Your browser is old and dusty. Try Google Chrome!

Details for sll1745

ORF sll1745
Accession NP_440737.1
Symbol rpl10
Category Ribosomal proteins: synthesis and modification
Definition 50S ribosomal protein L10
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -63 -77 17.5025 0.0786
NP_441061.1_2 Forward -71 -57 2.65453 0.173
NP_441061.1_2 Reverse -64 -78 2.45787 0.176
NP_441061.1_2 Reverse -187 -201 0.196253 0.215
NP_440557.1_1 Forward -71 -52 3.6377 0.2
NP_440795.1_7 Forward -71 -64 14.6904 0.0123
NP_440795.1_7 Reverse -64 -71 14.6904 0.0123
NP_441418.1_6 Reverse -63 -82 -9.34199 0.0278
NP_441418.1_6 Forward -72 -53 -20.3551 0.111
NP_443032.1_8 Forward -284 -265 1.0811 0.238
NP_442291.1_5 Reverse -22 -38 -3.77637 0.252
NP_442291.1_7 Forward -82 -68 9.73436 0.26
NP_441453.1_1 Forward -79 -61 4.54162 0.258
NP_441453.1_4 Reverse -63 -71 16.539 0.00633
NP_441453.1_4 Forward -72 -64 16.539 0.00633
NP_441453.1_7 Reverse -13 -20 12.9205 0.23
NP_442151.1_6 Forward -72 -58 20.0591 0.0045
NP_440226.1_1 Forward -72 -53 7.07928 0.114
NP_441465.1_8 Reverse -349 -367 8.37728 0.235
NP_441630.1_3 Reverse -352 -371 5.60432 0.138
NP_440150.1_6 Forward -75 -56 2.16274 0.276
NP_442744.1_8 Forward -72 -53 -6.68705 0.297
NP_442655.1_1 Forward -77 -58 1.37609 0.238
NP_442173.1_1 Forward -71 -63 15.4574 0.00633
NP_442173.1_1 Reverse -64 -72 15.4574 0.00633
NP_442752.1_4 Forward -72 -65 13.8055 0.0199
NP_442752.1_4 Reverse -63 -70 13.8055 0.0199
NP_443027.1_4 Forward -74 -64 11.8781 0.0872
NP_443027.1_4 Reverse -290 -300 6.8632 0.262
NP_442975.1_10 Forward -76 -62 5.21053 0.228
NP_440784.1_7 Forward -71 -64 15.9687 0.0123
NP_440784.1_7 Reverse -64 -71 15.9687 0.0123
NP_440061.1_9 Reverse -61 -75 11.602 0.107
NP_440061.1_9 Forward -74 -60 10.8154 0.122
NP_441476.1_5 Forward -77 -58 -2.65548 0.231
NP_441476.1_5 Reverse -58 -77 -3.14714 0.233
NP_439979.1_2 Reverse -63 -82 10.2259 0.205
NP_440878.1_9 Reverse -53 -72 6.19431 0.174
NP_440878.1_9 Forward -82 -63 4.42435 0.174
NP_442062.1_8 Reverse -63 -73 19.4496 0.000558
NP_442062.1_8 Forward -72 -62 17.3846 0.00193
NP_441859.1_3 Reverse -170 -189 3.63691 0.238
NP_440304.1_4 Reverse -358 -368 7.35486 0.118
NP_440304.1_4 Forward -74 -64 1.84832 0.299
NP_440304.1_4 Reverse -61 -71 1.84832 0.299
NP_442242.1_4 Forward -71 -64 14.3954 0.0124
NP_442242.1_4 Reverse -64 -71 14.3954 0.0124
NP_440044.1_8 Forward -37 -18 -0.590531 0.224
NP_441208.1_9 Reverse -60 -74 14.6509 0.0953
NP_441594.1_6 Forward -189 -170 3.83436 0.225
NP_440132.1_1 Reverse -185 -203 10.0489 0.223
NP_442110.1_7 Forward -72 -58 10.6193 0.0644
NP_442110.1_7 Reverse -63 -77 3.04785 0.218
NP_442110.1_7 Forward -78 -64 -0.590395 0.295
NP_441082.1_10 Reverse -13 -26 18.5055 0.135
NP_440014.1_7 Reverse -54 -68 15.7319 0.276
NP_440856.1_7 Reverse -60 -79 -6.88371 0.246
NP_441083.1_5 Forward -72 -62 20.3345 0.00053
NP_441083.1_5 Reverse -63 -73 11.3864 0.0159
NP_441083.1_5 Reverse -108 -118 4.20827 0.153
NP_442827.1_8 Forward -377 -358 6.48849 0.106
NP_441434.1_7 Reverse -65 -79 7.76774 0.225
NP_441738.1_2 Forward -70 -63 15.28 0.0102
NP_441738.1_2 Reverse -65 -72 15.28 0.0102
NP_441738.1_2 Reverse -110 -117 8.29857 0.176
NP_441738.1_4 Forward -82 -63 5.211 0.207
NP_441558.1_5 Forward -74 -55 4.71934 0.271
NP_440209.1_1 Reverse -63 -71 18.1123 0.00295
NP_440209.1_1 Forward -72 -64 18.1123 0.00295
NP_440209.1_1 Forward -369 -361 2.1827 0.254
NP_442889.1_8 Forward -75 -61 14.8469 0.0473
NP_440447.1_1 Forward -77 -59 3.3624 0.255
NP_441713.1_1 Forward -123 -104 -16.6185 0.285
NP_442570.1_3 Forward -74 -55 -2.45882 0.212
NP_442570.1_3 Reverse -184 -203 -7.96535 0.279
NP_441716.1_1 Forward -72 -58 3.93283 0.259
NP_441598.1_3 Reverse -76 -95 12.675 0.252
NP_442111.1_4 Reverse -62 -76 21.9274 0.0011
NP_442111.1_4 Forward -73 -59 2.94952 0.259
NP_441163.1_1 Reverse -100 -117 4.85634 0.284
NP_440906.1_5 Forward -71 -64 15.8704 0.0124
NP_440906.1_5 Reverse -64 -71 15.8704 0.0124
NP_440906.1_5 Reverse -24 -31 8.79057 0.149
NP_440747.1_10 Reverse -60 -72 24.7201 0.00036
NP_440747.1_10 Forward -75 -63 17.0502 0.000794
NP_441486.1_1 Forward -75 -61 5.40779 0.037
NP_441486.1_1 Reverse -60 -74 4.62115 0.0425
NP_442634.1_4 Forward -74 -60 -1.27871 0.149
NP_441265.1_3 Reverse -57 -71 2.85119 0.181
NP_440403.1_4 Forward -81 -62 -7.76869 0.248
NP_442848.1_1 Forward -78 -64 -1.67204 0.263
NP_441012.1_4 Reverse -65 -78 9.16406 0.272
NP_443018.1_3 Forward -71 -64 14.8871 0.0123
NP_443018.1_3 Reverse -64 -71 14.8871 0.0123
NP_443018.1_3 Reverse -305 -312 7.11894 0.16
NP_441634.1_8 Forward -34 -20 2.35953 0.168
NP_441634.1_8 Reverse -61 -75 -3.04867 0.295
