Your browser is old and dusty. Try Google Chrome!

Details for sll1738

ORF sll1738
Accession NP_440746.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -232 -213 -22.715 0.184
NP_440295.1_9 Reverse -295 -314 5.30933 0.128
NP_441453.1_7 Forward -173 -166 12.9205 0.23
NP_441660.1_5 Reverse -85 -104 13.2741 0.216
NP_441594.1_6 Forward -340 -321 7.47261 0.172
NP_441594.1_6 Reverse -37 -56 3.93269 0.224
NP_441713.1_8 Reverse -206 -224 10.0489 0.268
NP_440178.1_7 Forward -271 -252 -22.6167 0.268
NP_441533.1_7 Forward -107 -89 11.9164 0.299
NP_442330.1_4 Reverse -295 -314 16.2148 0.233
NP_441634.1_8 Forward -99 -85 -0.688726 0.265
NP_441634.1_8 Forward -294 -280 -2.65535 0.295
NP_440376.1_1 Forward -166 -157 5.89959 0.116
NP_440376.1_1 Reverse -78 -87 1.57302 0.246
NP_441857.1_6 Reverse -188 -198 14.7297 0.229
NP_442687.1_7 Forward -167 -157 4.40493 0.249
NP_442946.1_7 Reverse -326 -341 13.4792 0.284
NP_440642.1_10 Forward -378 -364 21.6317 0.0453
NP_441950.1_7 Forward -171 -152 -0.000545616 0.191
NP_442658.1_1 Reverse -213 -223 5.28945 0.274
NP_442937.1_5 Reverse -28 -47 7.47261 0.251
NP_441127.1_1 Forward -337 -323 15.5359 0.114
NP_441127.1_1 Reverse -94 -108 9.83269 0.267
NP_440984.1_7 Forward -171 -157 7.07942 0.187
NP_443055.1_6 Reverse -128 -146 1.98502 0.222
NP_443055.1_6 Reverse -196 -214 -2.73484 0.299
NP_441099.1_3 Forward -165 -146 3.04771 0.279
NP_441099.1_5 Reverse -213 -232 -0.4922 0.0937
NP_440411.1_10 Forward -168 -149 11.9207 0.26
NP_442431.1_10 Forward -349 -331 2.47742 0.237
NP_441000.1_6 Reverse -210 -224 -0.885388 0.209
NP_440147.1_4 Reverse -155 -168 -0.767364 0.299
NP_441041.1_4 Reverse -223 -242 -12.1936 0.26
NP_441041.1_7 Forward -115 -103 5.6684 0.245
NP_442642.1_9 Reverse -360 -377 1.71047 0.208
NP_442068.1_2 Reverse -194 -213 6.4893 0.3
NP_442215.1_2 Reverse -259 -275 -6.13632 0.264
NP_440929.1_1 Reverse -2 -12 16.3024 0.27
NP_440279.1_2 Forward -249 -230 9.63589 0.172
NP_440183.1_9 Forward -101 -82 -10.522 0.233
NP_441016.2_1 Reverse -23 -42 18.6823 0.238
NP_441426.1_4 Forward -338 -319 6.39097 0.274
NP_441764.1_8 Reverse -173 -183 14.9475 0.284
NP_442719.1_2 Forward -121 -103 -5.1931 0.218
NP_441612.1_2 Reverse -334 -344 9.13016 0.21
NP_442630.1_5 Reverse -302 -321 13.1758 0.263
NP_442692.1_1 Reverse -213 -232 0.392778 0.261
NP_440145.1_3 Reverse -251 -270 -5.40875 0.267
NP_441114.1_1 Forward -314 -296 14.3747 0.279
NP_441114.1_3 Forward -143 -134 13.2744 0.231
