Your browser is old and dusty. Try Google Chrome!

Details for sll1682

ORF sll1682
Accession NP_440110.1
Symbol
Category Amino acids and amines
Definition alanine dehydrogenase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -234 -248 0.196253 0.215
NP_441061.1_2 Reverse -369 -383 -1.67204 0.269
NP_440557.1_1 Reverse -234 -253 -0.590531 0.27
NP_441418.1_6 Reverse -233 -252 -22.2233 0.172
NP_441418.1_6 Reverse -239 -258 -28.8115 0.211
NP_442291.1_5 Forward -378 -362 -3.38305 0.239
NP_442291.1_7 Forward -276 -262 10.0294 0.255
NP_441453.1_4 Forward -242 -234 6.80426 0.121
NP_441453.1_4 Reverse -233 -241 6.11594 0.121
NP_441453.1_4 Forward -377 -369 3.756 0.288
NP_441623.1_1 Reverse -198 -216 3.85406 0.188
NP_442151.1_1 Forward -218 -199 4.12936 0.287
NP_442151.1_6 Forward -242 -228 14.7492 0.032
NP_441818.1_6 Forward -249 -235 12.1926 0.253
NP_440226.1_1 Reverse -233 -252 6.19431 0.135
NP_440813.1_1 Reverse -227 -241 15.9285 0.273
NP_442744.1_8 Reverse -62 -81 -0.000545616 0.235
NP_442287.1_1 Reverse -203 -213 15.9091 0.21
NP_442655.1_10 Reverse -257 -276 -19.4701 0.282
NP_442173.1_1 Reverse -234 -242 12.0158 0.0316
NP_442173.1_1 Forward -9 -1 7.59091 0.163
NP_442173.1_1 Forward -241 -233 4.83764 0.241
NP_442752.1_4 Forward -242 -235 13.8055 0.0199
NP_443027.1_4 Forward -379 -369 10.2065 0.138
NP_442975.1_10 Reverse -229 -243 2.75226 0.269
NP_442975.1_10 Forward -246 -232 1.67063 0.293
NP_440784.1_7 Forward -241 -234 6.23397 0.241
NP_440784.1_7 Reverse -234 -241 6.13563 0.241
NP_442909.1_7 Reverse -234 -248 11.897 0.131
NP_440110.1_6 Forward -71 -52 16.0274 0.139
NP_440110.1_7 Forward -231 -212 18.0924 0.212
NP_441476.1_5 Reverse -228 -247 -0.000545616 0.195
NP_441476.1_5 Reverse -270 -289 -1.37718 0.205
NP_439979.1_2 Reverse -233 -252 6.88262 0.288
NP_442062.1_8 Forward -377 -367 4.20827 0.228
NP_441859.1_3 Reverse -232 -251 5.89851 0.188
NP_442762.1_10 Reverse -258 -277 -0.885524 0.122
NP_442048.1_7 Forward -58 -39 16.5191 0.185
NP_441208.1_1 Forward -37 -18 -4.42544 0.263
NP_441208.1_9 Reverse -149 -163 6.88276 0.229
NP_441208.1_9 Reverse -365 -379 6.58777 0.241
NP_441208.1_9 Reverse -230 -244 5.89945 0.259
NP_441208.1_9 Reverse -267 -281 5.40779 0.267
NP_441594.1_6 Forward -312 -293 3.04771 0.238
NP_440370.1_10 Reverse -224 -243 8.06259 0.243
NP_440370.1_10 Forward -251 -232 7.66927 0.251
NP_442110.1_7 Forward -242 -228 14.7492 0.0511
NP_442110.1_7 Forward -248 -234 0.687908 0.252
NP_442259.1_6 Forward -318 -299 12.8808 0.283
NP_442726.1_1 Forward -382 -363 8.94757 0.268
NP_441083.1_5 Reverse -233 -243 8.82982 0.03
NP_441083.1_5 Forward -264 -254 1.84832 0.198
NP_441083.1_5 Forward -377 -367 1.16001 0.215
NP_441083.1_5 Forward -242 -232 -1.00328 0.289
NP_442827.1_8 Forward -250 -231 16.4199 0.032
NP_441434.1_7 Reverse -235 -249 7.66941 0.225
NP_441141.1_4 Reverse -259 -278 14.7491 0.292
NP_441738.1_2 Reverse -235 -242 15.28 0.0102
NP_441738.1_2 Reverse -200 -207 10.2652 0.101
NP_441558.1_5 Reverse -231 -250 20.7473 0.00412
NP_440209.1_1 Forward -242 -234 8.57422 0.0425
NP_440209.1_1 Reverse -233 -241 5.52596 0.0821
NP_442570.1_3 Forward -215 -196 -2.16383 0.212
NP_441716.1_1 Forward -377 -363 3.14618 0.278
NP_442111.1_4 Reverse -232 -246 16.5192 0.0145
NP_440906.1_5 Forward -241 -234 6.23397 0.234
NP_440906.1_5 Reverse -234 -241 6.13563 0.241
NP_440747.1_10 Reverse -365 -377 7.11881 0.00789
NP_441130.1_10 Reverse -231 -245 9.14437 0.128
NP_442634.1_4 Forward -73 -59 -5.90027 0.284
NP_442760.1_8 Reverse -174 -193 17.5024 0.109
NP_440403.1_4 Reverse -215 -234 -8.26035 0.251
NP_442848.1_1 Forward -248 -234 6.09611 0.0803
NP_442848.1_5 Forward -273 -255 -3.52077 0.293
NP_442848.1_9 Reverse -63 -82 0.982764 0.265
NP_441012.1_4 Reverse -235 -248 10.8357 0.26
NP_441012.1_4 Forward -88 -75 5.91914 0.286
NP_439978.1_1 Forward -113 -97 8.515 0.297
NP_443018.1_3 Reverse -234 -241 11.7405 0.0655
NP_443018.1_3 Reverse -63 -70 10.2655 0.107
NP_443018.1_3 Forward -241 -234 5.44732 0.193
NP_443018.1_3 Reverse -369 -376 4.07068 0.299
NP_441634.1_8 Reverse -366 -380 16.1259 0.0248
NP_441634.1_8 Reverse -261 -275 3.53951 0.148
NP_440376.1_1 Reverse -368 -377 6.68623 0.0902
NP_440376.1_1 Forward -242 -233 5.99792 0.111
NP_440376.1_1 Forward -309 -300 4.22796 0.166
NP_440376.1_1 Reverse -152 -161 1.86802 0.238
NP_440376.1_1 Forward -377 -368 -0.196935 0.285
NP_440376.1_1 Reverse -233 -242 -0.196935 0.285
NP_442687.1_1 Reverse -133 -146 11.1301 0.279
NP_442687.1_7 Forward -243 -233 4.50326 0.245
NP_442687.1_7 Forward -378 -368 4.40493 0.249
NP_442191.1_4 Reverse -258 -272 11.9627 0.233
NP_440066.1_5 Forward -273 -254 14.6499 0.194