NP_440376.1_1 Forward -72 -63 19.4693 0.000692
NP_440376.1_1 Reverse -63 -72 19.4693 0.000692
NP_440376.1_1 Forward -117 -108 -0.0986038 0.285
NP_441588.1_4 Forward -70 -60 9.02648 0.14
NP_442687.1_7 Forward -73 -63 15.8113 0.0125
NP_442687.1_7 Forward -370 -360 11.5831 0.0994
NP_442687.1_7 Reverse -62 -72 8.92815 0.0994
NP_442191.1_4 Reverse -64 -78 16.6166 0.034
NP_442485.1_3 Forward -83 -64 1.96607 0.216
NP_442485.1_3 Reverse -181 -200 -1.7705 0.261
NP_441013.1_2 Forward -77 -59 3.16574 0.23
NP_441388.1_10 Forward -23 -6 17.9414 0.13
NP_442770.1_4 Forward -76 -57 2.94938 0.294
NP_441422.1_7 Forward -74 -57 -0.157821 0.16
NP_441422.1_7 Reverse -61 -78 -2.3211 0.21
NP_442658.1_1 Forward -74 -64 17.0891 0.00615
NP_442658.1_1 Reverse -61 -71 6.76441 0.214
NP_441855.2_4 Forward -80 -61 14.3434 0.156
NP_442782.1_2 Reverse -63 -77 10.4227 0.173
NP_441414.1_9 Forward -273 -254 -7.57203 0.221
NP_441414.1_9 Forward -72 -53 -10.9153 0.297
NP_441256.1_1 Forward -75 -56 -8.85033 0.267
NP_442937.1_5 Forward -77 -58 7.7676 0.241
NP_442937.1_5 Reverse -58 -77 7.07928 0.263
NP_442321.1_4 Forward -316 -297 -4.6221 0.284
NP_441958.1_5 Forward -73 -63 12.2714 0.00183
NP_441958.1_5 Reverse -62 -72 12.2714 0.00183
NP_440203.1_5 Forward -69 -59 14.2375 0.0886
NP_440203.1_5 Forward -24 -14 12.7626 0.138
NP_440984.1_7 Reverse -58 -72 9.34103 0.127
NP_439990.1_5 Reverse -58 -71 11.229 0.128
NP_442911.1_2 Reverse -53 -72 5.60432 0.0325
NP_441580.1_6 Forward -83 -64 -3.73712 0.235
NP_440153.1_5 Reverse -64 -78 3.04785 0.219
NP_440153.1_8 Forward -78 -65 -3.12731 0.285
NP_440369.1_10 Reverse -293 -312 21.3373 0.0714
NP_442064.1_1 Forward -374 -355 -13.6686 0.297
NP_443055.1_6 Forward -352 -334 0.608397 0.241
NP_443055.1_6 Reverse -49 -67 -0.0799167 0.252
NP_440993.1_3 Reverse -53 -72 -0.492971 0.27
NP_440993.1_4 Forward -27 -10 2.10379 0.3
NP_440827.1_1 Reverse -70 -89 16.6174 0.202
NP_442210.1_9 Reverse -182 -200 12.6055 0.209
NP_441099.1_5 Forward -82 -63 -0.295539 0.0908
NP_442002.1_9 Forward -73 -66 10.7572 0.185
NP_441294.1_7 Forward -76 -62 9.4426 0.244
NP_441646.1_1 Forward -39 -20 -1.47551 0.287
NP_442438.1_10 Forward -77 -63 12.0943 0.0412
NP_442438.1_10 Reverse -58 -72 9.04604 0.0692
NP_441000.1_6 Reverse -62 -76 -2.45868 0.216
NP_441674.1_2 Reverse -326 -345 8.65258 0.217
NP_440147.1_4 Reverse -61 -74 17.7189 0.00602
NP_440147.1_4 Forward -74 -61 10.049 0.0355
NP_441175.1_7 Forward -72 -53 5.99764 0.265
NP_441295.1_4 Reverse -58 -77 4.916 0.29
NP_441550.1_8 Reverse -61 -71 14.6309 0.0132
NP_441550.1_8 Forward -74 -64 8.82935 0.112
NP_441916.1_7 Reverse -63 -73 18.4663 0.00144
NP_441916.1_7 Forward -72 -62 10.3048 0.0261
NP_441916.1_10 Reverse -302 -321 2.0644 0.253
NP_441041.1_4 Reverse -63 -82 -7.4737 0.188
NP_441041.1_7 Forward -75 -63 14.6087 0.0342
NP_441041.1_7 Reverse -60 -72 8.58373 0.133
NP_441041.1_7 Reverse -357 -369 6.44582 0.21
NP_442004.1_6 Forward -72 -58 5.80112 0.181
NP_441725.1_4 Forward -77 -63 12.6836 0.0693
NP_441725.1_5 Forward -71 -61 2.04498 0.115
NP_441725.1_5 Reverse -64 -74 2.04498 0.115
NP_441725.1_5 Forward -368 -358 1.65166 0.13
NP_439966.1_7 Forward -74 -64 17.9741 0.00631
NP_439966.1_7 Reverse -61 -71 7.25606 0.15
NP_439966.1_7 Forward -303 -293 6.96107 0.16
NP_439966.1_7 Forward -371 -361 5.48612 0.22
NP_439966.1_9 Forward -74 -65 0.884706 0.253
NP_442941.1_3 Forward -71 -61 11.0914 0.0116
NP_442941.1_3 Reverse -64 -74 10.7964 0.0116
NP_440289.1_2 Forward -75 -62 11.1307 0.0212
NP_440289.1_2 Reverse -357 -370 -4.7006 0.294
NP_440289.1_2 Forward -372 -359 -5.19226 0.3
NP_440260.1_8 Reverse -183 -201 -2.0458 0.243
NP_440260.1_8 Reverse -54 -72 -4.99573 0.273
NP_442281.1_1 Forward -77 -63 18.0918 0.00503
NP_442281.1_1 Reverse -58 -72 17.6002 0.00542
NP_442281.1_1 Reverse -299 -313 4.71887 0.184
NP_441334.1_7 Forward -74 -55 -21.24 0.293
NP_442256.1_2 Forward -74 -56 -5.78238 0.214
NP_440437.1_1 Reverse -354 -373 -4.52377 0.261
NP_440647.1_9 Forward -74 -56 3.55906 0.273
NP_442012.1_1 Reverse -57 -76 7.7676 0.108
NP_442012.1_1 Forward -78 -59 2.0644 0.205
NP_441556.1_10 Reverse -58 -72 14.018 0.178
NP_441556.1_10 Forward -77 -63 12.2659 0.195
NP_441556.1_10 Reverse -187 -201 10.8058 0.257
NP_442982.1_5 Reverse -53 -72 8.16093 0.12
NP_443030.1_4 Reverse -303 -322 -6.98204 0.294
NP_441644.1_6 Forward -72 -62 17.3841 0.00127
NP_441644.1_6 Reverse -63 -73 10.1076 0.0628
NP_442215.1_2 Forward -74 -58 16.3815 0.0155
NP_442215.1_2 Reverse -61 -77 -0.629782 0.17
NP_442029.1_6 Reverse -58 -77 11.6025 0.158
NP_442029.1_6 Forward -77 -58 8.65258 0.204
NP_440253.1_2 Reverse -63 -81 -3.22577 0.287
NP_440929.1_8 Forward -72 -63 19.2726 0.000701
