Your browser is old and dusty. Try Google Chrome!

Details for sll1714

ORF sll1714
Accession NP_440776.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -32 -46 10.6193 0.06
NP_441061.1_2 Forward -39 -25 0.786239 0.199
NP_440795.1_7 Forward -39 -32 14.6904 0.0123
NP_440795.1_7 Reverse -32 -39 14.6904 0.0123
NP_441418.1_6 Reverse -31 -50 -20.65 0.121
NP_442291.1_5 Reverse -30 -46 6.05672 0.0727
NP_442291.1_5 Forward -41 -25 -0.924775 0.19
NP_442291.1_5 Reverse -141 -157 -1.80975 0.202
NP_440897.1_6 Reverse -31 -50 -2.36125 0.21
NP_441453.1_4 Reverse -31 -39 16.539 0.00633
NP_441453.1_4 Forward -40 -32 16.539 0.00633
NP_442151.1_6 Reverse -31 -45 12.6843 0.0691
NP_442151.1_6 Forward -40 -26 9.73436 0.141
NP_441818.1_1 Reverse -32 -43 18.446 0.0046
NP_441818.1_1 Forward -39 -28 13.1362 0.0861
NP_440226.1_1 Forward -40 -21 20.7473 0.0087
NP_440226.1_1 Reverse -31 -50 6.88262 0.118
NP_440226.1_1 Forward -309 -290 2.94938 0.246
NP_442173.1_1 Forward -39 -31 15.4574 0.00633
NP_442173.1_1 Reverse -32 -40 15.4574 0.00633
NP_442752.1_4 Forward -40 -33 13.8055 0.0199
NP_442752.1_4 Reverse -31 -38 13.8055 0.0199
NP_443027.1_4 Forward -42 -32 14.0414 0.0452
NP_443027.1_4 Reverse -29 -39 13.1564 0.0521
NP_441812.1_3 Reverse -30 -44 10.4227 0.222
NP_442975.1_10 Forward -44 -30 12.487 0.0477
NP_442975.1_10 Reverse -27 -41 11.2087 0.0508
NP_440784.1_7 Forward -39 -32 15.9687 0.0123
NP_440784.1_7 Reverse -32 -39 15.9687 0.0123
NP_442909.1_7 Reverse -32 -46 14.5519 0.12
NP_442861.1_4 Forward -293 -274 -1.37794 0.297
NP_440061.1_9 Forward -42 -28 17.7968 0.012
NP_440061.1_9 Reverse -29 -43 5.21053 0.293
NP_442062.1_8 Forward -40 -30 17.3846 0.00193
NP_442062.1_8 Reverse -31 -41 17.3846 0.00193
NP_441859.1_3 Forward -41 -22 12.1917 0.102
NP_441859.1_3 Reverse -30 -49 1.57197 0.281
NP_440304.1_4 Forward -42 -32 10.8948 0.051
NP_440304.1_4 Reverse -29 -39 9.91146 0.051
NP_442242.1_4 Forward -39 -32 14.3954 0.0124
NP_442242.1_4 Reverse -32 -39 14.3954 0.0124
NP_440044.1_8 Reverse -32 -51 4.42435 0.114
NP_440044.1_8 Reverse -89 -108 -0.000545616 0.208
NP_441594.1_6 Reverse -28 -47 0.0977854 0.293
NP_441594.1_6 Forward -49 -30 -0.39387 0.299
NP_442742.1_9 Reverse -150 -169 -8.752 0.269
NP_442110.1_7 Reverse -31 -45 8.55439 0.0877
NP_440014.1_7 Forward -49 -35 17.6002 0.119
NP_440856.1_1 Reverse -27 -46 3.73603 0.157
NP_441083.1_5 Forward -40 -30 20.3345 0.00053
NP_441083.1_5 Reverse -31 -41 20.3345 0.00053
NP_442827.1_8 Forward -48 -29 3.44025 0.146
NP_440109.1_6 Reverse -63 -82 9.83255 0.268
NP_441738.1_2 Forward -38 -31 15.28 0.0102
NP_441738.1_2 Reverse -33 -40 15.28 0.0102
NP_441558.1_5 Reverse -29 -48 6.09597 0.229
NP_440209.1_1 Reverse -31 -39 18.1123 0.00295
NP_440209.1_1 Forward -40 -32 18.1123 0.00295
NP_442889.1_8 Reverse -28 -42 10.0287 0.0916
NP_441713.1_1 Reverse -25 -44 -12.3902 0.244
NP_442675.1_4 Reverse -44 -62 -3.42244 0.257
NP_440178.1_7 Reverse -30 -49 -3.63879 0.0481
NP_440178.1_7 Forward -41 -22 -21.3384 0.218
NP_441716.1_1 Reverse -31 -45 13.7659 0.0689
NP_441716.1_1 Forward -40 -26 8.55439 0.138
NP_441327.1_1 Forward -169 -150 2.48341 0.292
NP_442111.1_4 Forward -41 -27 3.53951 0.24
NP_440906.1_5 Forward -39 -32 15.8704 0.0124
NP_440906.1_5 Reverse -32 -39 15.8704 0.0124
NP_440747.1_10 Forward -43 -31 7.51213 0.00286