NP_442485.1_3 Forward -259 -240 6.39097 0.163
NP_442485.1_3 Reverse -252 -271 2.65439 0.209
NP_442485.1_3 Forward -268 -249 -4.32711 0.28
NP_441846.1_10 Reverse -257 -276 -23.01 0.275
NP_441422.1_7 Reverse -231 -248 4.56207 0.107
NP_441422.1_7 Reverse -55 -72 -2.51776 0.215
NP_441422.1_7 Reverse -196 -213 -3.99273 0.238
NP_441422.1_7 Reverse -366 -383 -6.64766 0.252
NP_441029.1_3 Reverse -228 -247 4.52268 0.277
NP_440533.1_9 Forward -192 -173 4.62101 0.22
NP_441950.1_7 Forward -83 -64 -7.57203 0.279
NP_441763.1_10 Reverse -222 -241 8.06178 0.224
NP_440360.1_10 Reverse -370 -384 6.3911 0.227
NP_442658.1_1 Forward -244 -234 9.02601 0.169
NP_442658.1_1 Reverse -347 -357 6.17443 0.235
NP_442782.1_2 Forward -309 -295 1.67122 0.281
NP_442205.1_9 Forward -383 -367 -2.5964 0.272
NP_441414.1_9 Reverse -207 -226 -9.63698 0.264
NP_440607.1_8 Reverse -246 -265 -0.0988766 0.28
NP_442937.1_5 Forward -314 -295 8.16093 0.231
NP_442937.1_5 Reverse -258 -277 7.37428 0.254
NP_442937.1_5 Forward -247 -228 6.29264 0.282
NP_441958.1_5 Reverse -232 -242 1.55333 0.095
NP_441958.1_5 Forward -243 -233 0.865012 0.12
NP_439905.1_1 Reverse -369 -382 15.6539 0.0837
NP_439905.1_1 Reverse -234 -247 9.85238 0.216
NP_439905.1_1 Reverse -205 -218 6.50913 0.285
NP_442876.1_6 Reverse -129 -147 9.64667 0.298
NP_440984.1_7 Forward -382 -368 7.17775 0.182
NP_442376.1_2 Forward -247 -228 -7.37537 0.286
NP_442911.1_2 Forward -387 -368 -7.4737 0.211
NP_442911.1_2 Forward -252 -233 -7.67036 0.216
NP_442911.1_2 Reverse -358 -377 -7.96535 0.223
NP_441580.1_6 Forward -253 -234 -6.58872 0.235
NP_440153.1_5 Forward -241 -227 3.24451 0.217
NP_440153.1_5 Reverse -234 -248 2.94952 0.219
NP_443055.1_6 Reverse -255 -273 3.36165 0.196
NP_440993.1_2 Reverse -228 -244 16.3815 0.0617
NP_440993.1_3 Reverse -181 -200 -0.886293 0.273
NP_440934.1_1 Forward -354 -335 4.22769 0.271
NP_440827.1_3 Forward -247 -228 11.3075 0.268
NP_442210.1_7 Reverse -237 -256 16.5191 0.178
NP_440138.1_6 Reverse -58 -77 4.03023 0.24
NP_441129.1_3 Forward -94 -75 -10.1286 0.281
NP_441099.1_5 Reverse -223 -242 -7.17871 0.171
NP_442002.1_1 Forward -215 -197 -9.12563 0.272
NP_442002.1_9 Forward -243 -236 10.7572 0.185
NP_441938.1_1 Forward -259 -240 1.27776 0.272
NP_440411.1_4 Reverse -72 -91 7.7676 0.231
NP_441646.1_1 Forward -249 -230 1.27776 0.232
NP_442438.1_10 Forward -247 -233 2.35953 0.178
NP_442438.1_10 Reverse -243 -257 0.196253 0.236
NP_441292.1_2 Forward -253 -234 -5.99873 0.241
NP_442885.1_1 Reverse -231 -250 8.55425 0.282
NP_440377.1_1 Forward -149 -132 15.5256 0.181
NP_441000.1_6 Reverse -232 -246 -4.7203 0.251
NP_440147.1_4 Forward -379 -366 5.72248 0.115
NP_440147.1_4 Forward -244 -231 1.10092 0.239
NP_441175.1_7 Reverse -207 -226 5.01433 0.294
NP_441550.1_8 Reverse -231 -241 12.8609 0.0296
NP_441550.1_8 Forward -244 -234 9.22267 0.103
NP_441916.1_7 Reverse -368 -378 5.97822 0.111
NP_441916.1_7 Forward -309 -299 4.89658 0.154
NP_440465.1_10 Reverse -230 -249 6.19431 0.199
NP_441041.1_4 Forward -242 -223 -13.1769 0.282
NP_441041.1_7 Reverse -230 -242 5.95994 0.231
NP_441041.1_7 Forward -245 -233 5.6684 0.245
NP_442004.1_6 Forward -309 -295 4.32615 0.218
NP_442004.1_6 Reverse -233 -247 2.45787 0.264
NP_441725.1_5 Reverse -234 -244 -0.806614 0.271
NP_439966.1_7 Reverse -231 -241 13.5492 0.0263
NP_439966.1_7 Forward -244 -234 7.74772 0.15
NP_439966.1_7 Forward -379 -369 4.20782 0.285
NP_439966.1_9 Forward -244 -235 10.7178 0.0863
NP_442941.1_3 Forward -376 -366 -0.118297 0.249
NP_440289.1_2 Reverse -230 -243 -5.19226 0.3
NP_440983.1_5 Reverse -300 -319 5.60432 0.178
NP_440983.1_5 Reverse -374 -393 -3.24547 0.237
NP_440983.1_5 Forward -257 -238 -8.65367 0.295
NP_440260.1_8 Forward -216 -198 3.16574 0.174
NP_442281.1_1 Reverse -363 -377 5.01387 0.172
NP_442281.1_1 Reverse -228 -242 4.8172 0.18
NP_442281.1_1 Forward -382 -368 3.14559 0.243
NP_441334.1_7 Reverse -231 -250 -10.4236 0.12
NP_440437.1_1 Reverse -227 -246 -0.4922 0.181
NP_441457.1_7 Forward -244 -225 8.45592 0.146
NP_441556.1_4 Forward -257 -238 14.4398 0.165
NP_441556.1_4 Reverse -377 -396 10.8728 0.264
NP_441556.1_7 Reverse -284 -303 -1.08295 0.3
NP_441556.1_10 Forward -382 -368 12.0712 0.2
NP_440375.1_8 Reverse -199 -218 -0.000545616 0.266
NP_442068.1_7 Forward -290 -271 13.9625 0.0594
NP_441644.1_6 Reverse -233 -243 7.15773 0.133
NP_441644.1_6 Forward -377 -367 5.97777 0.172
NP_441644.1_6 Forward -242 -232 5.68278 0.18
NP_441644.1_6 Forward -71 -61 4.20782 0.245
NP_441644.1_6 Reverse -300 -310 4.10949 0.249
NP_441644.1_6 Forward -309 -299 3.51951 0.277
NP_443049.1_6 Forward -243 -233 11.6409 0.24
