Your browser is old and dusty. Try Google Chrome!

Details for sll1695

ORF sll1695
Accession NP_441070.1
Symbol pilA2
Category Chemotaxis
Definition pilin polypeptide PilA2
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442657.1_1 Forward -22 -5 9.41035 0.289
NP_442151.1_1 Forward -260 -241 3.6377 0.287
NP_442151.1_6 Reverse -267 -281 8.75105 0.164
NP_441818.1_9 Reverse -198 -217 -8.85033 0.283
NP_441818.1_9 Forward -137 -118 -9.14533 0.287
NP_442623.1_3 Forward -377 -358 -19.1751 0.281
NP_441675.1_4 Reverse -29 -48 2.26107 0.294
NP_440061.1_9 Forward -250 -236 6.29216 0.251
NP_441145.1_1 Reverse -238 -257 4.62101 0.254
NP_440878.1_9 Reverse -229 -248 -2.26216 0.258
NP_442062.1_10 Reverse -351 -370 12.7825 0.236
NP_440304.1_4 Forward -250 -240 2.7333 0.299
NP_440304.1_4 Forward -211 -201 2.7333 0.299
NP_440304.1_4 Forward -278 -268 2.24165 0.299
NP_442762.1_10 Reverse -227 -246 -11.7019 0.275
NP_441082.1_10 Reverse -137 -150 21.5538 0.0126
NP_441925.1_4 Forward -161 -142 -7.86776 0.202
NP_441713.1_1 Forward -235 -216 -10.4236 0.2
NP_441014.1_10 Forward -333 -314 -3.24622 0.297
NP_441634.1_8 Forward -353 -339 0.982901 0.212
NP_441634.1_9 Reverse -132 -151 8.65176 0.294
NP_440376.1_1 Reverse -246 -255 3.63797 0.2
NP_442485.1_3 Forward -212 -193 -5.31042 0.289
NP_442958.1_3 Forward -259 -240 1.47442 0.267
NP_442530.1_2 Reverse -60 -70 11.1898 0.284
NP_440656.1_2 Reverse -56 -75 3.93269 0.221
NP_442486.1_6 Reverse -110 -129 4.62101 0.263
NP_442816.1_7 Forward -34 -15 6.63627 0.24
NP_442816.1_7 Forward -33 -14 5.1084 0.256
NP_439905.1_5 Reverse -315 -329 13.6676 0.288
NP_439990.1_5 Reverse -358 -371 7.00078 0.218
NP_439990.1_5 Reverse -262 -275 5.42749 0.295
NP_441941.1_9 Forward -259 -240 12.3892 0.126
NP_442598.1_2 Forward -34 -25 16.5193 0.252
NP_441646.1_1 Reverse -238 -257 0.58944 0.247
NP_442431.1_10 Forward -122 -104 -0.0791831 0.284
NP_442431.1_10 Reverse -189 -207 -0.374176 0.287
NP_441041.1_4 Forward -277 -258 -10.7186 0.236
NP_441041.1_7 Reverse -197 -209 5.6684 0.245
NP_441644.1_8 Reverse -330 -349 15.2408 0.289
NP_443049.1_6 Reverse -141 -151 11.153 0.278
NP_442933.1_1 Forward -35 -16 8.6416 0.253
NP_442926.1_5 Reverse -234 -253 12.6001 0.19
NP_442142.1_4 Forward -210 -197 4.54195 0.217
NP_441715.1_5 Reverse -132 -142 18.3674 0.219
NP_442757.1_7 Forward -129 -110 11.7008 0.254
NP_441956.1_10 Forward -152 -138 17.7968 0.291
NP_442490.1_10 Forward -152 -134 9.95058 0.234
NP_442227.1_2 Reverse -160 -179 10.8159 0.166
NP_442808.1_1 Forward -152 -142 13.0576 0.0481
NP_441290.1_1 Reverse -338 -357 7.66927 0.26
NP_442739.1_3 Reverse -18 -32 17.6002 0.157
NP_440558.1_2 Forward -381 -362 -7.4737 0.294
NP_441557.1_8 Forward -150 -140 15.0242 0.183
NP_442183.1_9 Reverse -145 -155 9.81313 0.296
NP_440440.1_1 Forward -249 -230 6.39016 0.295
NP_442645.1_2 Forward -82 -63 -20.1584 0.288
NP_441633.1_1 Forward -216 -199 11.7402 0.248
NP_440299.1_1 Forward -376 -363 2.08368 0.299
NP_441799.1_9 Forward -245 -226 0.294447 0.213
NP_442333.2_5 Reverse -115 -134 -10.6203 0.246
NP_441270.1_5 Forward -129 -110 14.5557 0.211
NP_441866.1_3 Forward -172 -159 10.7374 0.287
NP_441866.1_4 Forward -31 -18 15.4819 0.273
NP_441464.1_2 Reverse -166 -176 15.713 0.247
NP_442386.1_9 Forward -152 -143 7.57079 0.219
NP_442186.1_9 Reverse -237 -256 9.73422 0.228
NP_440408.1_7 Forward -207 -188 8.16093 0.282
NP_442239.1_8 Forward -135 -116 4.42435 0.297
NP_442384.1_10 Reverse -192 -205 2.87088 0.21
NP_442114.1_8 Reverse -313 -327 8.25877 0.234
NP_441814.1_1 Forward -348 -329 4.62101 0.177
NP_440531.1_6 Reverse -134 -153 5.40766 0.115
NP_442641.1_1 Forward -155 -136 -7.27704 0.192
NP_441640.1_8 Forward -276 -257 -3.44213 0.257
NP_440350.1_5 Forward -34 -15 -6.39206 0.296
NP_441896.1_3 Reverse -236 -255 -2.26216 0.28