NP_440747.1_10 Reverse -28 -40 7.4138 0.00422
NP_441130.1_10 Forward -42 -28 8.16106 0.14
NP_441130.1_10 Reverse -29 -43 7.86607 0.146
NP_441486.1_1 Forward -43 -29 14.0609 0.00683
NP_441486.1_1 Reverse -28 -42 3.93283 0.0522
NP_442634.1_4 Reverse -29 -43 -3.63866 0.161
NP_440403.1_10 Reverse -28 -47 1.27776 0.291
NP_441014.1_10 Reverse -30 -49 -1.77127 0.265
NP_442848.1_1 Forward -46 -32 7.17775 0.0791
NP_442848.1_1 Reverse -31 -45 1.27789 0.239
NP_442848.1_1 Reverse -25 -39 -2.06536 0.263
NP_443018.1_3 Forward -39 -32 14.8871 0.0123
NP_443018.1_3 Reverse -32 -39 14.8871 0.0123
NP_443018.1_3 Forward -45 -38 4.07068 0.299
NP_441634.1_8 Forward -42 -28 3.73617 0.143
NP_441634.1_8 Reverse -29 -43 -3.83532 0.295
NP_440376.1_1 Forward -40 -31 19.4693 0.000692
NP_440376.1_1 Reverse -31 -40 19.4693 0.000692
NP_441588.1_4 Forward -38 -28 6.37155 0.2
NP_442687.1_7 Forward -41 -31 8.92815 0.0994
NP_442687.1_7 Reverse -30 -40 8.92815 0.0994
NP_442658.1_1 Reverse -29 -39 9.616 0.147
NP_442658.1_1 Forward -42 -32 6.76441 0.214
NP_442205.1_9 Forward -46 -30 6.9417 0.11
NP_442205.1_9 Forward -247 -231 -3.57971 0.287
NP_441414.1_9 Forward -40 -21 1.57275 0.073
NP_441414.1_9 Reverse -31 -50 -4.22878 0.15
NP_441487.1_9 Reverse -208 -227 -1.96717 0.29
NP_442937.1_5 Reverse -26 -45 22.5172 0.003
NP_442937.1_5 Forward -45 -26 7.57094 0.248
NP_441958.1_5 Forward -41 -31 12.2714 0.00183
NP_441958.1_5 Reverse -30 -40 12.2714 0.00183
NP_441958.1_5 Reverse -299 -309 -1.88825 0.26
NP_440203.1_5 Reverse -235 -245 8.63269 0.29
NP_440984.1_7 Reverse -26 -40 8.84938 0.134
NP_442911.1_2 Reverse -21 -40 14.0608 0.0113
NP_442911.1_2 Forward -50 -31 6.19431 0.03
NP_443055.1_6 Reverse -23 -41 6.1149 0.172
NP_441913.1_1 Reverse -189 -205 13.4326 0.256
NP_441099.1_5 Reverse -21 -40 -10.6203 0.258
NP_440809.1_9 Forward -49 -31 1.88744 0.118
NP_441294.1_7 Forward -44 -30 14.818 0.0351
NP_441646.1_1 Reverse -24 -43 2.3594 0.218
NP_441646.1_1 Forward -47 -28 -1.37718 0.284
NP_442438.1_10 Forward -45 -31 10.7177 0.0491
NP_441000.1_6 Reverse -30 -44 -5.40861 0.275
NP_440605.1_4 Reverse -21 -40 19.9779 0.0461
NP_440147.1_4 Forward -42 -29 11.524 0.0326
NP_440147.1_4 Reverse -29 -42 2.08423 0.21
NP_441550.1_8 Reverse -29 -39 16.7941 0.00906
NP_441550.1_8 Forward -42 -32 12.3692 0.0336
NP_441916.1_7 Forward -40 -30 10.3048 0.0261
NP_441916.1_7 Reverse -31 -41 10.3048 0.0261
NP_441916.1_10 Forward -48 -29 3.24438 0.236
NP_440345.1_5 Reverse -14 -28 13.7611 0.276
NP_441041.1_4 Reverse -31 -50 1.37609 0.0808
NP_442004.1_6 Reverse -31 -45 12.586 0.104
NP_442004.1_6 Forward -46 -32 2.35953 0.266
NP_441725.1_5 Reverse -32 -42 11.2881 0.0247
NP_441725.1_5 Forward -39 -29 9.02648 0.0553
NP_439966.1_7 Forward -42 -32 15.8108 0.0124
NP_439966.1_7 Reverse -29 -39 14.8275 0.0177
NP_439966.1_9 Reverse -29 -38 0.884706 0.253
NP_442941.1_3 Reverse -32 -42 19.9412 0.00262
NP_442941.1_3 Forward -39 -29 10.9931 0.0116
NP_440289.1_2 Forward -43 -30 3.85419 0.0735
NP_440289.1_2 Reverse -28 -41 2.08423 0.105
NP_441514.1_4 Forward -136 -117 12.1147 0.294
NP_442281.1_1 Forward -45 -31 7.3738 0.102
NP_442281.1_1 Reverse -26 -40 7.27547 0.104
NP_441079.1_7 Forward -272 -253 -6.19614 0.273
NP_441079.1_7 Reverse -251 -270 -7.6711 0.296