NP_441810.1_2 Forward -205 -186 11.8975 0.121
NP_441810.1_9 Reverse -226 -245 0.58944 0.292
NP_442029.1_10 Forward -231 -212 17.699 0.119
NP_440929.1_8 Reverse -233 -242 7.07956 0.0713
NP_440929.1_8 Reverse -349 -358 1.67135 0.283
NP_442933.1_10 Reverse -368 -377 4.62128 0.227
NP_442926.1_4 Reverse -262 -280 17.8171 0.245
NP_442554.1_8 Reverse -369 -379 12.2714 0.0274
NP_442554.1_8 Forward -241 -231 7.25653 0.0955
NP_442554.1_8 Reverse -234 -244 6.17489 0.125
NP_442554.1_8 Forward -376 -366 5.28991 0.153
NP_442554.1_8 Reverse -63 -73 4.79825 0.173
NP_442554.1_8 Forward -70 -60 3.81494 0.209
NP_442075.1_10 Forward -242 -223 13.0775 0.282
NP_441762.1_7 Forward -243 -231 4.07055 0.0572
NP_441762.1_7 Reverse -232 -244 -4.77924 0.182
NP_441762.1_7 Reverse -182 -194 -6.2542 0.284
NP_441762.1_7 Reverse -367 -379 -7.04085 0.285
NP_442142.1_4 Reverse -230 -243 8.2785 0.118
NP_442142.1_4 Reverse -365 -378 5.0336 0.204
NP_442292.1_1 Forward -376 -367 5.70292 0.135
NP_442292.1_1 Reverse -234 -243 -0.196935 0.239
NP_440039.1_9 Forward -314 -295 10.9142 0.284
NP_442476.1_6 Reverse -234 -248 2.85119 0.171
NP_440895.1_10 Reverse -232 -249 -5.76269 0.294
NP_441264.1_10 Reverse -251 -265 18.3875 0.109
NP_442301.1_2 Forward -267 -248 5.60352 0.263
NP_441715.1_4 Forward -376 -366 4.99491 0.24
NP_440183.1_9 Forward -220 -201 -13.2752 0.26
NP_440379.1_5 Reverse -239 -258 3.44104 0.149
NP_440379.1_5 Reverse -53 -72 -9.53865 0.264
NP_441468.1_1 Reverse -369 -376 10.9539 0.0726
NP_441468.1_1 Forward -241 -234 6.13563 0.209
NP_441468.1_1 Reverse -234 -241 6.0373 0.223
NP_441020.2_6 Forward -216 -199 5.9387 0.284
NP_441015.1_8 Reverse -380 -399 2.75272 0.272
NP_441015.1_10 Reverse -258 -277 0.884433 0.164
NP_441015.1_10 Forward -247 -228 -0.197208 0.169
NP_441673.1_1 Reverse -368 -377 1.37636 0.114
NP_441673.1_1 Forward -242 -233 1.37636 0.114
NP_441673.1_1 Forward -377 -368 1.1797 0.163
NP_441673.1_1 Reverse -233 -242 1.1797 0.163
NP_441731.1_7 Reverse -249 -268 10.4225 0.147
NP_441320.1_4 Reverse -238 -257 17.2074 0.289
NP_441426.1_3 Reverse -197 -216 8.65176 0.259
NP_441826.1_2 Reverse -227 -241 5.21113 0.0978
NP_441826.1_2 Forward -248 -234 0.589577 0.18
NP_442811.1_2 Forward -391 -372 4.81767 0.226
NP_442868.1_6 Reverse -366 -376 -0.216628 0.273
NP_442719.1_2 Forward -347 -329 -2.24319 0.185
NP_442808.1_1 Reverse -232 -242 9.71433 0.0481
NP_442808.1_1 Forward -378 -368 6.27276 0.121
NP_441849.1_2 Forward -149 -130 -0.0481691 0.277
NP_442542.1_2 Reverse -267 -280 8.86907 0.145
NP_442050.1_5 Reverse -231 -241 14.0409 0.0259
NP_440558.1_2 Forward -216 -197 -2.16383 0.223
NP_440111.2_2 Forward -253 -234 12.7825 0.0924
NP_442789.1_4 Forward -259 -240 0.884433 0.187
NP_441878.1_6 Reverse -367 -377 1.65166 0.0795
NP_441878.1_6 Forward -378 -368 -0.41329 0.177
NP_441878.1_6 Forward -310 -300 -7.98478 0.285
NP_441036.1_8 Forward -243 -233 6.8632 0.213
NP_441557.1_5 Forward -242 -233 1.08137 0.0794
NP_441557.1_5 Reverse -233 -242 0.589713 0.134
NP_441557.1_5 Reverse -368 -377 0.491382 0.144
NP_441557.1_5 Forward -377 -368 0.29472 0.174
NP_441557.1_8 Forward -376 -366 11.5826 0.244
NP_441445.1_1 Forward -216 -197 0.294447 0.278
NP_442066.2_4 Forward -242 -223 0.884433 0.157
NP_442066.2_9 Reverse -229 -242 6.31247 0.297
NP_441433.1_8 Forward -70 -51 -4.6221 0.294
NP_440101.1_3 Forward -247 -228 1.86774 0.267
NP_440101.1_10 Reverse -86 -105 6.19431 0.197
NP_442183.1_1 Forward -242 -228 6.3911 0.176
NP_442183.1_1 Reverse -368 -382 5.70279 0.206
NP_442183.1_3 Forward -264 -245 18.5831 0.161
NP_442135.1_3 Reverse -258 -277 5.70265 0.26
NP_441574.1_1 Reverse -368 -387 -2.75381 0.23
NP_442170.1_5 Forward -242 -223 5.11266 0.154
NP_442347.1_2 Reverse -234 -243 8.94785 0.0718
NP_442347.1_2 Forward -181 -172 8.35786 0.0927
NP_442347.1_2 Reverse -72 -81 4.32629 0.284
NP_442645.1_2 Forward -215 -196 -9.83364 0.144
NP_440547.1_1 Forward -400 -381 10.815 0.216
NP_442888.1_9 Reverse -233 -252 14.8474 0.206
NP_441037.1_4 Forward -244 -234 7.22024 0.237
NP_442594.1_8 Forward -215 -196 1.96607 0.295
NP_440151.1_2 Forward -272 -254 16.4396 0.222
NP_440151.1_5 Forward -247 -228 6.68596 0.239
NP_441633.1_3 Reverse -366 -379 1.39592 0.109
NP_442764.1_8 Forward -177 -158 1.27776 0.298
NP_440136.1_2 Forward -241 -234 6.23397 0.171
NP_440136.1_2 Reverse -234 -241 6.13563 0.193
NP_442590.1_9 Reverse -197 -216 10.8159 0.23
NP_442998.1_10 Reverse -235 -242 15.5754 0.0102
NP_440899.1_2 Reverse -207 -226 6.1935 0.269
NP_440299.1_1 Forward -381 -368 3.46031 0.243
NP_441799.1_1 Forward -381 -367 5.50552 0.206
NP_441799.1_1 Reverse -194 -208 3.93223 0.274
NP_441799.1_1 Reverse -364 -378 3.63724 0.289