NP_440929.1_8 Reverse -63 -72 19.2726 0.000701
NP_440566.1_6 Reverse -9 -28 10.2259 0.258
NP_442933.1_3 Forward -238 -219 17.2359 0.225
NP_442933.1_10 Forward -72 -63 17.601 0.00325
NP_442933.1_10 Reverse -63 -72 17.601 0.00325
NP_441751.2_8 Reverse -64 -78 -3.04867 0.134
NP_442554.1_8 Forward -71 -61 15.3197 0.00882
NP_442554.1_8 Reverse -64 -74 14.1397 0.0144
NP_442167.1_5 Reverse -79 -98 23.2544 0.0159
NP_441762.1_7 Forward -73 -61 9.57708 0.0142
NP_441762.1_7 Reverse -62 -74 2.98891 0.0676
NP_441762.1_7 Reverse -359 -371 -6.05754 0.268
NP_442142.1_4 Forward -75 -62 15.1616 0.0289
NP_442142.1_4 Reverse -60 -73 14.7683 0.0302
NP_442142.1_4 Reverse -357 -370 9.95012 0.083
NP_442292.1_1 Forward -71 -62 18.486 0.00229
NP_442292.1_1 Reverse -64 -73 9.63616 0.0183
NP_440919.1_1 Forward -357 -338 -4.32711 0.23
NP_442476.1_6 Reverse -64 -78 8.84938 0.0978
NP_442476.1_6 Forward -31 -17 8.35772 0.103
NP_442476.1_6 Reverse -24 -38 5.30946 0.138
NP_442381.1_8 Forward -75 -56 -6.09707 0.152
NP_441711.1_4 Forward -21 -2 11.3075 0.109
NP_443009.1_5 Reverse -62 -73 18.3477 0.00265
NP_443009.1_5 Reverse -359 -370 4.97473 0.222
NP_442408.2_1 Forward -72 -53 -5.11376 0.267
NP_441715.1_4 Reverse -64 -74 18.8596 0.00741
NP_441715.1_4 Forward -71 -61 7.94484 0.107
NP_440183.1_9 Forward -194 -175 -15.5368 0.273
NP_440379.1_5 Forward -81 -62 -3.24547 0.204
NP_440379.1_5 Reverse -183 -202 -10.817 0.285
NP_440464.1_10 Reverse -250 -260 15.5864 0.169
NP_440464.1_10 Forward -71 -61 13.0082 0.169
NP_441468.1_1 Forward -71 -64 15.8704 0.0124
NP_441468.1_1 Reverse -64 -71 15.8704 0.0124
NP_442099.1_1 Reverse -64 -82 14.7688 0.274
NP_441020.2_6 Reverse -61 -78 13.3135 0.0755
NP_441015.1_10 Forward -77 -58 3.93269 0.131
NP_441015.1_10 Reverse -64 -83 -3.04881 0.184
NP_441015.1_10 Reverse -58 -77 -4.22878 0.201
NP_441673.1_1 Forward -72 -63 20.8459 0.000698
NP_441673.1_1 Reverse -63 -72 20.8459 0.000698
NP_441731.1_3 Reverse -55 -74 -6.88371 0.299
NP_441956.1_9 Forward -79 -60 14.6508 0.166
NP_441426.1_6 Reverse -341 -360 13.5691 0.225
NP_441826.1_2 Reverse -57 -71 6.98109 0.0899
NP_441826.1_2 Forward -78 -64 3.04785 0.115
NP_441826.1_2 Reverse -354 -368 0.294584 0.19
NP_441330.1_1 Reverse -58 -77 -4.22878 0.0919
NP_441330.1_1 Forward -77 -58 -14.1602 0.214
NP_441637.1_9 Forward -125 -107 -4.50408 0.298
NP_442490.1_9 Forward -84 -65 5.70265 0.161
NP_442490.1_10 Reverse -352 -370 7.78729 0.286
NP_441764.1_6 Reverse -84 -95 16.8733 0.253
NP_442868.1_6 Forward -74 -64 10.3048 0.038
NP_442868.1_6 Reverse -61 -71 9.81313 0.038
NP_442719.1_2 Forward -378 -360 -6.56973 0.226
NP_441056.1_1 Reverse -63 -82 3.04771 0.132
NP_441612.1_2 Forward -258 -248 9.32379 0.21
NP_441612.1_2 Forward -72 -62 8.54929 0.21
NP_441612.1_2 Reverse -192 -202 6.61303 0.283
NP_442361.1_3 Reverse -57 -70 17.7189 0.0481
NP_442808.1_1 Forward -73 -63 18.4657 0.00201
NP_442808.1_1 Reverse -62 -72 8.63269 0.0481
NP_440145.1_3 Forward -257 -238 4.42435 0.0843
NP_440145.1_3 Forward -82 -63 -6.29373 0.295
NP_442820.1_3 Forward -227 -217 12.5659 0.289
NP_442542.1_2 Forward -74 -61 8.47575 0.154
NP_442050.1_4 Reverse -68 -87 10.4225 0.257
NP_442050.1_5 Reverse -262 -272 9.02601 0.202
NP_442050.1_5 Reverse -106 -116 7.94438 0.243
NP_442050.1_5 Reverse -61 -71 7.64939 0.243
NP_442050.1_5 Forward -74 -64 6.96107 0.27
NP_442050.1_5 Forward -34 -24 6.76441 0.282
NP_442342.1_4 Reverse -285 -304 14.0608 0.283
NP_440558.1_2 Forward -81 -62 -2.0655 0.222
NP_440558.1_2 Forward -36 -17 -4.03212 0.241
NP_440558.1_2 Reverse -189 -208 -6.78538 0.28
NP_441878.1_6 Forward -73 -63 10.4031 0.0176
NP_441878.1_6 Reverse -62 -72 10.4031 0.0176
NP_441878.1_6 Reverse -359 -369 -7.49312 0.231
NP_441878.1_6 Reverse -369 -379 -7.59145 0.245
NP_441036.1_8 Forward -73 -63 17.7779 0.000554
NP_441036.1_8 Reverse -62 -72 8.33817 0.174
NP_442650.1_2 Forward -72 -58 8.25939 0.13
NP_441557.1_5 Forward -72 -63 19.9609 0.000699
NP_441557.1_5 Reverse -63 -72 19.9609 0.000699
NP_442419.1_2 Reverse -58 -77 -0.885524 0.246
NP_440101.1_3 Forward -77 -58 11.1109 0.108
NP_440101.1_3 Reverse -58 -77 6.58763 0.181
NP_441458.1_10 Forward -81 -62 26.1555 0.00176
NP_441458.1_10 Reverse -54 -73 4.62101 0.23
NP_442183.1_1 Reverse -63 -77 8.06273 0.124
NP_442166.1_7 Reverse -64 -78 9.83269 0.19
NP_442397.1_9 Forward -72 -53 3.53937 0.264
NP_442347.1_2 Forward -71 -62 12.4878 0.056
NP_442347.1_2 Reverse -64 -73 11.1111 0.056
NP_442347.1_2 Forward -31 -22 3.53964 0.284
NP_442645.1_2 Forward -80 -61 -13.1769 0.147
NP_442645.1_2 Reverse -55 -74 -22.715 0.293
NP_441037.1_4 Reverse -61 -71 7.9999 0.237
NP_441037.1_4 Forward -74 -64 6.92787 0.237