NP_441878.1_6 Forward -167 -157 2.14332 0.0501
NP_441878.1_6 Reverse -203 -213 -0.0199663 0.163
NP_441878.1_6 Reverse -156 -166 -7.19813 0.21
NP_441590.1_4 Reverse -211 -230 3.9319 0.29
NP_441116.1_9 Forward -17 -3 12.586 0.25
NP_442645.1_2 Reverse -253 -272 -15.3402 0.197
NP_442645.1_2 Forward -111 -92 -18.0934 0.269
NP_442888.1_6 Reverse -146 -165 13.3725 0.148
NP_442590.1_10 Forward -226 -207 3.73603 0.286
NP_440899.1_2 Forward -294 -275 5.89851 0.273
NP_440899.1_8 Forward -386 -367 -9.63698 0.267
NP_440915.1_6 Reverse -153 -167 -0.885388 0.212
NP_442866.1_1 Forward -225 -206 -8.65367 0.282
NP_441939.1_3 Forward -165 -146 9.0459 0.156
NP_441297.1_8 Forward -157 -139 14.9646 0.152
NP_442791.1_5 Reverse -86 -105 -8.94866 0.279
NP_440168.1_2 Reverse -320 -339 -4.52377 0.282
NP_442959.1_7 Forward -104 -85 -4.22878 0.272
NP_440027.1_3 Forward -103 -85 5.32826 0.245
NP_439937.1_8 Reverse -86 -105 4.22769 0.2
NP_439943.1_1 Forward -165 -146 -7.17871 0.244
NP_440819.1_5 Reverse -4 -12 8.08256 0.185
NP_441018.1_7 Forward -254 -235 6.78429 0.282
NP_442244.1_7 Forward -37 -18 11.7992 0.288
NP_440531.1_6 Forward -95 -76 -5.40875 0.297
NP_441060.1_1 Reverse -94 -113 12.0837 0.294
NP_440297.1_9 Reverse -158 -168 3.81494 0.26
NP_442280.1_10 Forward -223 -205 6.23363 0.28
NP_440888.1_2 Forward -166 -152 7.07881 0.208
NP_440491.1_1 Reverse -68 -87 7.20938 0.274
NP_440575.1_1 Reverse -314 -333 -2.55791 0.294
NP_441543.1_2 Reverse -335 -344 6.68623 0.142
NP_441306.1_10 Forward -222 -208 17.8952 0.22
NP_442204.1_1 Forward -59 -48 6.74518 0.152
NP_442204.1_2 Forward -49 -30 10.9142 0.223
NP_442428.1_8 Reverse -219 -238 -1.47551 0.284
NP_441867.1_2 Reverse -187 -206 -16.6185 0.291
NP_440673.1_7 Reverse -267 -286 0.294447 0.271
NP_442219.1_8 Reverse -23 -42 10.8728 0.195
NP_440689.1_4 Reverse -35 -53 18.3087 0.143
NP_441004.1_1 Reverse -40 -59 -17.7001 0.294
NP_442206.1_8 Reverse -123 -139 18.5636 0.278
NP_442430.1_7 Forward -197 -178 15.4918 0.293
NP_440347.1_3 Forward -240 -221 5.50599 0.241
NP_442843.1_1 Reverse -95 -114 -1.18052 0.192
NP_439960.1_10 Forward -104 -86 -4.79907 0.297
NP_440954.1_1 Forward -159 -140 -12.0953 0.295
NP_442006.1_2 Reverse -85 -102 -7.72931 0.182
NP_442006.1_2 Reverse -157 -174 -18.3491 0.29
NP_442243.1_1 Reverse -151 -169 -1.6532 0.279
NP_441078.1_4 Reverse -157 -166 6.39124 0.0775
NP_441078.1_4 Forward -166 -157 -1.77023 0.266
NP_442348.1_2 Forward -145 -136 11.9961 0.225
NP_442348.1_2 Forward -155 -146 7.17789 0.285