NP_442871.1_4 Reverse -247 -266 -5.70449 0.277
NP_441543.1_3 Forward -154 -140 6.0955 0.286
NP_441319.1_5 Forward -377 -358 10.3242 0.253
NP_442315.1_1 Forward -130 -112 12.2122 0.14
NP_443062.1_1 Forward -240 -222 4.54812 0.258
NP_440454.1_2 Reverse -20 -34 12.8075 0.227
NP_440673.1_3 Reverse -269 -276 6.92228 0.277
NP_442414.1_2 Forward -128 -109 8.16093 0.29
NP_442414.1_8 Reverse -328 -347 6.4893 0.293
NP_441004.1_1 Forward -140 -121 -16.2252 0.283
NP_441004.1_1 Forward -185 -166 -18.1918 0.298
NP_442450.1_5 Reverse -168 -178 7.35486 0.137
NP_442443.1_1 Reverse -134 -153 -5.60541 0.282
NP_440497.1_6 Reverse -193 -212 -6.98204 0.269
NP_440757.1_4 Reverse -237 -256 3.04771 0.264
NP_440545.1_3 Reverse -242 -259 1.61214 0.116
NP_440545.1_3 Forward -258 -241 -4.48438 0.227
NP_440025.1_1 Reverse -275 -294 5.89931 0.279
NP_440555.1_2 Forward -279 -260 16.1249 0.213
NP_440743.1_5 Reverse -106 -125 10.6184 0.208
NP_441329.1_6 Reverse -26 -45 -1.76702 0.293
NP_441112.1_6 Reverse -20 -39 -3.14714 0.296
NP_440671.1_6 Forward -154 -135 12.88 0.226
NP_442073.1_6 Reverse -191 -210 -3.3438 0.291
NP_442778.1_10 Forward -99 -81 7.78729 0.265
NP_441874.1_1 Reverse -139 -153 11.6026 0.24
NP_440354.1_7 Reverse -135 -153 5.91901 0.296
NP_440546.1_7 Reverse -133 -143 14.238 0.279
NP_441230.1_5 Reverse -234 -253 2.55606 0.212
NP_440675.1_1 Reverse -236 -255 8.35759 0.195
NP_441497.1_3 Reverse -208 -227 -10.6203 0.294
NP_441474.1_1 Forward -152 -133 0.490334 0.255
NP_441848.1_10 Forward -397 -384 18.0129 0.122
NP_440653.1_5 Forward -176 -157 7.7676 0.271
NP_441203.1_2 Reverse -231 -250 -3.04881 0.188
NP_440308.1_6 Forward -153 -134 1.37609 0.296
NP_442533.1_1 Forward -128 -109 -7.4737 0.191
NP_442322.1_4 Forward -154 -137 -9.7949 0.297
NP_441527.1_4 Reverse -26 -45 -9.02441 0.254
NP_441972.1_5 Forward -152 -133 -6.49039 0.231
NP_440480.1_7 Forward -169 -150 17.5998 0.129
NP_442588.1_10 Forward -190 -171 18.9773 0.169
NP_440886.1_6 Reverse -137 -156 23.1072 0.0209
NP_440886.1_7 Forward -152 -142 4.60114 0.227
NP_440907.2_8 Forward -287 -277 4.89613 0.235
NP_439967.1_4 Forward -214 -200 16.8142 0.289
NP_442912.1_9 Forward -145 -126 16.6174 0.199
NP_441962.1_4 Reverse -301 -320 -13.2752 0.271
NP_441193.1_1 Forward -164 -145 9.53674 0.277
NP_441993.1_1 Reverse -194 -213 5.06532 0.208
NP_440293.1_3 Forward -272 -253 -2.16383 0.239
NP_442930.1_1 Reverse -13 -23 13.1559 0.239
NP_442867.1_8 Reverse -135 -154 5.11266 0.277
NP_441332.1_6 Forward -152 -142 15.3256 0.121
NP_441436.1_9 Reverse -167 -177 16.0075 0.28
YP_003858595.1_4 Reverse -105 -124 3.63691 0.297
NP_441885.1_5 Forward -255 -245 -1.49493 0.264
NP_440423.1_3 Forward -84 -65 14.4541 0.201
NP_441902.1_3 Reverse -147 -157 12.0099 0.281
NP_442451.1_2 Forward -256 -237 -10.4236 0.269
NP_439962.1_4 Reverse -133 -152 4.81767 0.178
NP_440172.1_1 Forward -332 -322 1.84832 0.294
NP_441226.1_7 Forward -150 -143 5.34865 0.289
NP_440244.1_1 Reverse -36 -55 -8.752 0.287
NP_441766.1_9 Reverse -134 -153 -1.37718 0.268
NP_443052.1_9 Reverse -109 -128 -0.590531 0.213
NP_443052.1_9 Forward -152 -133 -5.31042 0.266
NP_440072.1_5 Reverse -136 -154 -0.177514 0.238
NP_440885.1_6 Reverse -11 -30 13.8614 0.183
NP_442154.1_1 Forward -136 -118 -17.2871 0.251
NP_442154.1_1 Reverse -232 -250 -17.5821 0.26
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGGTTATTTTACTGAGAAGGGTACGTTTGCAACCGATACGGAAACGCTTGAAGTCCCAGCTCCTGATGGTAATTTCTTTAGTTTTGCAGTTAACACTGCTGACAACACAGAAGCTATCCAAGACGCAACGGCATTGAATTGGGAGGCTGACGGCACCCGCTCCATGTCAGGTGGAACGTTTTACGATTCAGGCACCCGCGCCTTCAGTACTGTTGTTTGTCGGGCTGAAGCAGGTAGTGAAGATACTCCCCCAACCCCAGGAGGGGCTAATGATTGTGGTGGTGCTGAAGTAATTAAATAGGACCCTATTATGTTTTGAGTGGTGCGGGAATGATGAGCTGGTCTTATCTTACCTACTGCACCCTCTTTTTTTTGGGTTAATATTTTCACACTATTGTT