NP_441633.1_3 Reverse -61 -74 8.57408 0.0377
NP_441633.1_3 Forward -74 -61 5.72248 0.0481
NP_440136.1_2 Forward -71 -64 15.9687 0.0123
NP_440136.1_2 Reverse -64 -71 15.9687 0.0123
NP_440136.1_2 Reverse -24 -31 4.26735 0.218
NP_442590.1_10 Reverse -63 -82 2.94938 0.299
NP_442998.1_10 Forward -70 -63 15.5754 0.0102
NP_442998.1_10 Reverse -65 -72 15.5754 0.0102
NP_440299.1_1 Reverse -59 -72 22.3398 0.000547
NP_440299.1_1 Forward -76 -63 18.1116 0.00453
NP_441799.1_1 Reverse -59 -73 11.4053 0.0589
NP_441799.1_1 Forward -76 -62 5.30886 0.214
NP_441007.1_10 Reverse -58 -71 -0.669033 0.287
NP_441435.1_4 Forward -88 -69 6.98095 0.258
NP_440256.1_1 Reverse -60 -79 19.174 0.00424
NP_440256.1_1 Forward -120 -101 -8.65367 0.264
NP_441559.1_8 Forward -77 -63 12.291 0.0574
NP_441559.1_8 Reverse -58 -72 -6.88358 0.281
NP_440915.1_6 Forward -76 -62 12.4876 0.0208
NP_440915.1_6 Reverse -59 -73 3.73617 0.1
NP_440997.1_6 Reverse -99 -118 9.14423 0.266
NP_442866.1_1 Reverse -364 -383 -6.39206 0.255
NP_441464.1_1 Reverse -59 -78 6.78429 0.281
NP_441939.1_3 Reverse -64 -83 17.7974 0.0243
NP_441939.1_3 Forward -71 -52 8.94757 0.159
NP_440677.1_6 Forward -81 -62 8.84924 0.275
NP_442386.1_9 Forward -73 -64 15.7322 0.0144
NP_442386.1_9 Reverse -62 -71 13.8639 0.0289
NP_441340.1_5 Forward -71 -64 15.6737 0.0124
NP_441340.1_5 Reverse -64 -71 15.6737 0.0124
NP_442186.1_9 Forward -74 -55 7.47261 0.228
NP_442484.1_2 Forward -83 -64 0.884433 0.242
NP_442484.1_2 Reverse -52 -71 -1.67217 0.295
NP_440168.1_4 Reverse -53 -72 -5.11376 0.255
NP_441254.1_1 Reverse -47 -60 11.5234 0.295
NP_442240.1_1 Reverse -54 -73 8.35677 0.238
NP_442240.1_2 Reverse -64 -83 -1.96717 0.0609
NP_442714.1_7 Reverse -108 -127 -2.55715 0.299
NP_440586.1_8 Forward -71 -64 13.2151 0.026
NP_440586.1_8 Reverse -64 -71 13.2151 0.026
NP_441861.1_2 Reverse -93 -112 14.9324 0.207
NP_442251.1_6 Forward -71 -64 15.2804 0.0124
NP_442251.1_6 Reverse -64 -71 15.2804 0.0124
NP_442251.1_6 Reverse -361 -368 8.69224 0.199
NP_441262.1_3 Reverse -63 -70 14.7888 0.0223
NP_441262.1_3 Forward -72 -65 14.7888 0.0223
NP_440027.1_3 Forward -82 -64 9.16315 0.187
NP_443051.1_1 Reverse -62 -71 10.4228 0.00754
NP_443051.1_1 Forward -73 -64 10.4228 0.00754
NP_439937.1_8 Reverse -70 -89 -5.60541 0.299
NP_439937.1_9 Reverse -342 -359 -1.33848 0.124
NP_439937.1_9 Reverse -341 -358 -3.89507 0.157
NP_440408.1_7 Forward -78 -59 10.3242 0.247
NP_440439.1_1 Forward -75 -62 10.2457 0.0372
NP_440439.1_1 Reverse -60 -73 0.314277 0.194
NP_439943.1_7 Reverse -58 -77 6.09597 0.232
NP_440372.1_2 Forward -71 -64 16.3621 0.0124
NP_440372.1_2 Reverse -64 -71 16.3621 0.0124
NP_441138.1_5 Forward -123 -110 3.49948 0.297
NP_440574.1_3 Forward -374 -355 9.63589 0.156
NP_441181.1_6 Reverse -64 -82 6.90232 0.219
NP_441803.1_2 Forward -77 -58 9.0459 0.107
NP_441803.1_2 Reverse -58 -77 5.89931 0.16
NP_439977.1_5 Forward -78 -59 12.2908 0.0597
NP_440139.1_1 Reverse -354 -373 6.58682 0.14
NP_441572.1_7 Forward -78 -59 -3.63879 0.217
NP_442384.1_10 Reverse -63 -76 19.1938 0.00338
NP_442384.1_10 Forward -72 -59 17.4239 0.00585
NP_442339.1_8 Forward -178 -161 17.5418 0.27
NP_442114.1_4 Reverse -63 -74 9.20345 0.17
NP_441877.1_7 Forward -77 -58 4.71854 0.218
NP_441018.1_7 Reverse -59 -78 15.6341 0.102
NP_441018.1_7 Reverse -13 -32 10.2259 0.214
NP_441018.1_7 Forward -121 -102 10.0292 0.218
NP_442790.1_4 Forward -81 -62 -14.1602 0.272
NP_442262.1_10 Forward -71 -64 14.1988 0.0123
NP_442262.1_10 Reverse -64 -71 14.1988 0.0123
NP_442262.1_10 Reverse -265 -272 9.67555 0.173
NP_442262.1_10 Reverse -305 -312 8.20058 0.25
NP_441689.1_5 Reverse -106 -116 7.64939 0.197
NP_441689.1_5 Reverse -61 -71 5.78111 0.197
NP_440163.1_10 Reverse -289 -299 8.82982 0.26
NP_440344.1_10 Forward -79 -62 2.20212 0.0286
NP_440344.1_10 Reverse -56 -73 -10.3842 0.178
NP_440531.1_6 Reverse -352 -371 -4.52377 0.282
NP_440487.1_1 Forward -75 -56 -5.11376 0.214
NP_441965.1_10 Forward -75 -59 4.77842 0.231
NP_440297.1_9 Forward -368 -358 0.766681 0.282
NP_440297.1_9 Forward -71 -61 -0.118297 0.282
NP_440297.1_9 Reverse -64 -74 -0.118297 0.282
NP_440297.1_9 Reverse -305 -315 -0.216628 0.282
NP_441896.1_3 Forward -81 -62 3.53937 0.167
NP_441103.1_2 Reverse -52 -70 10.6381 0.156
NP_440894.1_10 Forward -77 -58 4.81767 0.243
NP_440999.1_9 Forward -76 -62 19.9608 0.0114
NP_440888.1_2 Reverse -63 -77 15.1419 0.0122
NP_440888.1_2 Forward -72 -58 10.717 0.0861
NP_440491.1_1 Forward -75 -56 11.1077 0.177
NP_441345.1_8 Forward -159 -140 10.0292 0.286
NP_440052.1_5 Forward -83 -64 8.75091 0.095
NP_442225.1_10 Reverse -53 -72 8.25844 0.27
NP_442033.1_10 Forward -74 -55 -7.17871 0.186