NP_441007.1_10 Reverse -228 -241 1.00259 0.209
NP_442201.1_10 Reverse -194 -213 -14.0619 0.28
NP_442333.2_5 Reverse -222 -241 -15.2418 0.29
NP_440256.1_1 Forward -210 -191 -6.1954 0.205
NP_440256.1_1 Reverse -230 -249 -8.06369 0.251
NP_442961.1_7 Reverse -234 -253 10.1275 0.263
NP_440087.1_1 Reverse -368 -387 -9.73531 0.299
NP_441090.1_5 Reverse -237 -255 19.3903 0.131
NP_442007.1_8 Reverse -367 -385 14.5713 0.242
NP_441559.1_8 Reverse -193 -207 -5.60527 0.267
NP_440915.1_6 Forward -246 -232 14.9459 0.0183
NP_441179.1_5 Reverse -367 -386 20.2556 0.0286
NP_440717.1_1 Reverse -205 -224 5.60432 0.272
NP_440717.1_3 Forward -276 -262 11.7987 0.23
NP_442069.1_7 Reverse -202 -221 15.6332 0.201
NP_442452.1_3 Reverse -375 -394 5.70265 0.229
NP_442866.1_1 Forward -247 -228 1.96607 0.158
NP_442866.1_1 Forward -400 -381 -6.39206 0.255
NP_441464.1_1 Forward -256 -237 9.93088 0.24
NP_440026.1_6 Forward -386 -367 12.1917 0.284
NP_440306.1_8 Reverse -40 -59 1.76863 0.204
NP_441939.1_3 Reverse -234 -253 14.1591 0.0792
NP_441494.1_6 Forward -382 -369 5.72248 0.294
NP_442993.1_1 Forward -192 -176 -6.43131 0.146
NP_442993.1_1 Reverse -368 -384 -12.6262 0.276
NP_442386.1_9 Reverse -56 -65 8.06244 0.209
NP_442386.1_9 Reverse -203 -212 7.47246 0.219
NP_442386.1_9 Forward -243 -234 5.9975 0.23
NP_442386.1_9 Forward -378 -369 4.62087 0.294
NP_442386.1_9 Reverse -232 -241 4.52254 0.297
NP_440570.1_5 Reverse -376 -395 -2.0655 0.277
NP_442054.1_4 Forward -306 -287 7.66927 0.299
NP_441750.1_1 Forward -212 -193 -9.93197 0.3
NP_441340.1_5 Forward -241 -234 13.5105 0.0314
NP_441340.1_5 Reverse -234 -241 5.84064 0.208
NP_440586.1_1 Forward -313 -294 -4.22878 0.278
NP_440586.1_8 Reverse -234 -241 9.47853 0.146
NP_440586.1_8 Reverse -63 -70 9.08521 0.178
NP_440586.1_8 Forward -241 -234 5.74197 0.283
NP_440586.1_8 Forward -256 -249 5.64364 0.297
NP_442251.1_6 Reverse -184 -191 10.4622 0.12
NP_440684.1_9 Reverse -368 -382 6.98109 0.283
NP_441262.1_3 Forward -242 -235 14.7888 0.0223
NP_440027.1_3 Reverse -204 -222 3.8533 0.263
NP_440027.1_3 Reverse -197 -215 3.55831 0.27
NP_443051.1_1 Forward -243 -234 7.47288 0.0571
NP_443051.1_1 Reverse -232 -241 0.29472 0.195
NP_439937.1_9 Forward -307 -290 -10.1882 0.224
NP_439937.1_9 Reverse -232 -249 -10.5815 0.231
NP_439937.1_9 Forward -267 -250 -13.5315 0.287
NP_440408.1_7 Reverse -368 -387 9.3409 0.262
NP_440439.1_1 Forward -245 -232 8.37742 0.0537
NP_440439.1_1 Reverse -230 -243 -1.75067 0.281
NP_440439.1_1 Forward -69 -56 -2.144 0.298
NP_440372.1_2 Forward -241 -234 13.8055 0.0214
NP_440372.1_2 Reverse -234 -241 6.52896 0.188
NP_441789.1_7 Reverse -196 -215 -3.14789 0.268
NP_442285.1_7 Forward -320 -301 8.35759 0.275
NP_440316.1_10 Forward -243 -233 11.1898 0.214
NP_441803.1_2 Reverse -228 -247 0.392778 0.253
NP_441572.1_7 Reverse -227 -246 -3.14714 0.207
NP_442384.1_10 Reverse -57 -70 0.904263 0.275
NP_442114.1_4 Reverse -233 -244 11.3667 0.129
NP_441877.1_7 Reverse -363 -382 2.85027 0.218
NP_442572.1_10 Forward -333 -314 17.9217 0.248
NP_442790.1_4 Forward -318 -299 -11.7019 0.233
NP_442790.1_4 Forward -251 -232 -12.9802 0.256
NP_442262.1_10 Reverse -234 -241 13.2155 0.0213
NP_442262.1_10 Reverse -369 -376 9.47889 0.187
NP_442262.1_10 Reverse -63 -70 9.18389 0.211
NP_440163.1_10 Forward -251 -241 13.648 0.118
NP_440282.1_10 Forward -387 -368 -5.50708 0.25
NP_440531.1_6 Forward -221 -202 -2.85214 0.258
NP_440487.1_1 Reverse -254 -273 -6.98204 0.276
NP_441965.1_10 Forward -380 -364 2.32015 0.288
NP_442529.1_6 Forward -247 -228 16.9124 0.232
NP_442693.1_6 Forward -258 -239 1.57275 0.278
NP_442693.1_7 Forward -384 -365 10.2259 0.227
NP_442280.1_10 Forward -398 -380 7.01283 0.268
NP_441592.1_4 Reverse -63 -82 -3.44213 0.281
NP_441896.1_3 Forward -251 -232 10.8159 0.0833
NP_440894.1_10 Reverse -228 -247 11.9958 0.135
NP_440894.1_10 Reverse -156 -175 2.0644 0.298
NP_441894.1_1 Reverse -376 -395 -3.14714 0.155
NP_442067.1_4 Forward -224 -205 5.11266 0.244
NP_442067.1_4 Forward -253 -234 3.14605 0.289
NP_440999.1_9 Forward -381 -367 13.3726 0.0328
NP_440999.1_9 Forward -246 -232 -0.295402 0.203
NP_440888.1_2 Reverse -233 -247 14.9452 0.0137
NP_440888.1_2 Forward -377 -363 9.04542 0.139
NP_442147.1_6 Reverse -212 -226 17.1085 0.205
NP_440491.1_1 Forward -245 -226 20.0738 0.0243
NP_440491.1_1 Reverse -204 -223 8.37887 0.243
NP_441543.1_2 Reverse -234 -243 8.65285 0.0968
NP_441543.1_2 Forward -376 -367 5.01461 0.209
NP_441551.1_5 Forward -381 -365 6.2527 0.275
NP_441469.1_8 Forward -243 -234 6.39124 0.227
NP_441469.1_8 Forward -378 -369 5.99792 0.241
NP_441306.1_10 Forward -225 -211 13.9619 0.25