NP_442443.1_4 Reverse -139 -149 13.6475 0.233
NP_440793.1_1 Reverse -317 -331 16.3219 0.212
NP_440793.1_1 Forward -379 -365 9.04542 0.295
NP_440526.1_3 Forward -282 -271 6.64635 0.189
NP_441432.1_8 Forward -271 -262 5.40793 0.158
NP_441432.1_8 Reverse -156 -165 3.34298 0.248
NP_441432.1_8 Reverse -366 -375 2.85133 0.281
NP_440629.1_4 Reverse -164 -183 9.0459 0.257
NP_440629.1_4 Reverse -133 -152 8.16093 0.271
NP_441057.1_3 Forward -228 -209 -2.65548 0.159
NP_442353.1_4 Reverse -34 -53 0.490334 0.268
NP_442751.1_2 Forward -104 -85 3.73524 0.265
NP_442489.1_7 Reverse -157 -166 -1.37691 0.195
NP_442489.1_7 Reverse -261 -270 -1.57357 0.213
NP_441968.1_1 Reverse -4 -12 14.1787 0.286
NP_440708.1_8 Forward -215 -196 22.0176 0.0891
NP_441786.1_10 Reverse -127 -146 5.99764 0.287
NP_440486.1_6 Forward -220 -201 7.27595 0.274
NP_440459.1_2 Forward -222 -205 11.9369 0.165
NP_442311.1_5 Forward -226 -207 5.01433 0.245
NP_440449.1_6 Forward -174 -156 12.4381 0.114
NP_441329.1_6 Reverse -241 -260 1.09773 0.244
NP_442943.1_1 Reverse -179 -194 3.00991 0.286
NP_442028.1_1 Reverse -312 -325 10.5659 0.251
NP_440227.1_6 Reverse -351 -365 15.2903 0.263
NP_440156.1_4 Reverse -239 -249 8.63269 0.281
NP_442691.1_2 Reverse -149 -168 13.6675 0.0919
NP_442568.1_8 Reverse -352 -366 10.1277 0.257
NP_442568.1_8 Reverse -349 -363 9.73436 0.257
NP_442568.1_8 Reverse -136 -150 7.66941 0.296
NP_441936.1_9 Forward -237 -218 13.3725 0.26
NP_442052.1_8 Reverse -134 -144 12.6647 0.258
NP_440374.1_6 Forward -346 -327 9.43923 0.299
NP_441474.1_1 Reverse -194 -213 -1.57461 0.262
NP_442402.1_10 Reverse -322 -332 10.1076 0.3
NP_439948.1_2 Reverse -348 -366 14.7077 0.259
NP_441084.1_6 Reverse -213 -227 9.05325 0.295
NP_442358.1_6 Reverse -362 -380 26.5685 0.003
NP_441053.1_8 Forward -147 -128 13.3725 0.21
NP_442456.1_5 Forward -341 -323 17.2271 0.2
NP_441408.2_7 Reverse -232 -251 -3.14714 0.272
NP_440914.1_1 Reverse -136 -146 9.7862 0.172
NP_442533.1_6 Forward -213 -204 4.12963 0.191
NP_442322.1_2 Forward -35 -16 14.4533 0.229
NP_441527.1_4 Reverse -361 -380 -4.24981 0.182
NP_441527.1_4 Reverse -360 -379 -7.01908 0.229
NP_441347.1_5 Reverse -209 -223 13.077 0.238
NP_443045.1_3 Forward -167 -148 18.1907 0.254
NP_440828.1_4 Forward -104 -85 -8.16275 0.296
NP_441001.1_5 Forward -300 -281 12.3892 0.233
NP_442382.1_9 Forward -72 -53 11.5033 0.275
NP_442072.1_9 Forward -167 -149 -4.50408 0.0462
NP_442264.1_2 Forward -347 -330 7.217 0.246