NP_442033.1_10 Forward -381 -362 -8.85033 0.207
NP_442033.1_10 Reverse -341 -360 -11.8986 0.26
NP_441123.1_6 Reverse -55 -73 13.0972 0.14
NP_440575.1_8 Reverse -47 -66 -5.01543 0.27
NP_441917.1_1 Forward -92 -73 9.53756 0.197
NP_441543.1_2 Reverse -64 -73 18.486 0.00236
NP_441543.1_2 Forward -71 -62 16.9127 0.00359
NP_442845.1_2 Forward -72 -58 7.37441 0.195
NP_442845.1_2 Reverse -57 -71 5.70279 0.225
NP_442845.1_2 Forward -279 -265 5.60446 0.228
NP_441304.1_10 Forward -61 -52 14.946 0.164
NP_441304.1_10 Forward -183 -174 14.1594 0.207
NP_441304.1_10 Forward -62 -53 12.8811 0.276
NP_441469.1_8 Forward -73 -64 16.126 0.00797
NP_441469.1_8 Reverse -62 -71 6.48957 0.227
NP_441469.1_8 Forward -302 -293 5.21127 0.283
NP_442315.1_2 Forward -121 -109 12.4287 0.291
NP_443064.1_6 Forward -72 -62 12.5669 0.0796
NP_442337.1_8 Reverse -7 -26 4.03102 0.21
NP_442578.1_7 Forward -71 -64 14.5921 0.026
NP_442578.1_7 Reverse -64 -71 14.5921 0.026
NP_442578.1_7 Reverse -367 -374 9.97054 0.112
NP_440998.1_10 Forward -171 -152 12.0942 0.128
NP_441462.1_2 Forward -72 -62 11.5831 0.00406
NP_441462.1_2 Reverse -63 -73 11.5831 0.00406
NP_441621.1_7 Forward -74 -60 -3.24533 0.188
NP_441621.1_7 Reverse -61 -75 -3.34366 0.188
NP_443062.1_1 Forward -301 -283 6.79079 0.192
NP_443062.1_1 Forward -273 -255 5.32818 0.231
NP_442204.1_1 Forward -76 -65 11.5634 0.0565
NP_442204.1_1 Reverse -59 -70 8.7118 0.0852
NP_440516.1_2 Forward -78 -60 2.96908 0.159
NP_440516.1_8 Forward -72 -63 16.9127 0.00442
NP_440516.1_8 Reverse -63 -72 16.9127 0.00442
NP_440516.1_8 Reverse -360 -369 -0.295266 0.232
NP_442428.1_5 Forward -71 -64 15.8704 0.0124
NP_442428.1_5 Reverse -64 -71 15.8704 0.0124
NP_442859.1_7 Reverse -5 -24 19.2723 0.0954
NP_442120.1_10 Forward -247 -228 -13.2752 0.282
NP_440673.1_3 Forward -70 -63 12.4288 0.0426
NP_440673.1_3 Reverse -65 -72 12.4288 0.0426
NP_440673.1_3 Reverse -362 -369 10.4622 0.139
NP_440673.1_3 Reverse -240 -247 8.20058 0.234
NP_440673.1_7 Reverse -349 -368 4.42435 0.185
NP_441052.1_2 Forward -72 -62 19.9412 0.00106
NP_441052.1_2 Reverse -63 -73 10.5014 0.0285
NP_441052.1_2 Forward -201 -191 1.94665 0.221
NP_442219.1_9 Forward -71 -62 17.7976 0.00718
NP_442219.1_9 Reverse -64 -73 8.35786 0.0681
NP_440436.1_4 Reverse -64 -73 18.1905 0.00233
NP_440436.1_4 Forward -71 -62 17.2072 0.00233
NP_441884.1_8 Reverse -62 -81 -7.76869 0.254
NP_441884.1_9 Forward -75 -56 -13.4719 0.138
NP_441884.1_9 Forward -391 -372 -23.5016 0.284
NP_442864.1_3 Reverse -57 -76 9.0459 0.212
NP_442414.1_9 Reverse -165 -184 14.9458 0.227
NP_441719.1_4 Forward -71 -64 16.3621 0.0124
NP_441719.1_4 Reverse -64 -71 16.3621 0.0124
NP_441733.1_10 Reverse -60 -73 7.39411 0.153
NP_441004.1_1 Reverse -57 -76 -6.1954 0.183
NP_441004.1_1 Forward -201 -182 -18.2901 0.299
NP_441004.1_9 Reverse -147 -165 13.7316 0.227
NP_442813.1_4 Reverse -55 -74 -1.67217 0.249
NP_442366.1_3 Forward -73 -55 21.357 0.00671
NP_442366.1_5 Reverse -60 -70 14.0409 0.0497
NP_441115.1_4 Forward -73 -55 13.9813 0.0645
NP_442206.1_10 Forward -72 -57 3.71647 0.181
NP_442206.1_10 Reverse -63 -78 0.0782283 0.274
NP_440328.1_4 Reverse -57 -76 4.916 0.157
NP_443054.1_2 Forward -197 -183 0.589577 0.258
NP_443054.1_2 Forward -74 -60 -0.0987402 0.284
NP_441851.1_10 Forward -73 -63 16.008 0.00552
NP_441851.1_10 Reverse -62 -72 15.8113 0.00552
NP_442856.1_7 Forward -81 -62 7.86593 0.11
NP_442856.1_7 Reverse -54 -73 -6.29373 0.297
NP_441668.1_4 Reverse -53 -72 -1.67217 0.278
NP_442515.1_1 Reverse -22 -36 -3.73699 0.297
NP_442515.1_1 Reverse -62 -76 -4.52363 0.298
NP_440593.1_3 Reverse -58 -77 8.84924 0.109
NP_440593.1_3 Reverse -64 -83 0.0977854 0.198
NP_440165.1_5 Forward -274 -255 -6.68705 0.242
NP_440165.1_5 Forward -73 -54 -8.06369 0.288
NP_441349.1_10 Reverse -53 -72 -8.85033 0.279
NP_440155.1_3 Reverse -132 -151 4.52268 0.245
NP_442843.1_1 Forward -351 -332 -7.17871 0.245
NP_442843.1_1 Reverse -64 -83 -11.1119 0.286
NP_439960.1_4 Reverse -62 -81 12.88 0.28
NP_439960.1_6 Reverse -63 -82 7.66927 0.28
NP_439960.1_10 Reverse -56 -74 3.06741 0.165
NP_440474.1_8 Forward -246 -232 5.89884 0.237
NP_441477.1_10 Reverse -56 -74 7.00065 0.181
NP_442450.1_5 Reverse -61 -71 7.55152 0.13
NP_442450.1_5 Forward -84 -74 7.35486 0.137
NP_440588.1_2 Reverse -54 -73 7.7676 0.048
NP_440588.1_2 Forward -81 -62 -0.39387 0.15
NP_442006.1_2 Reverse -69 -86 -17.0707 0.269
NP_442006.1_2 Forward -66 -49 -18.3491 0.29
NP_443047.1_7 Forward -368 -349 12.8808 0.114
NP_441570.1_1 Reverse -63 -81 -7.749 0.0949
NP_441570.1_1 Forward -369 -351 -9.32229 0.134
NP_441570.1_1 Forward -72 -54 -10.5023 0.171
NP_440078.1_4 Reverse -52 -71 15.4374 0.175