NP_442578.1_7 Forward -241 -234 6.0373 0.18
NP_440071.1_2 Reverse -371 -385 17.5025 0.24
NP_441462.1_2 Forward -242 -232 16.2046 0.00406
NP_441462.1_2 Forward -309 -299 -0.41329 0.225
NP_441621.1_7 Forward -244 -230 5.80112 0.0726
NP_441621.1_7 Forward -256 -242 3.04785 0.121
NP_441621.1_7 Reverse -231 -245 -3.34366 0.188
NP_441621.1_7 Forward -379 -365 -4.81863 0.246
NP_443062.1_1 Forward -242 -224 5.71821 0.22
NP_443062.1_6 Forward -193 -174 4.32602 0.221
NP_441601.1_7 Reverse -225 -244 9.43923 0.24
NP_440519.1_8 Forward -71 -55 9.10498 0.199
NP_442204.1_1 Reverse -382 -393 7.63016 0.123
NP_442204.1_1 Forward -246 -235 0.648657 0.281
NP_442204.1_1 Reverse -364 -375 -0.0396598 0.285
NP_440516.1_6 Forward -395 -381 16.0269 0.186
NP_440516.1_8 Forward -242 -233 18.9776 0.00442
NP_440516.1_8 Reverse -233 -242 5.01461 0.118
NP_442428.1_5 Forward -241 -234 6.13563 0.209
NP_442428.1_5 Reverse -234 -241 6.0373 0.212
NP_442428.1_5 Reverse -369 -376 4.66067 0.244
NP_442120.1_10 Forward -383 -364 -14.8485 0.289
NP_441867.1_2 Reverse -247 -266 -17.7985 0.291
NP_440673.1_2 Forward -267 -248 8.63366 0.264
NP_440673.1_3 Reverse -235 -242 12.4288 0.0426
NP_440673.1_3 Reverse -302 -309 8.8889 0.206
NP_441052.1_2 Forward -377 -367 7.55152 0.0685
NP_441052.1_2 Reverse -233 -243 1.25834 0.249
NP_442219.1_8 Forward -217 -198 16.5742 0.0805
NP_440436.1_4 Reverse -234 -243 8.55409 0.0997
NP_440436.1_4 Forward -376 -367 4.62087 0.248
NP_441884.1_8 Reverse -232 -251 -6.88371 0.239
NP_441884.1_9 Forward -245 -226 -22.0267 0.275
NP_441884.1_9 Reverse -230 -249 -22.125 0.275
NP_440314.1_9 Forward -241 -222 -9.53865 0.269
NP_440648.1_1 Forward -380 -361 2.45773 0.292
NP_441719.1_4 Forward -241 -234 6.82395 0.0855
NP_441719.1_4 Reverse -234 -241 6.52896 0.188
NP_441719.1_6 Forward -274 -255 4.42355 0.297
NP_441733.1_10 Reverse -230 -243 6.70579 0.176
NP_441004.1_1 Forward -212 -193 -3.54046 0.159
NP_441004.1_1 Reverse -251 -270 -11.7019 0.241
NP_441004.1_5 Forward -210 -196 18.4858 0.14
NP_442366.1_3 Forward -243 -225 -4.8974 0.278
NP_441034.1_4 Reverse -228 -247 18.0287 0.094
NP_442873.1_3 Forward -274 -255 10.0284 0.176
NP_442873.1_3 Reverse -196 -215 5.11187 0.262
NP_442206.1_10 Forward -71 -56 0.176559 0.269
NP_442854.1_6 Reverse -10 -29 3.83436 0.253
NP_441228.1_8 Forward -382 -363 11.6025 0.151
NP_443054.1_2 Reverse -366 -380 0.786239 0.254
NP_442308.1_4 Reverse -242 -261 2.26107 0.267
NP_441851.1_10 Reverse -367 -377 5.09324 0.227
NP_442208.1_5 Reverse -255 -274 -4.22878 0.258
NP_442208.1_5 Forward -221 -202 -8.752 0.281
NP_441195.1_1 Forward -21 -2 4.916 0.087
NP_442622.1_1 Reverse -238 -257 -5.31042 0.257
NP_442856.1_7 Forward -386 -367 1.37609 0.172
NP_442856.1_7 Reverse -239 -258 -0.590531 0.208
NP_441668.1_4 Reverse -358 -377 6.09597 0.163
NP_442515.1_1 Reverse -26 -40 1.96621 0.145
NP_442515.1_1 Reverse -68 -82 -4.03198 0.298
NP_442515.1_1 Reverse -367 -381 -5.01529 0.298
NP_441396.1_5 Forward -385 -376 8.25953 0.224
NP_440593.1_3 Reverse -228 -247 12.1925 0.107
NP_441982.1_6 Reverse -336 -345 10.671 0.295
NP_440463.1_8 Forward -396 -377 5.56364 0.277
NP_441046.1_2 Reverse -243 -262 1.47442 0.256
NP_441349.1_10 Reverse -358 -377 -2.95047 0.13
NP_441349.1_10 Reverse -364 -383 -4.22878 0.164
NP_442314.1_1 Reverse -202 -220 -4.01242 0.256
NP_440389.1_3 Reverse -365 -384 20.4523 0.0735
NP_442843.1_1 Reverse -249 -268 -9.047 0.264
NP_440474.1_8 Reverse -369 -383 7.76712 0.199
NP_440396.1_1 Forward -182 -163 5.211 0.156
NP_440396.1_3 Forward -205 -186 22.1239 0.0167
NP_440396.1_5 Forward -319 -300 25.5655 0.00652
NP_440396.1_6 Forward -232 -213 29.5971 0.000658
NP_440933.1_1 Reverse -236 -255 9.14423 0.289
NP_440431.1_3 Reverse -373 -392 -12.1936 0.296
NP_440588.1_2 Forward -386 -367 -2.26216 0.163
NP_440588.1_2 Forward -201 -182 -5.80207 0.262
NP_442006.1_2 Forward -71 -54 -6.05768 0.154
NP_442006.1_2 Forward -257 -240 -15.4975 0.227
NP_442006.1_2 Reverse -380 -397 -15.6941 0.228
NP_441003.1_9 Reverse -53 -72 2.94938 0.3
NP_443047.1_7 Forward -241 -222 3.6377 0.294
NP_441570.1_1 Reverse -233 -251 -17.2871 0.269
NP_441078.1_4 Reverse -368 -377 7.66954 0.052
NP_441078.1_4 Forward -377 -368 0.688044 0.164
NP_441078.1_4 Forward -242 -233 0.196389 0.205
NP_441078.1_4 Reverse -233 -242 -0.000272808 0.205
NP_441078.1_4 Forward -309 -300 -1.96689 0.282
NP_442729.1_8 Reverse -23 -36 4.73917 0.282
NP_442348.1_2 Forward -214 -205 7.66954 0.28
NP_442443.1_1 Reverse -240 -259 -0.983855 0.228
NP_442443.1_1 Reverse -249 -268 -1.37718 0.233
NP_441432.1_8 Forward -243 -234 5.50626 0.151
NP_441432.1_8 Reverse -367 -376 4.32629 0.223
