -226 -240 13.9626 0.0464
NP_440114.1_10 Forward -235 -221 12.291 0.0866
NP_442698.1_10 Forward -127 -108 4.22769 0.279
NP_441206.1_7 Reverse -220 -238 5.42735 0.2
NP_440287.1_6 Forward -237 -218 3.04771 0.226
NP_440293.1_3 Reverse -164 -183 -4.91709 0.268
NP_440766.1_2 Forward -398 -382 17.2657 0.203
NP_440766.1_4 Forward -239 -225 10.4227 0.0871
NP_439988.1_7 Reverse -228 -242 15.5352 0.292
NP_440422.1_10 Reverse -289 -308 10.1138 0.2
NP_439910.1_2 Reverse -218 -235 -21.594 0.183
NP_442867.1_8 Reverse -236 -255 5.50599 0.276
NP_440457.1_1 Forward -239 -227 2.49725 0.21
NP_440798.1_6 Reverse -227 -240 0.707601 0.251
NP_442680.1_5 Forward -324 -305 3.29601 0.236
NP_441984.1_3 Reverse -110 -128 5.52568 0.282
NP_441436.1_6 Reverse -171 -190 8.35759 0.26
NP_442439.1_8 Forward -332 -313 7.17762 0.295
NP_440554.1_4 Reverse -227 -237 12.4681 0.0323
NP_441885.1_5 Forward -235 -225 7.94484 0.0385
NP_440478.1_10 Forward -132 -118 8.65272 0.257
NP_442341.1_7 Forward -377 -363 4.71948 0.181
NP_441173.1_9 Forward -71 -63 10.8354 0.243
NP_442395.2_4 Reverse -153 -172 0.195343 0.276
NP_443000.1_7 Forward -237 -227 1.06167 0.274
NP_441842.1_1 Reverse -228 -241 14.5717 0.102
NP_441842.1_10 Forward -242 -228 11.8976 0.115
NP_440275.1_3 Forward -237 -227 16.1063 0.0155
NP_440091.1_1 Reverse -222 -234 3.57889 0.155
NP_440679.1_10 Reverse -168 -187 -11.2103 0.182
NP_441105.1_3 Forward -162 -143 -5.70374 0.223
NP_441105.1_3 Reverse -100 -119 -9.53865 0.29
NP_440216.1_9 Forward -396 -387 8.25953 0.286
NP_440216.1_9 Forward -395 -386 6.48957 0.289
NP_440172.1_1 Reverse -226 -236 4.89658 0.162
NP_441226.1_7 Forward -234 -227 12.7234 0.0312
NP_441226.1_7 Reverse -227 -234 11.5435 0.0757
NP_441111.1_7 Reverse -227 -235 8.86921 0.0589
NP_441766.1_2 Forward -235 -226 8.1612 0.0645
NP_441766.1_2 Reverse -226 -235 5.89959 0.103
NP_441766.1_2 Forward -120 -111 1.37636 0.294
NP_442417.1_5 Forward -291 -277 4.42448 0.299
NP_440416.1_1 Forward -235 -216 -12.7836 0.272
NP_440416.1_9 Reverse -104 -123 -18.4868 0.259
NP_443052.1_8 Reverse -216 -235 -9.93197 0.198
NP_440261.1_5 Reverse -227 -240 -3.12731 0.115
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCTCCCATGGAAGAATTTCTGACGGGAACCACCGCTATTCTTGTCTTGAAAGAAGACCTGGGCGGCGCAATTAAGGCTTACAAAAAATTCCAGAAAGATACCAAAAAAACCGAACTACGGGGTGGGGTATTAGAAGGAAAAAGCCTAACCCAAGCTGACGTGGAGGCGATCGGTGATTTGCCTTCCAAAGAGCAACTTATGGGTCAAATTGCCGGCGGCATCAATGCCCTGGCTACCAAGATTGCCCTGGGCATCAAAGAAGTTCCAGCTTCCGTGGCCCGTGGTCTCCAAGCCCATGTGGACAAAGAATAGGGTTGTTTTCACCCTGTTCACCCCAAAGTCATTTGTTTTTGGTTTGTCTAATCAGATTTAACCTACTTACCTATAGGAGTCATTTCT

CDS

ATGTCCGCTGCAACCGATCAAATTTTAGAACAGTTAAAAAGTCTTTCCTTGTTGGAAGCTTCCGAGTTAGTTAAACAAATCGAAGAAGCTTTTGGTGTTAGCGCCGCTGCCCCCGTTGGTGGCATGGTTATGGCCGCCGCTGCCGCTGCCCCCGCCGAAGCCGCTGAGGAAAAAACTGAATTCGACGTTATCCTCGAAGAAGTTCCTGCCGACAAGAAAATTGCTGTGCTGAAAGTTGTCCGCACCATCACCGGTTTGGGTCTGAAAGAAGCCAAAGAATTGGTGGAATCCACCCCCAAAGCCATCAAAGAAGCTACCGGTAAAGATGATGCTGAAGCCATCAAAAAACAAATCGAAGAAGCTGGTGGTAAAGCCGCTGTTAAATAA

Protein

MSAATDQILEQLKSLSLLEASELVKQIEEAFGVSAAAPVGGMVMAAAAAAPAEAAEEKTEFDVILEEVPADKKIAVLKVVRTITGLGLKEAKELVESTPKAIKEATGKDDAEAIKKQIEEAGGKAAVK