Your browser is old and dusty. Try Google Chrome!

Details for sll1680

ORF sll1680
Accession NP_440114.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -190 -176 12.7826 0.207
NP_441061.1_2 Reverse -85 -99 1.47456 0.188
NP_440795.1_7 Forward -92 -85 14.6904 0.0123
NP_440795.1_7 Reverse -85 -92 14.6904 0.0123
NP_441418.1_6 Reverse -84 -103 -2.0655 0.0169
NP_441418.1_6 Forward -93 -74 -20.1584 0.106
NP_441418.1_6 Forward -199 -180 -20.8467 0.129
NP_442291.1_5 Forward -304 -288 3.00846 0.116
NP_440897.1_6 Forward -219 -200 5.99684 0.108
NP_440897.1_6 Reverse -84 -103 -3.83621 0.257
NP_441453.1_1 Reverse -77 -95 11.4247 0.117
NP_441453.1_4 Reverse -84 -92 16.539 0.00633
NP_441453.1_4 Forward -93 -85 16.539 0.00633
NP_441623.1_1 Forward -45 -27 -1.94747 0.241
NP_443041.1_6 Forward -198 -179 9.63589 0.191
NP_442151.1_6 Reverse -84 -98 17.6008 0.00997
NP_442151.1_6 Forward -93 -79 6.6861 0.224
NP_441818.1_1 Reverse -295 -306 11.8579 0.155
NP_441818.1_1 Forward -92 -81 9.69459 0.232
NP_441818.1_1 Reverse -154 -165 9.49793 0.241
NP_441818.1_9 Reverse -10 -29 -5.11376 0.248
NP_441818.1_9 Forward -222 -203 -10.227 0.292
NP_440226.1_1 Forward -93 -74 19.3707 0.0114
NP_442623.1_3 Reverse -85 -104 -9.83364 0.154
NP_442744.1_8 Reverse -17 -36 -3.44213 0.297
NP_442287.1_5 Forward -257 -247 15.9097 0.218
NP_442655.1_1 Reverse -79 -98 2.75272 0.238
NP_442655.1_10 Forward -96 -77 -10.0303 0.22
NP_442173.1_1 Forward -92 -84 15.4574 0.00633
NP_442173.1_1 Reverse -85 -93 15.4574 0.00633
NP_442752.1_4 Forward -93 -86 13.8055 0.0199
NP_442752.1_4 Reverse -84 -91 13.8055 0.0199
NP_442752.1_4 Forward -256 -249 7.6106 0.151
NP_443027.1_4 Reverse -82 -92 14.828 0.0437
NP_443027.1_4 Forward -95 -85 6.46988 0.275
NP_441812.1_3 Forward -94 -80 8.55439 0.251
NP_442975.1_10 Reverse -80 -94 13.7653 0.0459
NP_440784.1_7 Forward -92 -85 15.9687 0.0123
NP_440784.1_7 Reverse -85 -92 15.9687 0.0123
NP_442909.1_7 Reverse -154 -168 12.8803 0.129
NP_440061.1_9 Reverse -82 -96 19.1735 0.00631
NP_440061.1_9 Reverse -179 -193 10.717 0.123
NP_440061.1_9 Reverse -236 -250 9.04542 0.154
NP_440878.1_9 Forward -103 -84 3.14605 0.174
NP_442062.1_8 Forward -93 -83 19.4496 0.000558
NP_442062.1_8 Reverse -84 -94 17.6796 0.00193
NP_441859.1_3 Reverse -83 -102 13.5683 0.0814
NP_441859.1_3 Forward -169 -150 3.04693 0.25
NP_440304.1_4 Forward -95 -85 17.9746 0.00654
NP_440304.1_4 Reverse -82 -92 10.8948 0.051
NP_440304.1_4 Forward -206 -196 4.3066 0.271
NP_442242.1_4 Forward -92 -85 14.3954 0.0124
NP_442242.1_4 Reverse -85 -92 14.3954 0.0124
NP_440044.1_8 Reverse -160 -179 -1.57384 0.248