NP_440177.1_9 Reverse -23 -42 14.2574 0.213
NP_442256.1_2 Reverse -29 -47 8.7706 0.0965
NP_440498.1_1 Forward -49 -31 7.59063 0.0833
NP_441644.1_6 Forward -40 -30 17.3841 0.00127
NP_441644.1_6 Reverse -31 -41 17.3841 0.00127
NP_442215.1_2 Reverse -199 -215 2.71347 0.111
NP_442215.1_2 Reverse -29 -45 -6.82463 0.28
NP_440253.1_2 Forward -40 -22 22.6353 0.0026
NP_440253.1_2 Reverse -31 -49 -2.63579 0.271
NP_440929.1_8 Forward -40 -31 19.2726 0.000701
NP_440929.1_8 Reverse -31 -40 19.2726 0.000701
NP_442933.1_10 Forward -40 -31 17.601 0.00325
NP_442933.1_10 Reverse -31 -40 17.601 0.00325
NP_441751.2_8 Forward -39 -25 -2.95034 0.134
NP_441751.2_8 Reverse -32 -46 -3.04867 0.134
NP_442554.1_8 Forward -39 -29 18.0729 0.00543
NP_442554.1_8 Reverse -32 -42 15.9097 0.00747
NP_442554.1_8 Forward -45 -35 2.63497 0.265
NP_442970.1_1 Reverse -152 -166 9.08335 0.287
NP_441762.1_7 Forward -41 -29 2.69391 0.0676
NP_441762.1_7 Reverse -30 -42 -6.84419 0.284
NP_442142.1_4 Forward -43 -30 6.31189 0.169
NP_442142.1_4 Reverse -28 -41 4.24695 0.227
NP_442142.1_4 Forward -49 -36 3.85363 0.243
NP_442292.1_1 Forward -39 -30 18.486 0.00229
NP_442292.1_1 Reverse -32 -41 18.486 0.00229
NP_440775.1_5 Forward -60 -41 24.2872 0.00133
NP_442476.1_6 Forward -39 -25 10.9143 0.0601
NP_442381.1_8 Reverse -28 -47 -14.8485 0.288
NP_443009.1_5 Reverse -30 -41 8.90795 0.0965
NP_443009.1_5 Forward -41 -30 8.90795 0.0965
NP_443009.1_5 Reverse -231 -242 4.18809 0.259
NP_441715.1_4 Reverse -32 -42 14.828 0.0268
NP_441715.1_4 Forward -39 -29 7.84651 0.107
NP_440881.1_7 Reverse -305 -324 12.7825 0.257
NP_441468.1_1 Forward -39 -32 15.8704 0.0124
NP_441468.1_1 Reverse -32 -39 15.8704 0.0124
NP_441468.1_1 Forward -45 -38 10.9539 0.0726
NP_441015.1_10 Forward -45 -26 -6.39206 0.248
NP_441673.1_1 Forward -40 -31 20.8459 0.000698
NP_441673.1_1 Reverse -31 -40 20.8459 0.000698
NP_441826.1_2 Reverse -31 -45 2.45787 0.127
NP_441764.1_8 Forward -160 -150 11.3107 0.284
NP_442868.1_6 Reverse -29 -39 17.4829 0.012
NP_442868.1_6 Forward -42 -32 9.91146 0.038
NP_441612.1_2 Reverse -31 -41 8.54929 0.21
NP_441612.1_2 Forward -40 -30 8.54929 0.21
NP_442427.1_8 Reverse -22 -41 20.354 0.0239
NP_442808.1_1 Reverse -30 -40 8.63269 0.0481
NP_442808.1_1 Forward -41 -31 8.63269 0.0481
NP_440145.1_3 Reverse -21 -40 1.17943 0.129
NP_442542.1_2 Reverse -29 -42 13.1956 0.114
NP_442050.1_5 Forward -42 -32 16.4991 0.00812
NP_442050.1_5 Reverse -29 -39 15.6142 0.01
NP_441114.1_3 Forward -209 -200 14.5527 0.193
NP_440558.1_2 Forward -185 -166 -5.11376 0.253
NP_440558.1_2 Forward -49 -30 -5.70374 0.264
NP_440111.2_2 Forward -51 -32 -3.44213 0.265
NP_441518.1_3 Forward -50 -31 -6.58872 0.14
NP_441518.1_3 Reverse -21 -40 -11.2103 0.256
NP_441878.1_6 Forward -41 -31 10.4031 0.0176
NP_441878.1_6 Reverse -30 -40 10.4031 0.0176
NP_441878.1_6 Forward -211 -201 -7.59145 0.245
NP_441036.1_8 Forward -41 -31 8.33817 0.174
NP_441036.1_8 Reverse -30 -40 8.33817 0.174
NP_442650.1_2 Reverse -31 -45 4.52282 0.169
NP_441557.1_5 Forward -40 -31 19.9609 0.000699
NP_441557.1_5 Reverse -31 -40 19.9609 0.000699
NP_441445.1_1 Forward -49 -30 18.3873 0.0285
NP_441445.1_1 Reverse -22 -41 5.01433 0.181
NP_442066.2_9 Reverse -27 -40 10.344 0.154
NP_442795.1_10 Forward -153 -134 14.8474 0.28
NP_442419.1_2 Reverse -26 -45 4.32602 0.184