NP_441432.1_9 Forward -344 -331 8.59837 0.287
NP_442320.1_8 Forward -248 -234 -1.37704 0.0817
NP_441732.1_2 Reverse -364 -380 -15.2811 0.145
NP_441732.1_2 Reverse -229 -245 -15.2811 0.145
NP_441732.1_2 Reverse -296 -312 -17.4444 0.258
NP_440759.1_9 Reverse -127 -146 10.3242 0.224
NP_440760.1_1 Reverse -233 -252 -14.0619 0.122
NP_442797.1_6 Reverse -296 -315 8.41895 0.265
NP_441057.1_4 Forward -217 -199 1.00246 0.253
NP_442751.1_2 Reverse -46 -65 2.9486 0.274
NP_440713.1_4 Forward -252 -233 9.73422 0.14
NP_440713.1_4 Reverse -209 -228 7.66927 0.176
NP_442489.1_2 Forward -388 -369 6.19431 0.182
NP_442489.1_7 Reverse -368 -377 8.1612 0.0294
NP_442489.1_7 Forward -242 -233 0.688044 0.152
NP_442489.1_7 Reverse -233 -242 0.688044 0.152
NP_442489.1_7 Forward -377 -368 0.491382 0.178
NP_442489.1_7 Forward -309 -300 -1.47524 0.203
NP_441659.2_8 Forward -377 -367 6.27322 0.0797
NP_441659.2_8 Forward -309 -299 4.89658 0.123
NP_441659.2_8 Forward -242 -232 1.84832 0.224
NP_440860.1_8 Reverse -231 -250 13.1758 0.296
NP_442913.1_10 Reverse -362 -381 -5.80207 0.279
NP_440708.1_6 Forward -393 -374 -10.6203 0.282
NP_440442.1_3 Forward -249 -235 15.4376 0.271
NP_441800.1_7 Reverse -189 -207 8.08229 0.113
NP_441800.1_7 Reverse -48 -66 -4.01242 0.284
NP_442346.1_5 Forward -310 -300 10.6981 0.0888
NP_442346.1_5 Reverse -367 -377 6.27322 0.208
NP_442346.1_5 Reverse -193 -203 4.3066 0.291
NP_440545.1_3 Forward -75 -58 1.31714 0.121
NP_440545.1_3 Reverse -364 -381 0.92382 0.129
NP_440545.1_3 Reverse -58 -75 -0.354483 0.152
NP_440545.1_3 Reverse -229 -246 -1.33779 0.167
NP_440545.1_3 Forward -313 -296 -2.41943 0.184
NP_440545.1_3 Reverse -293 -310 -7.13932 0.298
NP_441856.1_8 Reverse -225 -244 25.4672 0.00494
NP_440831.1_3 Forward -273 -254 6.09591 0.275
NP_441653.1_2 Forward -253 -234 19.1843 0.0274
NP_440010.1_4 Reverse -364 -383 4.62021 0.22
NP_440010.1_4 Forward -252 -233 0.686995 0.244
NP_440010.1_10 Forward -83 -64 3.83436 0.25
NP_442311.1_5 Reverse -326 -345 3.73603 0.245
NP_442603.1_9 Reverse -55 -73 4.54237 0.293
NP_441888.1_7 Forward -271 -257 0.687908 0.287
NP_440449.1_6 Reverse -225 -243 4.46257 0.297
NP_441833.1_4 Reverse -234 -241 6.52896 0.0924
NP_441833.1_4 Forward -241 -234 6.23397 0.163
NP_441895.1_10 Reverse -334 -353 -18.6834 0.282
NP_442162.1_9 Forward -241 -234 12.9205 0.0282
NP_442162.1_9 Reverse -234 -241 12.9205 0.0282
NP_442404.1_9 Reverse -236 -250 12.487 0.263
NP_440772.1_7 Reverse -252 -271 16.2241 0.168
NP_441915.1_4 Reverse -262 -281 6.39016 0.293
NP_442199.1_6 Forward -387 -368 15.4374 0.247
NP_442140.1_3 Reverse -234 -244 15.418 0.0393
NP_442140.1_3 Reverse -369 -379 6.76487 0.159
NP_441671.1_10 Reverse -252 -271 5.80098 0.215
NP_440875.1_9 Reverse -235 -245 15.2829 0.0295
NP_440875.1_9 Forward -69 -59 12.0708 0.137
NP_440875.1_9 Reverse -59 -69 11.0001 0.187
NP_441813.1_5 Reverse -231 -241 5.5849 0.118
NP_441813.1_5 Forward -244 -234 0.275027 0.206
NP_442254.1_6 Reverse -195 -214 15.7324 0.133
NP_441259.1_1 Forward -268 -249 15.6341 0.247
NP_440590.1_4 Reverse -234 -247 12.409 0.0141
NP_440590.1_4 Forward -241 -228 2.57589 0.0845
NP_440567.1_1 Reverse -184 -198 6.98109 0.0795
NP_440567.1_1 Forward -241 -227 6.6861 0.0816
NP_440567.1_1 Reverse -234 -248 2.85119 0.16
NP_440567.1_1 Reverse -369 -383 -0.688726 0.298
NP_442497.1_10 Reverse -234 -243 0.589713 0.153
NP_442497.1_10 Forward -241 -232 -1.18024 0.256
NP_440821.1_4 Forward -244 -234 9.02648 0.0364
NP_441239.1_9 Reverse -231 -243 15.8703 0.0178
NP_441239.1_9 Reverse -255 -267 10.8554 0.0714
NP_441239.1_9 Forward -379 -367 6.82381 0.175
NP_441239.1_9 Reverse -60 -72 5.25052 0.223
NP_441239.1_9 Reverse -366 -378 3.18557 0.292
NP_441951.1_4 Forward -248 -229 2.94938 0.283
NP_441951.1_4 Reverse -233 -252 2.75272 0.283
NP_441892.1_1 Forward -251 -234 -2.91109 0.23
NP_440665.1_1 Forward -395 -376 -9.73531 0.244
NP_440665.1_1 Reverse -236 -255 -10.227 0.244
NP_442044.1_1 Reverse -270 -289 -13.9635 0.283
NP_442044.1_9 Forward -242 -223 5.80098 0.202
NP_441567.1_4 Forward -263 -244 6.19431 0.281
NP_442138.1_9 Reverse -220 -239 16.3215 0.157
NP_440546.1_4 Forward -242 -232 15.6695 0.0459
NP_440546.1_4 Reverse -233 -243 6.55553 0.291
NP_441230.1_5 Reverse -228 -247 13.7658 0.0635
NP_440462.1_6 Reverse -231 -241 15.5163 0.0142
NP_440462.1_6 Forward -244 -234 8.4365 0.062
NP_442340.1_3 Forward -69 -50 -9.73531 0.275
NP_442611.1_1 Reverse -228 -247 -2.55715 0.292
NP_440868.1_4 Forward -246 -234 9.97041 0.0405
NP_440868.1_4 Forward -381 -369 1.90727 0.171
NP_440401.1_1 Reverse -87 -101 21.7554 0.022
NP_440401.1_9 Reverse -75 -82 14.5917 0.287
NP_441474.1_1 Forward -396 -377 1.76863 0.247