NP_441078.1_4 Forward -72 -63 19.6659 0.0007
NP_441078.1_4 Reverse -63 -72 19.6659 0.0007
NP_441078.1_4 Forward -201 -192 3.53964 0.136
NP_442729.1_5 Forward -67 -57 13.648 0.228
NP_442729.1_7 Forward -118 -100 6.214 0.286
NP_441663.1_8 Forward -78 -59 -2.16383 0.259
NP_442348.1_2 Forward -59 -50 16.0277 0.113
NP_442348.1_2 Forward -117 -108 14.1594 0.167
NP_440526.1_3 Forward -71 -60 8.02298 0.126
NP_440526.1_3 Forward -368 -357 7.43299 0.148
NP_441432.1_8 Reverse -62 -71 16.8143 0.00595
NP_441432.1_8 Forward -73 -64 8.25953 0.0755
NP_441432.1_8 Forward -202 -193 3.14632 0.259
NP_441432.1_9 Forward -224 -211 9.95576 0.26
NP_442320.1_8 Forward -78 -64 -0.983719 0.0817
NP_442320.1_8 Reverse -57 -71 -4.32697 0.159
NP_441732.1_2 Forward -76 -60 -6.52964 0.0495
NP_441732.1_2 Reverse -59 -75 -7.41462 0.0849
NP_440497.1_2 Reverse -64 -83 6.88262 0.249
NP_440760.1_1 Reverse -63 -82 -5.40875 0.05
NP_440760.1_1 Forward -72 -53 -15.1435 0.142
NP_442510.1_5 Reverse -54 -73 15.7324 0.198
NP_442751.1_4 Forward -378 -359 15.4374 0.193
NP_440713.1_4 Forward -82 -63 3.34271 0.246
NP_442489.1_7 Forward -72 -63 20.1576 0.000695
NP_442489.1_7 Reverse -63 -72 20.1576 0.000695
NP_442489.1_7 Reverse -360 -369 -1.6719 0.235
NP_440559.1_1 Forward -71 -62 17.4043 0.00658
NP_440559.1_1 Reverse -64 -73 8.75118 0.0586
NP_440559.1_1 Forward -368 -359 4.62128 0.24
NP_441659.2_8 Forward -72 -62 18.1713 0.00133
NP_441659.2_8 Reverse -63 -73 11.9764 0.0147
NP_441022.1_1 Reverse -91 -100 10.587 0.294
NP_442913.1_9 Reverse -57 -76 9.73422 0.22
NP_442913.1_10 Reverse -54 -73 0.491109 0.153
NP_441800.1_3 Forward -77 -59 6.41066 0.286
NP_440118.1_2 Forward -399 -380 -0.983855 0.278
NP_442776.1_1 Forward -27 -8 5.80098 0.24
NP_442776.1_8 Forward -79 -60 12.29 0.298
NP_442346.1_5 Reverse -62 -72 16.6963 0.00248
NP_442346.1_5 Forward -73 -63 9.02648 0.118
NP_442346.1_5 Forward -248 -238 4.89658 0.269
NP_440545.1_3 Reverse -59 -76 19.6067 0.00859
NP_440545.1_3 Reverse -19 -36 0.137172 0.144
NP_440545.1_3 Forward -200 -183 -4.09106 0.218
NP_441856.1_8 Forward -83 -64 11.2092 0.274
NP_440831.1_3 Forward -75 -56 6.77545 0.27
NP_440831.1_3 Reverse -54 -73 5.61052 0.28
NP_441710.1_9 Forward -79 -60 14.1583 0.137
NP_440459.1_2 Forward -74 -57 9.47861 0.227
NP_440459.1_2 Forward -87 -70 7.90532 0.276
NP_441653.1_2 Forward -83 -64 8.16804 0.194
NP_441653.1_2 Forward -191 -172 6.42863 0.234
NP_442603.1_7 Forward -72 -58 12.2903 0.1
NP_441888.1_7 Forward -77 -63 13.6676 0.0743
NP_441948.1_4 Reverse -56 -74 -2.43913 0.166
NP_441948.1_4 Reverse -353 -371 -4.11075 0.217
NP_441833.1_4 Forward -71 -64 15.9687 0.0124
NP_441833.1_4 Reverse -64 -71 15.9687 0.0124
NP_441329.1_6 Reverse -207 -226 1.4797 0.237
NP_442162.1_9 Forward -71 -64 16.2637 0.0124
NP_442162.1_9 Reverse -64 -71 16.2637 0.0124
NP_442796.1_2 Reverse -71 -90 17.9599 0.177
NP_442796.1_10 Reverse -69 -88 18.4857 0.145
NP_440671.1_4 Forward -78 -64 11.7993 0.125
NP_441973.1_1 Reverse -347 -362 -7.98491 0.293
NP_442073.1_6 Forward -81 -62 0.786102 0.25
NP_442140.1_3 Reverse -64 -74 14.238 0.0486
NP_442140.1_3 Forward -71 -61 12.2714 0.0632
NP_440875.1_9 Reverse -65 -75 17.327 0.0126
NP_441813.1_5 Forward -74 -64 19.4496 0.00647
NP_441813.1_5 Reverse -61 -71 8.63316 0.0367
NP_441813.1_5 Reverse -262 -272 4.50326 0.155
NP_442254.1_1 Forward -90 -71 -5.70374 0.287
NP_440590.1_4 Reverse -64 -77 13.4906 0.013
NP_440590.1_4 Forward -71 -58 10.934 0.0235
NP_440590.1_6 Forward -202 -188 21.1407 0.0374
NP_440567.1_1 Forward -71 -57 12.9793 0.0213
NP_440567.1_1 Reverse -64 -78 1.67122 0.196
NP_442497.1_10 Forward -71 -62 10.4228 0.0087
NP_442497.1_10 Reverse -64 -73 10.4228 0.0087
NP_442497.1_10 Forward -368 -359 0.29472 0.199
NP_440821.1_4 Forward -74 -64 10.2065 0.0163
NP_440821.1_4 Reverse -61 -71 9.41981 0.0286
NP_440821.1_4 Reverse -21 -31 4.50326 0.13
NP_440821.1_4 Reverse -358 -368 0.275027 0.19
NP_441239.1_9 Forward -74 -62 14.1986 0.0288
NP_441239.1_9 Reverse -61 -73 5.93884 0.202
NP_441239.1_9 Forward -371 -359 4.8572 0.239
NP_441892.1_1 Reverse -295 -312 -2.12444 0.218
NP_441892.1_1 Forward -388 -371 -2.41943 0.221
NP_441892.1_1 Reverse -54 -71 -3.8944 0.251
NP_440665.1_1 Forward -27 -8 -13.5702 0.257
NP_442044.1_1 Reverse -18 -37 -8.26035 0.248
NP_442270.1_9 Forward -83 -64 -6.39206 0.207
NP_441769.1_3 Forward -316 -297 -6.3928 0.269
NP_440354.1_7 Forward -307 -289 6.90232 0.278
NP_440546.1_4 Reverse -63 -73 11.8882 0.0679
NP_440546.1_4 Forward -72 -62 10.046 0.109
NP_441230.1_5 Forward -77 -58 2.85105 0.209
NP_440462.1_6 Forward -74 -64 17.2863 0.00752
NP_440462.1_6 Reverse -61 -71 1.35667 0.294