NP_442183.1_1 Forward -40 -26 16.5192 0.0143
NP_442183.1_1 Reverse -31 -45 12.291 0.0616
NP_441819.1_5 Forward -170 -151 10.8379 0.261
NP_441549.1_9 Reverse -27 -45 -7.35568 0.207
NP_442347.1_2 Forward -39 -30 12.4878 0.056
NP_442347.1_2 Reverse -32 -41 12.4878 0.056
NP_442347.1_2 Reverse -309 -318 11.2095 0.056
NP_441037.1_4 Reverse -29 -39 9.55921 0.21
NP_441633.1_3 Forward -42 -29 3.75586 0.0699
NP_441633.1_3 Reverse -29 -42 -6.07724 0.236
NP_440136.1_2 Forward -39 -32 15.9687 0.0123
NP_440136.1_2 Reverse -32 -39 15.9687 0.0123
NP_442998.1_5 Forward -205 -195 9.32148 0.243
NP_442998.1_10 Forward -38 -31 15.5754 0.0102
NP_442998.1_10 Reverse -33 -40 15.5754 0.0102
NP_440299.1_1 Reverse -27 -40 12.605 0.0362
NP_440299.1_1 Forward -44 -31 10.3434 0.0573
NP_441799.1_1 Forward -44 -30 13.7653 0.03
NP_441799.1_1 Reverse -27 -41 10.3237 0.0756
NP_441007.1_10 Reverse -26 -39 8.67241 0.112
NP_441007.1_10 Forward -45 -32 1.49425 0.203
NP_441007.1_10 Forward -246 -233 -0.865694 0.295
NP_440256.1_1 Reverse -28 -47 -4.32711 0.152
NP_440256.1_1 Forward -43 -24 -6.78538 0.22
NP_441362.1_2 Forward -169 -150 5.74825 0.243
NP_440915.1_6 Reverse -27 -41 3.53951 0.101
NP_441704.1_8 Forward -51 -32 20.7464 0.0268
NP_441464.1_8 Forward -40 -26 6.98109 0.222
NP_440695.1_5 Reverse -31 -50 7.37428 0.15
NP_440695.1_5 Forward -241 -222 3.44104 0.225
NP_441939.1_3 Reverse -32 -51 14.2574 0.0777
NP_442993.1_1 Reverse -31 -47 -9.28291 0.181
NP_442993.1_1 Reverse -300 -316 -13.1178 0.286
NP_440677.1_6 Reverse -51 -70 11.8975 0.211
NP_442386.1_9 Reverse -30 -39 13.8639 0.0289
NP_442386.1_9 Forward -41 -32 13.8639 0.0289
NP_442386.1_9 Reverse -36 -45 4.7192 0.289
NP_441340.1_5 Forward -39 -32 15.6737 0.0124
NP_441340.1_5 Reverse -32 -39 15.6737 0.0124
NP_440251.1_1 Reverse -282 -301 10.9142 0.14
NP_442240.1_2 Reverse -295 -314 -19.6667 0.295
NP_440586.1_8 Forward -39 -32 13.2151 0.026
NP_440586.1_8 Reverse -32 -39 13.2151 0.026
NP_442251.1_6 Forward -39 -32 15.2804 0.0124
NP_442251.1_6 Reverse -32 -39 15.2804 0.0124
NP_441262.1_3 Reverse -31 -38 14.7888 0.0223
NP_441262.1_3 Forward -40 -33 14.7888 0.0223
NP_443051.1_1 Reverse -30 -39 10.4228 0.00754
NP_443051.1_1 Forward -41 -32 10.4228 0.00754
NP_439937.1_9 Forward -41 -24 -14.5148 0.287
NP_440439.1_1 Forward -43 -30 2.37923 0.135
NP_439943.1_7 Forward -81 -62 5.01433 0.273
NP_440372.1_2 Forward -39 -32 16.3621 0.0124
NP_440372.1_2 Reverse -32 -39 16.3621 0.0124
NP_442384.1_10 Reverse -31 -44 10.049 0.047
NP_442384.1_10 Forward -40 -27 2.67422 0.216
NP_442790.1_4 Reverse -22 -41 -10.817 0.218
NP_442262.1_10 Forward -39 -32 14.1988 0.0123
NP_442262.1_10 Reverse -32 -39 14.1988 0.0123
NP_442262.1_10 Forward -45 -38 9.47889 0.187
NP_441689.1_5 Forward -42 -32 15.3192 0.0403
NP_441689.1_5 Reverse -29 -39 5.87944 0.197
NP_440344.1_10 Forward -47 -30 1.02215 0.0322
NP_440344.1_10 Reverse -24 -41 0.0388413 0.0376
NP_440282.1_10 Forward -50 -31 -5.99873 0.25
NP_442123.1_3 Reverse -31 -50 11.0125 0.263
NP_441965.1_10 Reverse -28 -44 8.61333 0.123
NP_440297.1_9 Reverse -32 -42 9.32148 0.0917
NP_440297.1_9 Forward -39 -29 -0.216628 0.282
NP_441679.1_6 Reverse -26 -45 10.7175 0.09
NP_440888.1_2 Forward -40 -26 16.9119 0.00511
NP_440888.1_2 Reverse -31 -45 16.0269 0.00832