NP_442402.1_2 Reverse -46 -60 11.4053 0.272
NP_439942.1_2 Reverse -127 -146 15.4144 0.228
NP_440696.1_6 Reverse -258 -277 5.70265 0.266
NP_442923.1_4 Forward -212 -193 -6.29373 0.297
NP_442039.1_4 Forward -241 -234 11.6422 0.0747
NP_442039.1_4 Forward -9 -2 7.02061 0.269
NP_442679.1_3 Reverse -126 -144 1.29745 0.265
NP_442829.1_2 Reverse -66 -82 11.2334 0.287
NP_442409.1_5 Forward -198 -179 15.3391 0.23
NP_441926.1_3 Forward -242 -226 3.30346 0.23
NP_442696.1_6 Forward -166 -147 -3.73712 0.155
NP_442837.1_3 Forward -241 -234 6.0373 0.25
NP_442837.1_3 Reverse -234 -241 6.0373 0.25
NP_440160.1_2 Reverse -368 -387 -7.08038 0.283
NP_442053.1_1 Reverse -233 -242 14.4544 0.0114
NP_442053.1_1 Forward -242 -233 7.86621 0.0863
NP_442053.1_1 Forward -377 -368 4.91628 0.218
NP_440505.1_3 Forward -244 -234 12.5664 0.0482
NP_440505.1_7 Reverse -364 -383 1.37609 0.249
NP_441701.1_3 Reverse -11 -28 6.33202 0.291
NP_442532.1_7 Reverse -368 -382 5.30946 0.171
NP_440914.1_1 Forward -242 -232 10.8597 0.118
NP_440914.1_1 Reverse -57 -67 9.10306 0.186
NP_441011.1_8 Forward -241 -232 11.5045 0.0778
NP_441011.1_8 Reverse -234 -243 7.07956 0.179
NP_441011.1_8 Forward -191 -182 5.80125 0.227
NP_442533.1_6 Forward -377 -368 8.55452 0.0747
NP_442533.1_6 Reverse -368 -377 6.48957 0.109
NP_442533.1_6 Reverse -300 -309 5.3096 0.145
NP_442533.1_6 Reverse -233 -242 4.42462 0.179
NP_442533.1_6 Reverse -374 -383 2.94966 0.232
NP_442533.1_6 Reverse -263 -272 1.86802 0.284
NP_442541.1_10 Forward -332 -318 0.883986 0.295
NP_442232.1_3 Forward -385 -366 -5.31042 0.165
NP_441482.1_7 Forward -248 -234 -8.5552 0.193
NP_442269.1_5 Reverse -166 -185 19.7184 0.184
NP_441697.1_5 Reverse -131 -150 -8.83343 0.268
NP_440816.1_2 Reverse -327 -346 6.24133 0.284
NP_441028.1_6 Forward -181 -171 6.0761 0.232
NP_442202.1_10 Reverse -203 -217 6.78443 0.255
NP_441527.1_4 Reverse -316 -335 -4.82277 0.189
NP_440115.1_6 Forward -245 -235 9.61647 0.115
NP_441602.1_3 Forward -247 -228 19.2723 0.0354
NP_441972.1_5 Reverse -234 -253 -4.42544 0.211
NP_441972.1_5 Forward -259 -240 -9.73531 0.293
NP_441106.1_1 Forward -243 -234 8.45619 0.0548
NP_440429.1_2 Forward -271 -252 10.4225 0.267
NP_439903.1_6 Reverse -230 -249 2.06362 0.233
NP_441286.1_1 Reverse -367 -379 -4.68091 0.168
NP_441286.1_1 Forward -243 -231 -5.27089 0.194
NP_442674.1_3 Forward -323 -304 2.85027 0.297
NP_440670.1_8 Forward -242 -233 8.75118 0.0606
NP_440670.1_8 Reverse -233 -242 6.19458 0.124
NP_440670.1_8 Forward -377 -368 5.3096 0.167
NP_440886.1_7 Forward -378 -368 15.6142 0.0243
NP_440886.1_7 Forward -243 -233 6.86274 0.113
NP_440886.1_7 Reverse -232 -242 6.76441 0.114
NP_440886.1_7 Reverse -376 -386 4.99446 0.205
NP_440886.1_10 Forward -188 -169 7.86512 0.272
NP_442072.1_9 Forward -243 -225 4.9357 0.0183
NP_442401.1_2 Forward -341 -322 7.76679 0.255
NP_442022.1_4 Reverse -242 -261 5.80098 0.279
NP_440907.2_8 Reverse -234 -244 15.7125 0.0168
NP_441021.1_8 Reverse -363 -381 6.90232 0.198
NP_440193.1_10 Reverse -281 -300 20.944 0.123
NP_441463.1_6 Reverse -366 -380 7.4789 0.261
NP_441626.1_2 Forward -241 -234 12.2322 0.0511
NP_441626.1_2 Reverse -234 -241 5.93897 0.231
NP_442211.1_3 Reverse -375 -394 10.4872 0.257
NP_442794.1_1 Reverse -364 -376 6.43049 0.18
NP_441796.1_8 Forward -396 -378 10.8356 0.222
NP_440387.1_1 Reverse -368 -384 -4.36636 0.185
NP_440387.1_1 Forward -309 -293 -4.56302 0.19
NP_440387.1_1 Reverse -233 -249 -5.448 0.232
NP_440855.1_1 Forward -260 -241 5.70265 0.148
NP_440855.1_5 Reverse -366 -385 7.07848 0.285
NP_441431.1_2 Forward -245 -231 12.5853 0.114
NP_441431.1_2 Reverse -230 -244 7.76712 0.234
NP_441836.1_1 Forward -218 -199 11.6941 0.294
NP_441836.1_2 Forward -383 -364 8.25926 0.101
NP_441836.1_2 Reverse -294 -313 5.11266 0.128
NP_441836.1_2 Forward -209 -190 2.26107 0.175
NP_441993.1_1 Forward -383 -364 2.43397 0.259
NP_439938.1_10 Reverse -249 -268 18.9773 0.16
NP_441174.1_2 Reverse -365 -379 15.6342 0.102
NP_440114.1_10 Forward -242 -228 7.66941 0.229
NP_442323.1_7 Forward -30 -11 3.53858 0.238
NP_440293.1_3 Forward -215 -196 -3.3438 0.244
NP_440766.1_4 Forward -246 -232 12.1926 0.0568
NP_440766.1_4 Reverse -229 -243 7.07942 0.097
NP_439988.1_7 Forward -307 -293 13.9619 0.292
NP_441979.1_5 Reverse -227 -246 -2.45882 0.147
NP_442103.1_2 Reverse -239 -257 14.8663 0.192
NP_440457.1_1 Forward -246 -234 9.47875 0.0927
NP_440798.1_6 Reverse -234 -247 2.57589 0.17
NP_440801.1_8 Reverse -197 -216 0.0977854 0.262
NP_442040.1_4 Forward -260 -241 9.73422 0.141
NP_442509.1_9 Reverse -233 -243 9.71433 0.192
NP_443037.1_7 Forward -145 -126 -2.55715 0.276