NP_442611.1_1 Forward -72 -53 -1.86883 0.283
NP_440868.1_4 Forward -76 -64 10.5604 0.0364
NP_440868.1_4 Reverse -59 -71 6.1355 0.0878
NP_440868.1_4 Forward -373 -361 2.20226 0.161
NP_440401.1_9 Forward -23 -16 14.5917 0.287
NP_442402.1_4 Forward -40 -21 -7.27777 0.272
NP_440696.1_3 Reverse -63 -81 1.39578 0.217
NP_442923.1_4 Forward -201 -182 -5.50708 0.279
NP_442039.1_4 Forward -71 -64 15.1821 0.0124
NP_442039.1_4 Reverse -64 -71 15.1821 0.0124
NP_442273.1_10 Reverse -117 -135 8.18062 0.243
NP_440825.1_7 Forward -71 -61 12.9096 0.152
NP_442837.1_3 Forward -71 -64 15.7721 0.0124
NP_442837.1_3 Reverse -64 -71 15.7721 0.0124
NP_439994.1_3 Forward -73 -54 9.21897 0.253
NP_442053.1_1 Forward -72 -63 18.3876 0.0007
NP_442053.1_1 Reverse -63 -72 18.3876 0.0007
NP_440505.1_3 Forward -74 -64 15.9097 0.00857
NP_440505.1_3 Reverse -61 -71 9.22315 0.122
NP_440505.1_3 Reverse -21 -31 4.50326 0.284
NP_440351.1_1 Forward -337 -318 -3.54046 0.264
NP_441203.1_1 Forward -71 -52 -0.983855 0.0636
NP_441203.1_1 Reverse -64 -83 -19.9617 0.297
NP_441408.2_7 Forward -74 -55 1.57275 0.215
NP_440914.1_1 Forward -72 -62 17.5935 0.000537
NP_440914.1_1 Reverse -63 -73 8.6151 0.186
NP_440914.1_1 Forward -273 -263 6.17532 0.293
NP_441011.1_8 Reverse -64 -73 16.9127 0.00602
NP_441011.1_8 Forward -71 -62 8.25953 0.144
NP_442101.1_10 Reverse -55 -74 -7.37537 0.211
NP_442533.1_6 Forward -72 -63 17.2076 0.00137
NP_442533.1_6 Reverse -63 -72 17.2076 0.00137
NP_442541.1_10 Reverse -342 -356 4.32555 0.252
NP_442232.1_3 Reverse -15 -34 -14.8485 0.288
NP_442229.1_1 Reverse -61 -75 7.3738 0.196
NP_441482.1_7 Forward -78 -64 18.2892 0.00478
NP_441482.1_7 Reverse -57 -71 -8.5552 0.193
NP_439944.1_9 Forward -71 -61 10.5014 0.0887
NP_439944.1_9 Forward -368 -358 5.87989 0.214
NP_442203.1_1 Reverse -38 -52 13.9534 0.282
NP_440116.1_5 Reverse -60 -77 6.33202 0.167
NP_440116.1_8 Forward -71 -52 -8.94866 0.264
NP_441527.1_4 Reverse -92 -111 -11.4117 0.282
NP_440115.1_6 Reverse -60 -70 9.32148 0.115
NP_440115.1_6 Forward -75 -65 7.64985 0.146
NP_440007.1_9 Forward -76 -62 1.96621 0.281
NP_440007.1_9 Forward -205 -191 0.392915 0.298
NP_439965.1_1 Forward -81 -62 -5.99873 0.211
NP_439965.1_1 Reverse -54 -73 -8.94866 0.28
NP_441602.1_3 Forward -77 -58 -1.18052 0.226
NP_441972.1_5 Reverse -64 -83 -3.3438 0.199
NP_441972.1_5 Forward -71 -52 -6.39206 0.229
NP_441106.1_1 Forward -73 -64 18.191 0.0028
NP_441106.1_1 Reverse -62 -71 9.63616 0.0311
NP_439903.1_1 Reverse -214 -233 4.71934 0.214
NP_439903.1_6 Reverse -183 -202 -1.37794 0.299
NP_442306.1_10 Reverse -365 -384 -21.4367 0.27
NP_441286.1_1 Reverse -62 -74 6.03717 0.0258
NP_441286.1_1 Forward -73 -61 3.38223 0.0467
NP_440670.1_8 Forward -72 -63 18.3876 0.000699
NP_440670.1_8 Reverse -63 -72 18.3876 0.000699
NP_440670.1_8 Reverse -360 -369 3.93297 0.212
NP_440670.1_8 Forward -273 -264 3.14632 0.296
NP_440886.1_7 Forward -73 -63 17.7774 0.0011
NP_440886.1_7 Forward -370 -360 11.2876 0.0805
NP_440886.1_7 Reverse -62 -72 7.94438 0.0805
NP_442614.1_2 Forward -72 -58 8.16106 0.255
NP_440205.1_3 Reverse -345 -364 4.916 0.282
NP_440907.2_8 Reverse -64 -74 7.94438 0.117
NP_440907.2_8 Forward -71 -61 7.64939 0.117
NP_440907.2_8 Forward -31 -21 4.7978 0.243
NP_442264.1_2 Forward -323 -306 8.39697 0.216
NP_441021.1_1 Reverse -64 -83 -3.24547 0.153
NP_441021.1_8 Reverse -355 -373 2.28076 0.25
NP_441463.1_3 Reverse -13 -32 -5.11376 0.22
NP_442893.1_4 Forward -136 -117 0.195343 0.235
NP_441626.1_2 Forward -71 -64 15.7721 0.0124
NP_441626.1_2 Reverse -64 -71 15.7721 0.0124
NP_442365.1_7 Reverse -59 -78 -5.40875 0.269
NP_442794.1_1 Reverse -59 -71 21.9668 0.00123
NP_442794.1_1 Forward -76 -64 10.4621 0.0721
NP_442615.1_1 Reverse -54 -72 7.59063 0.0314
NP_442615.1_1 Forward -81 -63 -1.65248 0.131
NP_441962.1_4 Reverse -58 -77 -11.4069 0.241
NP_441962.1_4 Forward -77 -58 -13.8652 0.279
NP_441742.1_7 Forward -76 -57 15.2408 0.245
NP_440387.1_1 Forward -72 -56 13.3332 0.00865
NP_440387.1_1 Reverse -63 -79 4.68009 0.0396
NP_441431.1_2 Forward -75 -61 19.8618 0.00685
NP_442020.1_1 Reverse -41 -60 -0.39464 0.274
NP_441488.1_8 Reverse -58 -72 13.7653 0.146
NP_441836.1_2 Forward -78 -59 -6.49039 0.298
NP_441193.1_1 Reverse -105 -124 8.75009 0.292
NP_441993.1_1 Reverse -57 -76 8.96362 0.136
NP_441993.1_1 Reverse -63 -82 3.31109 0.237
NP_441993.1_1 Reverse -232 -251 0.777198 0.292
NP_440467.1_3 Reverse -172 -191 10.6703 0.298
NP_440737.1_1 Forward -351 -332 28.7121 0.000999
NP_440737.1_2 Forward -195 -178 27.4732 0.00268
NP_440737.1_3 Forward -309 -290 23.5006 0.0188
NP_440737.1_4 Forward -384 -365 31.072 0.000137
NP_440737.1_5 Forward -166 -147 25.7622 0.00702