NP_442842.1_10 Forward -378 -359 0.174202 0.27
NP_442061.1_6 Forward -256 -246 16.598 0.232
NP_442209.1_3 Reverse -307 -326 19.174 0.0424
NP_442615.1_1 Forward -175 -157 -1.06249 0.124
NP_440855.1_5 Forward -51 -32 2.26028 0.295
NP_441174.1_4 Reverse -296 -306 13.943 0.267
NP_440725.1_5 Forward -188 -169 7.37428 0.267
NP_440801.1_9 Forward -175 -161 13.9018 0.262
NP_441436.1_2 Reverse -87 -106 0.687771 0.275
NP_442514.1_5 Reverse -25 -44 -5.60616 0.26
NP_440478.1_9 Reverse -207 -226 22.6156 0.0597
NP_440649.2_8 Reverse -35 -49 14.3559 0.232
NP_442341.1_7 Reverse -45 -59 6.3911 0.127
NP_441842.1_10 Reverse -87 -101 6.58777 0.283
NP_441122.1_1 Forward -217 -202 3.12649 0.285
NP_442214.1_1 Forward -226 -207 9.14423 0.276
NP_442373.1_2 Reverse -76 -95 -8.65367 0.249
NP_440216.1_1 Forward -166 -152 -11.3085 0.178
NP_440216.1_9 Reverse -167 -176 14.0611 0.184
NP_440172.1_1 Forward -270 -260 2.92996 0.258
NP_440416.1_9 Reverse -327 -346 -12.1936 0.155
NP_442154.1_1 Reverse -86 -104 -16.1071 0.232
NP_440261.1_5 Reverse -158 -171 -2.63565 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCTGTTGCAATTCTATTATCAGTTTCCCTTTGCCTCTTTTATCATCTTTATTGTGCTGTTTATGGCAGTGGTGAGAAACAACAATATCTCCCACTTTATCCGCTTCAATGCTATGCAAGCCATCCTAATTGGCATTCTCCTATCCTTGTTTGGCTTAATCGTTGCCTACGTGATCCAGCCAGTGTTTGGCCAGGGACTAGTTACCGAAACCCTCTACAATTTTGCTTTCCTTGGGGCCTTAGCCTGTGGATTTTTCGGCATTGTTCAATCAGTGCTGGGACGCTACGCAGAAATTCCCACCATTTCCGACGCGGCCTATTCCCAAGTGCGCTTTTAATTACCCACGTTGATGGACCCTGCCTCTGACCAAGTTGATTAACTGGAGCTATTTTTCCTGACC

CDS

ATGTCTGATAGTCGTTTAAATCTGGTGGCGATCGCCATTTTCCTAATGATGATGTCTGCCCTGGTGGGGCCGATAGTGCACCTTTCTCCGGCTATTCCAGCAGCGGCGACCTTAGGGATTTTGGGCATAATCACAGCGGATCAAATTAGTTGGCAGGGCAAGGGGACAGACTTTTTTGTCGGTCTCTTCCAAACCAAAGCGGAAAAAGAGAGAATTTTGTGCCATGAAGCAGGGCATTTTCTGGTGGCCCATTGCCTACAAATTCCCATTACTAACTACAGTCTTAGTCCCTGGGAAGTTCTGCGCCAGGGAGCCGGGGGAATGGCGGGCATCCAATTTGATACGACCAATCTAGAAAATCAGTGTCGGGATTGGCACCTCCGCCCCCAAGCTCTGGAACGTTGGGCTACGGTTTGGATGGCGGGCATTGCCGCAGAAAAAATTATCTATGGTGAATCCCAGGGAGGAAACGGCGATCGCCAACAGCTACGCCAAGCTTTTCGTCGGGCAGGACTGCCAGAAATTAAACTACAGCAAAAGGAAAGTTGGGCTTTTCTCCAAGCTAAAAACCTGCTGGAACAACACCGCCAAGCCCATGGTCAGTTGCAACAAGCCCTGGCCCAACGGCGATCGGTAGAAGAATGTCGCCATCTTCTCGCCCAACATCTAGGAGAGCCTGCTGTTGGTTCCAATTGA

Protein

MSDSRLNLVAIAIFLMMMSALVGPIVHLSPAIPAAATLGILGIITADQISWQGKGTDFFVGLFQTKAEKERILCHEAGHFLVAHCLQIPITNYSLSPWEVLRQGAGGMAGIQFDTTNLENQCRDWHLRPQALERWATVWMAGIAAEKIIYGESQGGNGDRQQLRQAFRRAGLPEIKLQQKESWAFLQAKNLLEQHRQAHGQLQQALAQRRSVEECRHLLAQHLGEPAVGSN