NP_441208.1_1 Reverse -230 -249 -6.49039 0.287
NP_441208.1_9 Forward -96 -82 15.0442 0.0896
NP_442742.1_9 Forward -247 -228 -14.1602 0.293
NP_442276.1_2 Forward -105 -86 8.94757 0.285
NP_440132.1_1 Reverse -82 -100 15.4571 0.106
NP_441546.1_1 Reverse -54 -67 16.1456 0.278
NP_442110.1_7 Reverse -84 -98 1.96621 0.222
NP_441082.1_10 Reverse -310 -323 10.7374 0.236
NP_441925.1_4 Reverse -240 -259 -14.7509 0.263
NP_441083.1_5 Reverse -84 -94 19.3512 0.000718
NP_441083.1_5 Forward -93 -83 11.3864 0.0159
NP_441083.1_5 Reverse -153 -163 -1.10161 0.295
NP_442827.1_8 Forward -101 -82 1.17865 0.185
NP_441434.1_7 Forward -188 -174 8.25939 0.225
NP_441738.1_2 Forward -91 -84 15.28 0.0102
NP_441738.1_2 Reverse -86 -93 15.28 0.0102
NP_441738.1_2 Forward -301 -294 6.52862 0.261
NP_440209.1_1 Reverse -84 -92 18.1123 0.00295
NP_440209.1_1 Forward -93 -85 18.1123 0.00295
NP_442889.1_1 Reverse -309 -328 -14.5535 0.277
NP_442889.1_8 Reverse -81 -95 3.93223 0.27
NP_440447.1_6 Forward -101 -83 0.904127 0.274
NP_441713.1_1 Forward -99 -80 -3.44213 0.113
NP_441770.1_4 Forward -255 -236 -12.6852 0.296
NP_440178.1_7 Forward -94 -75 -12.6852 0.123
NP_441989.1_1 Reverse -20 -39 15.4374 0.229
NP_441716.1_1 Reverse -84 -98 17.5025 0.0264
NP_441716.1_1 Forward -93 -79 4.22782 0.256
NP_441598.1_1 Forward -327 -308 8.45592 0.295
NP_442111.1_4 Reverse -83 -97 12.9793 0.0407
NP_441163.1_1 Forward -332 -315 10.2645 0.217
NP_440906.1_5 Forward -92 -85 15.8704 0.0124
NP_440906.1_5 Reverse -85 -92 15.8704 0.0124
NP_440747.1_10 Forward -96 -84 7.80712 0.00223
NP_440747.1_10 Reverse -81 -93 -2.02597 0.0196
NP_441130.1_10 Reverse -82 -96 12.0943 0.1
NP_441130.1_10 Forward -95 -81 8.45605 0.135
NP_441486.1_1 Reverse -81 -95 13.4709 0.00839
NP_441486.1_1 Forward -96 -82 -6.29359 0.288
NP_442634.1_4 Forward -206 -192 10.4227 0.0479
NP_442634.1_4 Forward -95 -81 4.22782 0.0819
NP_442634.1_4 Reverse -82 -96 -2.95034 0.157
NP_441265.1_3 Forward -99 -85 23.9923 0.0117
NP_441014.1_8 Reverse -182 -201 -5.9004 0.275
NP_441014.1_8 Reverse -205 -224 -6.78538 0.276
NP_441014.1_10 Forward -94 -75 4.81688 0.196
NP_442848.1_1 Forward -168 -154 -2.45868 0.263
NP_442848.1_9 Forward -110 -91 -1.57384 0.293
NP_443018.1_3 Forward -92 -85 14.8871 0.0123
NP_443018.1_3 Reverse -85 -92 14.8871 0.0123
NP_443018.1_3 Forward -167 -160 4.26735 0.267
NP_443018.1_3 Reverse -160 -167 4.07068 0.299
NP_441316.1_7 Reverse -82 -97 6.46974 0.107
NP_441634.1_8 Forward -192 -178 1.86788 0.178
NP_441634.1_8 Forward -95 -81 -4.22864 0.295
NP_440376.1_1 Forward -93 -84 19.4693 0.000692
NP_440376.1_1 Reverse -84 -93 19.4693 0.000692