CDS

ATGAAAGCCCAATTTTCTATCGGTAGTTCATCTAACTGTCGGCATTTCAATGGTACCCGACAAAGAGGATTTACTTTGCTGGAACTGCTTGTTGTGGTTATTATTTTGGGAGTGTTGGGAGCAATGACGTTGCCGAATCTTTTCTCCCAGATAGGTAAAGCGAGGGAAGCTGAGGCCAAGCAGATACTGAGTGCGATTGGTCAAGCCCAGCAGTCCTATTTTTTTGAAAAAGCCTCTTTCGCTGAGAGCAACCAAGCTTTAGAAATTAGTTTTCAGAGCAATTATTATGATATTTCAGAGCCTCAATTAATTGGAACTGATGTAGCCAAAAGTAGTGCTACAGCAACTAATGGTGTTCAGCAAAATGCCCGTAATTTTGCAATGGGAGTGTACTATGAGAACCAAACTTATAGAGTAGTATTGTGTCAAAGTCCTGTTCCAGCCGAGACAAACAGCACAGAGGCACCAAATAACTCATCTGGGGACTGTGTAAACGGTATTAAGCTTTTTTGA

Protein

MKAQFSIGSSSNCRHFNGTRQRGFTLLELLVVVIILGVLGAMTLPNLFSQIGKAREAEAKQILSAIGQAQQSYFFEKASFAESNQALEISFQSNYYDISEPQLIGTDVAKSSATATNGVQQNARNFAMGVYYENQTYRVVLCQSPVPAETNSTEAPNNSSGDCVNGIKLF