NP_440737.1_6 Forward -288 -269 25.0739 0.0127
NP_441510.2_6 Forward -82 -63 14.2566 0.222
NP_440766.1_4 Reverse -59 -73 8.75105 0.0871
NP_439988.1_3 Forward -70 -56 6.3911 0.278
NP_441237.1_9 Forward -71 -61 14.828 0.0242
NP_442743.1_4 Reverse -64 -83 11.0125 0.0547
NP_442743.1_5 Reverse -64 -83 2.94938 0.279
NP_441311.1_2 Reverse -57 -71 14.5519 0.229
NP_440457.1_1 Forward -76 -64 7.61046 0.101
NP_440457.1_1 Reverse -356 -368 0.0389777 0.25
NP_440457.1_1 Reverse -59 -71 -0.452677 0.263
NP_440798.1_6 Forward -71 -58 4.34585 0.145
NP_441984.1_1 Forward -78 -60 8.86894 0.243
NP_442130.1_9 Reverse -134 -153 6.39097 0.281
NP_441436.1_9 Forward -85 -75 16.0075 0.28
NP_442509.1_5 Forward -370 -353 13.1161 0.265
NP_442509.1_9 Reverse -63 -73 16.2041 0.00739
NP_442509.1_9 Forward -72 -62 8.14104 0.192
NP_440660.1_6 Forward -203 -184 13.7658 0.25
NP_440554.1_4 Reverse -64 -74 16.4996 0.0189
NP_441885.1_5 Forward -72 -62 20.9245 0.000538
NP_441885.1_5 Reverse -63 -73 11.4848 0.00668
NP_441885.1_5 Forward -201 -191 -1.49493 0.264
NP_441885.1_5 Forward -32 -22 -1.59326 0.273
NP_440478.1_10 Forward -74 -60 5.99778 0.3
NP_442341.1_7 Forward -73 -59 16.1259 0.0186
NP_442341.1_7 Reverse -62 -76 10.9143 0.0591
NP_442341.1_9 Forward -74 -60 19.7634 0.00907
NP_441756.1_5 Forward -76 -57 10.4225 0.117
NP_442395.2_4 Forward -73 -54 5.80018 0.154
NP_440423.1_6 Forward -370 -351 -19.5684 0.241
NP_443000.1_7 Forward -74 -64 11.5831 0.0344
NP_443000.1_7 Reverse -61 -71 10.3048 0.0345
NP_441842.1_10 Reverse -56 -70 7.37441 0.258
NP_440275.1_3 Forward -74 -64 15.418 0.0178
NP_440275.1_3 Reverse -61 -71 8.04317 0.0602
NP_440091.1_1 Reverse -356 -368 -0.846001 0.293
NP_443060.1_5 Reverse -55 -74 10.0284 0.191
NP_443010.1_10 Forward -372 -355 3.15733 0.261
NP_442451.1_2 Forward -80 -61 1.37609 0.146
NP_439962.1_4 Reverse -55 -74 -1.86883 0.223
NP_439962.1_4 Forward -80 -61 -7.37537 0.288
NP_439962.1_6 Reverse -66 -84 12.0155 0.204
NP_442495.1_5 Reverse -293 -312 6.29264 0.291
NP_440149.1_8 Reverse -63 -82 13.8641 0.0273
NP_440149.1_8 Reverse -232 -251 -3.93378 0.201
NP_440149.1_8 Reverse -360 -379 -4.81876 0.213
NP_440149.1_8 Forward -72 -53 -5.60541 0.23
NP_441105.1_3 Reverse -52 -71 -3.24547 0.175
NP_440216.1_1 Reverse -63 -77 7.57108 0.00935
NP_440216.1_1 Forward -72 -58 -0.492064 0.0284
NP_440216.1_1 Forward -369 -355 -11.9968 0.236
NP_440172.1_1 Forward -72 -62 15.0247 0.00945
NP_440172.1_1 Reverse -63 -73 8.73149 0.0586
NP_442015.1_10 Forward -76 -63 21.4554 0.00329
NP_442015.1_10 Reverse -59 -72 19.8821 0.00366
NP_441226.1_7 Forward -71 -64 14.4934 0.0123
NP_441226.1_7 Reverse -64 -71 14.4934 0.0123
NP_441226.1_7 Forward -26 -19 5.34865 0.289
NP_441111.1_7 Forward -71 -63 18.7023 0.00294
NP_441111.1_7 Reverse -64 -72 18.7023 0.00294
NP_441766.1_2 Forward -72 -63 17.5026 0.00297
NP_441766.1_2 Reverse -63 -72 17.5026 0.00297
NP_442417.1_5 Reverse -63 -77 9.43936 0.132
NP_442417.1_5 Forward -72 -58 8.06273 0.164
NP_440416.1_9 Reverse -56 -75 18.1907 0.0122
NP_440416.1_9 Forward -79 -60 -5.40875 0.0797
NP_440416.1_9 Reverse -176 -195 -15.6352 0.196
NP_440416.1_9 Forward -308 -289 -20.945 0.289
NP_441135.1_4 Forward -79 -60 1.57275 0.284
NP_442403.1_8 Forward -63 -44 -0.590531 0.256
NP_440591.1_9 Reverse -359 -377 6.50899 0.217
NP_440261.1_5 Forward -71 -58 -0.964025 0.0655
NP_440261.1_5 Reverse -64 -77 -2.63565 0.0924
NP_440261.1_10 Reverse -82 -96 11.7993 0.298
NP_440988.1_10 Forward -28 -14 9.06177 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAATTTAAAAGCGCTGCAAGAGACCATTGACCGCAATCGTCCTTCGGGGGCAAAGGGTCGTTTCTGGCGCACCGTATTTGTGTCCAGTTCCATGGGTCCTTCCATCCCTGTAGACATCAATGCTTTACGCGATCTGAAGTTTGAGGATAACTAAGCGACGACAATTTCCGAGTCATTTCTAGCCACTATTTATTTAACTGGCTATGCCAAAGACCGCAGGAGCAATTAGGGTTGCTTAATTAACCTGCCGAGGTTGAAGCCTGAATCAAGATTTGAGTTTGTTGGGGATTTGCTTCCTTGACAGCTTTTGATCCTCTGCTTCAGCCCCGGCGATCGCCAAGGGGCATTTTTATTGTGTGTTTAATGCTTGCTATCCCAACCCCAAGGAGGTGAAACCCGA

CDS

ATGGGAAGAACGAGAGAAAATAAAGCGACGGTAATCAGTGATGTTCAGGAGTTATTCCAGGACGCTCAAATGACGGTGATCATTGATTATCAAGGGTTAACCGTTGCCGAAATTACCGATTTAAGAAACCGGCTCCGCCCCCTGGGTGGAACCTGTAAGATTGCCAAAAATACCCTTGTCCGTAGGGCACTGGCAGGACAAGAAGCCTGGTCTCCCATGGAAGAATTTCTGACGGGAACCACCGCTATTCTTGTCTTGAAAGAAGACCTGGGCGGCGCAATTAAGGCTTACAAAAAATTCCAGAAAGATACCAAAAAAACCGAACTACGGGGTGGGGTATTAGAAGGAAAAAGCCTAACCCAAGCTGACGTGGAGGCGATCGGTGATTTGCCTTCCAAAGAGCAACTTATGGGTCAAATTGCCGGCGGCATCAATGCCCTGGCTACCAAGATTGCCCTGGGCATCAAAGAAGTTCCAGCTTCCGTGGCCCGTGGTCTCCAAGCCCATGTGGACAAAGAATAG

Protein

MGRTRENKATVISDVQELFQDAQMTVIIDYQGLTVAEITDLRNRLRPLGGTCKIAKNTLVRRALAGQEAWSPMEEFLTGTTAILVLKEDLGGAIKAYKKFQKDTKKTELRGGVLEGKSLTQADVEAIGDLPSKEQLMGQIAGGINALATKIALGIKEVPASVARGLQAHVDKE