NP_441857.1_5 Reverse -77 -95 2.57575 0.266
NP_441588.1_4 Reverse -161 -171 9.02648 0.14
NP_441588.1_4 Forward -91 -81 6.96153 0.178
NP_443065.1_9 Forward -326 -307 11.2092 0.231
NP_442687.1_7 Forward -94 -84 18.5646 0.0028
NP_442687.1_7 Reverse -83 -93 15.8113 0.0125
NP_442485.1_3 Reverse -73 -92 -5.01543 0.287
NP_440642.1_10 Forward -32 -18 8.84875 0.198
NP_440042.1_2 Forward -103 -84 2.16274 0.195
NP_441422.1_7 Reverse -82 -99 -9.00761 0.289
NP_440533.1_9 Forward -93 -74 2.55606 0.274
NP_442658.1_1 Forward -95 -85 17.6791 0.00565
NP_442658.1_1 Reverse -82 -92 15.9091 0.00966
NP_442496.1_5 Reverse -43 -61 7.78729 0.256
NP_440656.1_8 Reverse -73 -92 -2.0655 0.184
NP_441414.1_9 Reverse -84 -103 -9.44032 0.259
NP_441487.1_9 Forward -94 -75 1.76941 0.196
NP_441958.1_5 Forward -94 -84 20.5312 0.000966
NP_441958.1_5 Reverse -83 -93 12.2714 0.00183
NP_441127.1_1 Reverse -157 -171 7.66941 0.3
NP_442836.1_5 Forward -99 -80 5.70265 0.185
NP_440203.1_5 Reverse -87 -97 13.6475 0.112
NP_442816.1_2 Reverse -169 -188 18.584 0.249
NP_439990.1_5 Forward -98 -85 13.1956 0.102
NP_442376.1_2 Forward -98 -79 -13.3736 0.292
NP_442911.1_2 Forward -103 -84 16.3224 0.00925
NP_442911.1_2 Forward -236 -217 -10.9153 0.292
NP_441580.1_6 Reverse -73 -92 -6.68705 0.235
NP_441580.1_6 Reverse -218 -237 -8.06369 0.252
NP_442119.1_9 Reverse -83 -102 11.4058 0.245
NP_440993.1_3 Forward -103 -84 4.62021 0.161
NP_440993.1_3 Reverse -197 -216 -0.197979 0.261
NP_442853.1_5 Forward -182 -163 5.89851 0.287
NP_441099.1_5 Forward -103 -84 19.3707 0.00956
NP_441099.1_5 Reverse -209 -228 -8.35868 0.193
NP_442002.1_9 Forward -94 -87 14.1004 0.074
NP_442002.1_9 Reverse -83 -90 10.7572 0.185
NP_440809.1_9 Reverse -75 -93 -7.84733 0.225
NP_441294.1_7 Reverse -80 -94 12.8022 0.0838
NP_441646.1_1 Forward -100 -81 -1.67217 0.293
NP_442438.1_10 Forward -98 -84 2.75286 0.168
NP_442438.1_10 Reverse -79 -93 1.67122 0.19
NP_442438.1_10 Reverse -295 -309 -0.885388 0.283
NP_442431.1_10 Forward -202 -184 4.9357 0.206
NP_441752.1_6 Reverse -237 -256 -0.885524 0.279
NP_441000.1_6 Forward -94 -80 14.2576 0.0396
NP_442771.1_1 Reverse -82 -100 2.37909 0.0709
NP_441674.1_10 Forward -375 -357 2.57575 0.259
NP_440147.1_4 Reverse -82 -95 13.0973 0.0326
NP_440147.1_4 Forward -95 -82 2.67422 0.203
NP_441550.1_8 Forward -95 -85 19.8424 0.00352
NP_441550.1_8 Reverse -82 -92 6.0761 0.214
NP_441916.1_7 Forward -93 -83 18.4663 0.00144
NP_441916.1_7 Reverse -84 -94 16.893 0.00407
NP_440206.1_10 Reverse -186 -205 13.8641 0.288
NP_441041.1_4 Reverse -84 -103 1.47442 0.0808
NP_441041.1_4 Forward -93 -74 -6.09707 0.163