NP_440792.1_5 Forward -39 -20 6.19431 0.237
NP_440575.1_8 Reverse -63 -82 0.687771 0.185
NP_441543.1_2 Forward -39 -30 16.9127 0.00359
NP_441543.1_2 Reverse -32 -41 16.9127 0.00359
NP_442845.1_2 Reverse -25 -39 10.7177 0.143
NP_442845.1_2 Forward -46 -32 7.9644 0.195
NP_442845.1_2 Reverse -31 -45 6.78443 0.202
NP_441304.1_10 Forward -392 -383 12.9794 0.271
NP_441469.1_8 Forward -41 -32 6.48957 0.227
NP_441469.1_8 Reverse -30 -39 6.48957 0.227
NP_443064.1_6 Forward -40 -30 12.5669 0.0796
NP_443064.1_6 Reverse -31 -41 12.5669 0.0796
NP_442578.1_7 Forward -39 -32 14.5921 0.026
NP_442578.1_7 Reverse -32 -39 14.5921 0.026
NP_441462.1_2 Forward -40 -30 11.5831 0.00406
NP_441462.1_2 Reverse -31 -41 11.5831 0.00406
NP_443062.1_1 Forward -40 -22 4.35311 0.264
NP_443062.1_1 Reverse -31 -49 4.2556 0.268
NP_442204.1_2 Reverse -95 -114 6.68596 0.287
NP_440516.1_8 Forward -40 -31 16.9127 0.00442
NP_440516.1_8 Reverse -31 -40 16.9127 0.00442
NP_442428.1_5 Forward -39 -32 15.8704 0.0124
NP_442428.1_5 Reverse -32 -39 15.8704 0.0124
NP_442428.1_5 Forward -45 -38 4.66067 0.244
NP_442120.1_10 Reverse -61 -80 -14.5535 0.288
NP_440673.1_3 Forward -38 -31 12.4288 0.0426
NP_440673.1_3 Reverse -33 -40 12.4288 0.0426
NP_440673.1_3 Reverse -48 -55 9.08556 0.202
NP_441052.1_2 Forward -40 -30 19.9412 0.00106
NP_441052.1_2 Reverse -31 -41 19.9412 0.00106
NP_442219.1_8 Reverse -27 -46 10.1964 0.21
NP_442219.1_8 Reverse -21 -40 9.71324 0.222
NP_442219.1_8 Forward -50 -31 7.20077 0.275
NP_442219.1_9 Forward -39 -30 17.7976 0.00718
NP_442219.1_9 Reverse -32 -41 17.7976 0.00718
NP_440436.1_4 Forward -39 -30 17.2072 0.00233
NP_440436.1_4 Reverse -32 -41 17.2072 0.00233
NP_441884.1_9 Reverse -28 -47 -21.6334 0.256
NP_440314.1_9 Forward -39 -20 0.884433 0.0952
NP_441719.1_4 Forward -39 -32 16.3621 0.0124
NP_441719.1_4 Reverse -32 -39 16.3621 0.0124
NP_441733.1_10 Reverse -28 -41 7.59077 0.153
NP_442206.1_1 Reverse -31 -50 -11.7019 0.22
NP_443054.1_2 Forward -42 -28 2.85119 0.24
NP_441851.1_10 Forward -41 -31 15.8113 0.00552
NP_441851.1_10 Reverse -30 -40 15.8113 0.00552
NP_442898.1_1 Forward -205 -187 15.8933 0.298
NP_441668.1_4 Reverse -21 -40 0.294447 0.244
NP_442515.1_1 Forward -41 -27 21.3374 0.0134
NP_442515.1_1 Reverse -30 -44 16.5192 0.0227
NP_441982.1_6 Forward -276 -267 13.5358 0.274
NP_440338.1_4 Reverse -118 -137 4.81688 0.298
NP_441349.1_10 Forward -50 -31 1.96607 0.0784
NP_441409.1_6 Forward -46 -27 -9.93197 0.196
NP_440432.1_9 Forward -39 -24 7.74804 0.0427
NP_440474.1_8 Forward -39 -25 5.89884 0.237
NP_440474.1_8 Reverse -32 -46 4.8172 0.266
NP_442450.1_5 Forward -42 -32 9.32148 0.115
NP_440588.1_2 Reverse -28 -47 -6.78538 0.292
NP_441570.1_1 Reverse -31 -49 9.0656 0.0123
NP_441078.1_4 Forward -40 -31 19.6659 0.0007
NP_441078.1_4 Reverse -31 -40 19.6659 0.0007
NP_442729.1_8 Reverse -27 -40 10.4424 0.125
NP_440707.1_9 Forward -63 -44 -0.000545616 0.293
NP_440526.1_3 Forward -39 -28 10.7762 0.0646
NP_440526.1_3 Reverse -32 -43 0.844851 0.267
NP_441432.1_8 Reverse -30 -39 16.8143 0.00595
NP_441432.1_8 Forward -41 -32 16.8143 0.00595
NP_441432.1_8 Reverse -299 -308 3.04799 0.268
NP_442320.1_8 Reverse -25 -39 22.4191 0.00497
NP_442320.1_8 Forward -46 -32 5.40779 0.0386
NP_442344.1_7 Reverse -32 -51 -7.4737 0.183
NP_441732.1_2 Forward -44 -28 2.02515 0.0253