NP_440554.1_4 Reverse -234 -244 10.9931 0.0429
NP_441885.1_5 Forward -377 -367 2.14332 0.0827
NP_441885.1_5 Forward -242 -232 -0.0199663 0.186
NP_441885.1_5 Forward -36 -26 -1.78992 0.284
NP_440478.1_4 Reverse -251 -270 11.2092 0.261
NP_440478.1_9 Forward -260 -241 10.1275 0.255
NP_442341.1_7 Reverse -232 -246 3.34284 0.227
NP_440191.1_4 Forward -399 -389 14.3116 0.266
NP_443000.1_7 Reverse -366 -376 0.668351 0.293
NP_442513.1_5 Reverse -255 -274 6.98015 0.282
NP_441842.1_10 Forward -249 -235 10.521 0.161
NP_441842.1_10 Forward -17 -3 8.65272 0.213
NP_440275.1_3 Forward -244 -234 15.418 0.0178
NP_440091.1_1 Reverse -179 -191 0.530633 0.247
NP_440091.1_1 Forward -246 -234 0.432302 0.25
NP_441359.1_5 Forward -245 -226 1.67108 0.289
NP_442451.1_2 Forward -250 -231 -7.17871 0.232
NP_442451.1_2 Forward -286 -267 -11.2103 0.287
NP_441122.1_1 Forward -211 -196 2.92983 0.29
NP_439962.1_4 Forward -274 -255 -2.16383 0.224
NP_439962.1_4 Reverse -225 -244 -3.24547 0.249
NP_439962.1_4 Forward -231 -212 -5.01543 0.272
NP_439962.1_4 Reverse -240 -259 -6.1954 0.281
NP_439962.1_4 Forward -250 -231 -6.58872 0.283
NP_439962.1_4 Reverse -252 -271 -8.26035 0.292
NP_442495.1_5 Reverse -369 -388 12.4875 0.23
NP_440149.1_8 Reverse -233 -252 -0.4922 0.15
NP_440149.1_8 Reverse -257 -276 -1.18052 0.157
NP_440149.1_8 Reverse -368 -387 -3.14714 0.183
NP_441105.1_3 Forward -253 -234 -5.21209 0.214
NP_440216.1_1 Forward -242 -228 -11.5051 0.192
NP_440216.1_1 Forward -377 -363 -12.3901 0.264
NP_440216.1_6 Forward -384 -368 -0.334789 0.294
NP_440216.1_9 Forward -165 -156 13.5694 0.197
NP_440216.1_9 Reverse -382 -391 6.39124 0.289
NP_440172.1_1 Forward -242 -232 8.82982 0.0586
NP_440172.1_1 Forward -377 -367 3.51995 0.224
NP_442015.1_10 Reverse -244 -257 0.117615 0.241
NP_442015.1_10 Reverse -364 -377 -0.37404 0.264
NP_441226.1_7 Forward -241 -234 12.7234 0.0312
NP_441226.1_7 Reverse -234 -241 11.5435 0.0757
NP_442446.1_4 Reverse -296 -315 22.3206 0.027
NP_441111.1_7 Reverse -234 -242 8.86921 0.0589
NP_441766.1_2 Reverse -233 -242 14.7494 0.00772
NP_441766.1_2 Forward -377 -368 3.83464 0.202
NP_442417.1_5 Reverse -239 -253 5.40779 0.263
NP_440416.1_1 Forward -242 -223 -13.5702 0.281
NP_440416.1_9 Forward -214 -195 -12.7836 0.16
NP_440416.1_9 Forward -259 -240 -17.8968 0.248
NP_440416.1_9 Forward -73 -54 -18.3884 0.256
NP_443052.1_8 Forward -316 -297 -12.0953 0.248
NP_443052.1_8 Reverse -223 -242 -12.7836 0.263
NP_440885.1_6 Reverse -328 -347 12.9937 0.183
NP_442154.1_1 Reverse -255 -273 -13.3539 0.217
NP_442154.1_1 Reverse -246 -264 -15.9105 0.228
NP_440261.1_5 Reverse -369 -382 -4.50394 0.151
NP_440261.1_5 Reverse -234 -247 -12.4687 0.297
NP_440988.1_10 Reverse -372 -386 5.77014 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTTCCACCATTTCCTTGGTGGCGGCCATCTCCAGGTTTAAGTGGGTGCGCACCGTTTTTCGCAATATTTCCACGTCCCGCTCTTGAATGTGGCGACGGTCTTCCCGTAAATGGGCTGTAATACCATCCGCCCCGGCCAGTTCGGCCAACACAGCGGCGGCGATCGGGTCTGGCTCCACCGTTTGGCGGGCTTGGCGAATGGTGGCTACGTGATCGATGTTGACCCCCAATGTTAGCAAGGCAAACCTCTCAATAATTTTGGATTTTGTTGATCTAAGCGGACTTACTATTTTAAGGGAATTGATGACCAATCCATAGTTGGGGTTCTAGTCCATGGCATCGGTGGAAATGTTTGATTTAATAGGGGTGTCGGCATAGTATCCCCCTTGCAGAGATTGGT

CDS

ATGGAAATTGGTGTTCCCAAGGAAATTAAAGACCAGGAATTTCGGGTGGGGCTGACCCCCAGTAGTGTACGGGCATTGCTGAGCCAGGGCCATCAAGTATTTGTGGAAGAAGGGGCCGGAGTCGGGTCTGGCTTCCCCGATGGAGCCTACGCAAAGGCGGGAGCTGAGTTAGTTGCCACTGCCAAAGAGGCTTGGAACAGGGAATTGGTGGTGAAAGTGAAAGAGCCTCTCCCTGAAGAGTATGAATATTTAACTTTGCCTAAGTTGTTGTTCACTTATCTCCATTTGGCAGCGGAACGTACCCTCACCGAAGCTCTAATTAAATCTGGCATTACGGCGATCGCCTATGAAACGGTGGAATTGGCTGATGGTCAATTGCCATTGTTGGCCCCCATGAGCCGCATTGCCGGACGATTGGCGGTGCAGATGGGTGCCCATTATTTGGAAAAACAACAGGGAGGCCGGGGAGTTCTGTTGGGAGGCGTACCCGGAGTCAAGGCCGGACAAGTAACTATCCTCGGCGGTGGCGTAGTCGGTACAGAGGCGGCCAAAATGGCGATCGGACTGGGGGCCATGGTGACCATCCTAGACATCAATGTAGACCGTTTAAACCAATTGGGAGAACTGTTCGGTTCCCGGGTGGATCTGCGCTACAGCAATGCCAGCCAAATCGAAGACCTGTTGCCCCATACAGATTTGCTCATCGGCGCAGTATTGATCACAGGCAAGCGGGCCCCAGTGTTGGTTTCCCGCCAGGAAGTGGAGCAAATGTTGCCAGGGGCGGTGATTATGGATGTGGCGATCGACCAAGGGGGCTGTGTGGAGACTTTGCGGGTAACTTCTCATAGTCAACCCAGTTACATCGAAGCAGAAGTAGTTCATGTGGGCATTCCCAATATGCCAGGAGCCACTCCCTGGACAGCAACCCAAGCGTTGAATAATAGTACATTGCGCTATGTGTTGAAATTGGCCAATCTGGGGGAACAGGCTTGGGAAAATGATTTGCCGTTGGCGAAAGGAGTCAATGTTCAAGCCGGAAAATTGGTGCAAGGGGCGGTAAAAACGGTATTTCCTGATTTGTAA

Protein

MEIGVPKEIKDQEFRVGLTPSSVRALLSQGHQVFVEEGAGVGSGFPDGAYAKAGAELVATAKEAWNRELVVKVKEPLPEEYEYLTLPKLLFTYLHLAAERTLTEALIKSGITAIAYETVELADGQLPLLAPMSRIAGRLAVQMGAHYLEKQQGGRGVLLGGVPGVKAGQVTILGGGVVGTEAAKMAIGLGAMVTILDINVDRLNQLGELFGSRVDLRYSNASQIEDLLPHTDLLIGAVLITGKRAPVLVSRQEVEQMLPGAVIMDVAIDQGGCVETLRVTSHSQPSYIEAEVVHVGIPNMPGATPWTATQALNNSTLRYVLKLANLGEQAWENDLPLAKGVNVQAGKLVQGAVKTVFPDL