NP_441732.1_2 Reverse -27 -43 -15.3794 0.145
NP_440760.1_1 Forward -40 -21 -12.7836 0.0947
NP_442797.1_7 Forward -47 -29 5.23069 0.216
NP_440199.1_10 Forward -43 -33 15.5163 0.0861
NP_442400.1_10 Reverse -150 -163 8.0831 0.279
NP_440713.1_4 Forward -50 -31 12.1925 0.108
NP_442489.1_2 Forward -51 -32 12.9791 0.137
NP_442489.1_7 Forward -40 -31 20.1576 0.000695
NP_442489.1_7 Reverse -31 -40 20.1576 0.000695
NP_442079.1_7 Forward -39 -20 3.83436 0.207
NP_440559.1_1 Forward -39 -30 17.4043 0.00658
NP_440559.1_1 Reverse -32 -41 17.4043 0.00658
NP_441659.2_8 Forward -40 -30 18.1713 0.00133
NP_441659.2_8 Reverse -31 -41 18.1713 0.00133
NP_441659.2_8 Forward -309 -299 2.43831 0.2
NP_442913.1_10 Forward -49 -30 0.294447 0.155
NP_441185.1_7 Reverse -221 -240 13.2741 0.279
NP_442346.1_5 Forward -41 -31 16.6963 0.00248
NP_442346.1_5 Reverse -30 -40 16.6963 0.00248
NP_442346.1_5 Forward -56 -46 6.66654 0.195
NP_442346.1_10 Forward -99 -80 1.86774 0.209
NP_440352.1_8 Reverse -370 -386 18.2261 0.197
NP_440545.1_3 Reverse -27 -44 -3.40274 0.203
NP_440025.1_3 Reverse -198 -212 10.514 0.29
NP_440010.1_4 Reverse -27 -46 2.9486 0.221
NP_440010.1_4 Forward -50 -31 0.785326 0.243
NP_442603.1_7 Reverse -37 -51 9.6354 0.144
NP_442603.1_7 Forward -40 -26 8.3571 0.176
NP_441948.1_4 Forward -47 -29 -1.65248 0.148
NP_441833.1_4 Forward -39 -32 15.9687 0.0124
NP_441833.1_4 Reverse -32 -39 15.9687 0.0124
NP_442162.1_9 Forward -39 -32 16.2637 0.0124
NP_442162.1_9 Reverse -32 -39 16.2637 0.0124
NP_442199.1_5 Forward -48 -29 14.7491 0.0369
NP_442140.1_3 Forward -39 -29 13.5497 0.0542
NP_442140.1_3 Reverse -32 -42 4.40493 0.243
NP_442914.1_9 Forward -110 -91 12.5858 0.227
NP_441813.1_5 Forward -42 -32 15.9097 0.01
NP_441813.1_5 Reverse -29 -39 8.73149 0.0367
NP_440590.1_4 Reverse -32 -45 2.87088 0.0788
NP_440590.1_4 Forward -39 -26 2.57589 0.0845
NP_440567.1_1 Reverse -32 -46 8.94771 0.0517
NP_440567.1_1 Forward -39 -25 8.35772 0.0584
NP_440567.1_1 Forward -150 -136 0.982901 0.224
NP_442497.1_10 Forward -39 -30 10.4228 0.0087
NP_442497.1_10 Reverse -32 -41 10.4228 0.0087
NP_440821.1_4 Forward -42 -32 18.2696 0.00448
NP_440821.1_4 Reverse -29 -39 17.9746 0.00497
NP_440227.1_2 Forward -236 -220 8.61333 0.29
NP_441239.1_9 Reverse -29 -41 7.11881 0.169
NP_441239.1_9 Forward -42 -30 4.36554 0.253
NP_442568.1_9 Forward -141 -122 14.6508 0.254
NP_441727.1_3 Reverse -24 -43 22.7139 0.0124
NP_441727.1_3 Forward -47 -28 16.5191 0.116
NP_441892.1_1 Forward -49 -32 -1.92778 0.215
NP_440796.1_1 Forward -43 -24 8.45592 0.257
NP_440796.1_3 Forward -47 -29 6.90155 0.295
NP_441017.1_6 Forward -44 -30 12.487 0.217
NP_440949.1_7 Forward -54 -35 12.9783 0.209
NP_441782.1_5 Forward -63 -44 8.06259 0.278
NP_440546.1_4 Forward -40 -30 10.046 0.109
NP_440546.1_4 Reverse -31 -41 10.046 0.109
NP_440546.1_4 Forward -309 -299 6.8464 0.276
NP_440462.1_6 Reverse -29 -39 10.3048 0.0396
NP_440462.1_6 Forward -42 -32 7.74818 0.0699
NP_440868.1_4 Forward -44 -32 15.4769 0.0164
NP_440868.1_4 Reverse -27 -39 7.11881 0.0756
NP_442499.1_1 Forward -314 -295 3.24438 0.263
NP_442499.1_3 Forward -41 -23 3.55906 0.289
NP_441848.1_4 Forward -383 -367 7.45517 0.288
NP_440653.1_10 Forward -87 -68 3.44104 0.273
NP_441843.2_9 Reverse -234 -252 10.6866 0.23
NP_442039.1_4 Forward -39 -32 15.1821 0.0124
NP_442039.1_4 Reverse -32 -39 15.1821 0.0124
NP_441811.1_8 Forward -46 -32 6.3911 0.273
NP_442696.1_2 Forward -41 -23 11.9172 0.152
NP_442837.1_3 Forward -39 -32 15.7721 0.0124
NP_442837.1_3 Reverse -32 -39 15.7721 0.0124
NP_442053.1_1 Forward -40 -31 18.3876 0.0007
NP_442053.1_1 Reverse -31 -40 18.3876 0.0007
NP_440505.1_3 Reverse -29 -39 16.598 0.00683
NP_440505.1_3 Forward -42 -32 16.303 0.00696
NP_441959.1_8 Reverse -373 -386 8.61288 0.286
NP_442532.1_7 Forward -40 -26 4.12949 0.178
NP_442532.1_7 Reverse -46 -60 1.86788 0.261
NP_440914.1_1 Forward -40 -30 17.5935 0.000537
NP_440914.1_1 Reverse -31 -41 17.5935 0.000537
NP_441011.1_8 Forward -39 -30 8.25953 0.144
NP_441011.1_8 Reverse -32 -41 8.25953 0.144
NP_442533.1_6 Forward -40 -31 17.2076 0.00137
NP_442533.1_6 Reverse -31 -40 17.2076 0.00137
NP_440263.1_5 Forward -164 -150 17.5025 0.172
NP_443016.1_1 Reverse -195 -214 -5.40875 0.245
NP_441482.1_7 Forward -46 -32 -9.04686 0.193
NP_439944.1_9 Forward -39 -29 19.1546 0.00329
NP_439944.1_9 Reverse -32 -42 19.0562 0.00329
NP_440816.1_2 Forward -384 -365 8.08077 0.258
NP_440115.1_6 Reverse -28 -38 9.7148 0.115
NP_440115.1_6 Forward -43 -33 8.4365 0.13
NP_441170.1_4 Forward -49 -31 8.57394 0.194
NP_441106.1_1 Forward -41 -32 9.63616 0.0311
NP_441106.1_1 Reverse -30 -39 9.63616 0.0311
NP_441420.1_1 Forward -41 -22 -5.50708 0.292
NP_439903.1_6 Reverse -28 -47 -0.886293 0.287
NP_442306.1_10 Forward -45 -26 -18.6834 0.197
NP_441286.1_1 Forward -41 -29 21.6718 0.00196
NP_441286.1_1 Reverse -30 -42 21.3768 0.00196
NP_442674.1_3 Forward -54 -35 8.65176 0.193
NP_440670.1_8 Forward -40 -31 18.3876 0.000699
NP_440670.1_8 Reverse -31 -40 18.3876 0.000699
NP_442908.1_9 Reverse -23 -42 11.2092 0.205
NP_441705.1_3 Forward -176 -157 -5.99873 0.291
NP_440886.1_7 Forward -41 -31 7.94438 0.0805
NP_440886.1_7 Reverse -30 -40 7.94438 0.0805
NP_440886.1_7 Reverse -36 -46 4.50281 0.232
NP_442614.1_2 Reverse -31 -45 6.09611 0.293
NP_441753.1_10 Forward -49 -30 0.491109 0.291
NP_440907.2_8 Forward -39 -29 10.8943 0.0969
NP_442264.1_2 Reverse -27 -44 8.10198 0.222
NP_440841.1_4 Forward -42 -23 3.44104 0.0964
NP_440841.1_4 Reverse -29 -48 -8.16202 0.25
NP_441463.1_3 Forward -50 -31 27.8271 0.000659
NP_441463.1_3 Reverse -21 -40 0.58944 0.13
NP_441463.1_6 Forward -42 -28 17.6254 0.114
NP_441626.1_2 Forward -39 -32 15.7721 0.0124
NP_441626.1_2 Reverse -32 -39 15.7721 0.0124
NP_442365.1_7 Forward -44 -25 1.76941 0.168
NP_442794.1_1 Forward -50 -38 7.02048 0.152
NP_442615.1_1 Forward -49 -31 0.510803 0.101
NP_442615.1_1 Reverse -22 -40 -3.81576 0.17
NP_441962.1_4 Forward -45 -26 2.26107 0.103
NP_441962.1_4 Reverse -32 -51 -11.5053 0.241
NP_440387.1_1 Reverse -31 -47 4.68009 0.0396
NP_440387.1_1 Forward -40 -24 -0.728113 0.141
NP_441836.1_2 Forward -46 -27 -2.95047 0.232
NP_441993.1_1 Forward -46 -27 3.99329 0.227
NP_440114.1_10 Reverse -31 -45 10.4227 0.148
NP_440114.1_10 Reverse -300 -314 8.16106 0.213
NP_440114.1_10 Forward -40 -26 5.70279 0.296
NP_442698.1_3 Reverse -137 -151 20.2551 0.131
NP_441237.1_9 Forward -39 -29 14.9263 0.0242
NP_439910.1_2 Forward -48 -31 -21.594 0.183
NP_440457.1_1 Forward -44 -32 1.90727 0.223
NP_442940.1_2 Reverse -31 -50 5.99764 0.22
NP_440987.1_4 Forward -169 -150 8.25926 0.18
NP_441984.1_3 Forward -192 -174 6.214 0.273
NP_442509.1_9 Forward -40 -30 8.14104 0.192
NP_442509.1_9 Reverse -31 -41 8.14104 0.192
NP_442936.1_10 Forward -138 -124 8.68964 0.269
NP_442936.1_10 Forward -339 -325 7.7326 0.27
NP_440554.1_4 Reverse -32 -42 7.05986 0.106
NP_440554.1_4 Forward -39 -29 6.37155 0.123
NP_441885.1_5 Forward -40 -30 20.9245 0.000538
NP_441885.1_5 Reverse -31 -41 20.9245 0.000538
NP_441428.1_8 Forward -48 -29 1.96607 0.292
NP_442703.1_9 Forward -387 -369 4.24738 0.26
NP_442341.1_7 Forward -41 -27 9.93102 0.0692
NP_442341.1_7 Reverse -30 -44 7.9644 0.0956
NP_443000.1_7 Forward -42 -32 17.0896 0.00865
NP_443000.1_7 Reverse -29 -39 10.4031 0.0345
NP_440507.2_3 Forward -49 -30 16.9115 0.066
NP_440507.2_3 Reverse -22 -41 11.6017 0.176
NP_441842.1_10 Forward -47 -33 16.2242 0.0322
NP_441842.1_10 Reverse -24 -38 11.0127 0.145
NP_440275.1_3 Reverse -29 -39 17.6796 0.0102
NP_440275.1_3 Forward -42 -32 8.1415 0.0602
NP_440091.1_1 Forward -44 -32 14.002 0.0262
NP_440091.1_1 Reverse -27 -39 8.9871 0.0567
NP_443060.1_2 Forward -50 -31 12.5858 0.109
NP_440679.1_10 Reverse -39 -58 -16.5201 0.266
NP_440149.1_8 Reverse -31 -50 7.66927 0.0628
NP_441105.1_3 Forward -51 -32 2.16274 0.107
NP_441105.1_3 Reverse -26 -45 -6.98204 0.243
NP_440216.1_1 Reverse -31 -45 -1.5737 0.034
NP_440216.1_1 Forward -40 -26 -2.85201 0.0608
NP_440216.1_1 Reverse -201 -215 -12.5868 0.288
NP_440216.1_9 Forward -81 -72 6.09625 0.289
NP_440172.1_1 Forward -40 -30 15.0247 0.00945
NP_440172.1_1 Reverse -31 -41 15.0247 0.00945
NP_440172.1_1 Forward -241 -231 4.10993 0.205
NP_442015.1_10 Forward -44 -31 9.55739 0.0475
NP_441226.1_7 Forward -39 -32 14.4934 0.0123
NP_441226.1_7 Reverse -32 -39 14.4934 0.0123
NP_441111.1_7 Forward -39 -31 18.7023 0.00294
NP_441111.1_7 Reverse -32 -40 18.7023 0.00294
NP_441766.1_2 Forward -40 -31 17.5026 0.00297
NP_441766.1_2 Reverse -31 -40 17.5026 0.00297
NP_440416.1_9 Forward -47 -28 -14.2585 0.174
NP_443052.1_8 Forward -50 -31 -0.197208 0.0684
NP_442116.1_6 Forward -167 -150 6.73658 0.271
NP_442403.1_8 Reverse -33 -52 4.03102 0.226
NP_440261.1_5 Forward -39 -26 -10.5021 0.201
NP_440261.1_5 Reverse -32 -45 -12.1738 0.272
NP_440988.1_10 Reverse -29 -43 10.7076 0.187
NP_440988.1_10 Forward -42 -28 10.3203 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCGATACAAGAGCAATTAGGAATAATAAAAACCTGCTTGCAGAGTAATGAAGCTATCCGGCAAAGATTATATTTACCTAACTTGGGTTCAACCGATAGTCTTCAAACGTTATTCCTTATACCTTACTCAAAAAACCCTAGGTTATTATTGGAACTGGAGGCGATTATTTTAAGGACAACTGAGCCGCCGTGCAATGTCCAAATTCCTATGGAGTCCTAGGCCGTGCAAGTGAAATTTTCGGAGCAAATTTCGTCCGCTGATGCAGAAATTATTTTAAGGTGTTTACCAGATCGGATTCAAGATGCCCTAACTGCTCGTGCCACGGAAATTGATTATCCCGTTGAAGCAATCATCGAGATGGCGATCGCCACATTAACTTAAGCCAACTAAGGGCTGTTG

CDS

ATGCTCAGAGAATTAAGAACAAACAGGGCATCCTGGAAGATATTTACTGGGAAGAAATTGAGAAAGCAGTATCTATTGAGCTTGATTTCAACTCAGCGTTCAAGTCTTGATAATACAAAAGAAGGTCAGGCTATACTGAAAAAAGTCCACAGCTTTTATAAAATGATGCTTCAAGAACTCGAAGCCGTATTTGACGGCACAGCTCTTCAATTGGAAGTTCCCTTAAACCTTGCCGCAGGTACGAGGGTGCGAATTGTTGTTGAAAGTGTTCTACCAAATGAAGTAAAAGCACCTAAAACGTTTCTTCAAACTGCTCAGTCTTTAAAATTACAGGGTGAACCTGATTGGTCAGAGAAAATTGATCAATATTTGTATGGGGAAACTCTTTCTGACAATGACTGA

Protein

MLRELRTNRASWKIFTGKKLRKQYLLSLISTQRSSLDNTKEGQAILKKVHSFYKMMLQELEAVFDGTALQLEVPLNLAAGTRVRIVVESVLPNEVKAPKTFLQTAQSLKLQGEPDWSEKIDQYLYGETLSDND