NP_441041.1_7 Forward -96 -84 18.593 0.00508
NP_441041.1_7 Reverse -81 -93 10.916 0.0864
NP_441547.1_2 Forward -197 -179 3.16574 0.289
NP_442004.1_6 Forward -168 -154 6.78443 0.17
NP_442004.1_6 Reverse -84 -98 6.3911 0.174
NP_440703.1_9 Forward -324 -311 8.77016 0.226
NP_441725.1_5 Reverse -85 -95 18.7612 0.0119
NP_441725.1_5 Forward -92 -82 11.2881 0.0247
NP_439966.1_7 Reverse -82 -92 18.4657 0.00473
NP_439966.1_7 Forward -305 -295 10.1076 0.0968
NP_439966.1_7 Forward -95 -85 8.14104 0.14
NP_439966.1_9 Reverse -312 -321 4.0313 0.253
NP_439966.1_9 Forward -95 -86 0.983037 0.253
NP_439966.1_9 Reverse -82 -91 0.983037 0.253
NP_440202.1_8 Reverse -76 -95 9.90358 0.297
NP_442941.1_3 Forward -92 -82 11.4848 0.0116
NP_442941.1_3 Reverse -85 -95 2.43831 0.14
NP_440289.1_2 Reverse -81 -94 24.2087 0.00201
NP_440289.1_2 Forward -96 -83 4.73917 0.0649
NP_440260.1_8 Forward -251 -233 -5.48739 0.275
NP_442281.1_1 Reverse -79 -93 11.9953 0.0418
NP_442281.1_1 Forward -98 -84 10.3237 0.0595
NP_442281.1_1 Forward -24 -10 7.86545 0.0907
NP_441334.1_7 Forward -110 -91 -14.7502 0.275
NP_441334.1_7 Forward -393 -374 -21.24 0.293
NP_441079.1_4 Reverse -360 -379 15.6875 0.249
NP_442256.1_2 Reverse -157 -175 -9.0273 0.247
NP_440437.1_1 Forward -99 -80 7.37428 0.066
NP_440437.1_1 Reverse -322 -341 -1.08219 0.194
NP_441457.1_7 Forward -95 -76 7.07928 0.168
NP_441556.1_10 Forward -98 -84 9.54046 0.298
NP_440498.1_1 Reverse -186 -204 -3.6191 0.267
NP_442982.1_5 Reverse -185 -204 -0.0988766 0.252
NP_441644.1_6 Reverse -84 -94 15.7125 0.0048
NP_441644.1_6 Forward -93 -83 10.1076 0.0628
NP_441644.1_6 Forward -168 -158 3.61784 0.272
NP_443049.1_6 Reverse -356 -366 11.3482 0.263
NP_442215.1_2 Reverse -82 -98 -0.236458 0.164
NP_442215.1_2 Forward -327 -311 -3.48138 0.216
NP_440253.1_2 Forward -93 -75 13.7855 0.0208
NP_440929.1_8 Forward -93 -84 19.2726 0.000701
NP_440929.1_8 Reverse -84 -93 19.2726 0.000701
NP_442933.1_10 Forward -93 -84 17.601 0.00325
NP_442933.1_10 Reverse -84 -93 17.601 0.00325
NP_441751.2_8 Reverse -85 -99 4.22782 0.0521
NP_441751.2_8 Forward -92 -78 -4.13031 0.163
NP_441751.2_8 Forward -302 -288 -4.4253 0.173
NP_442554.1_8 Reverse -85 -95 16.9913 0.0065
NP_442554.1_8 Forward -92 -82 13.8447 0.0145
NP_442554.1_8 Reverse -196 -206 3.42162 0.226
NP_441762.1_7 Reverse -83 -95 11.7404 0.0142
NP_441762.1_7 Forward -94 -82 11.4454 0.0142
NP_442142.1_4 Forward -96 -83 15.7516 0.0264
NP_442142.1_4 Reverse -81 -94 9.16348 0.101
NP_442142.1_4 Reverse -156 -169 5.23026 0.197
NP_442292.1_1 Forward -92 -83 9.63616 0.0183
NP_442292.1_1 Reverse -85 -94 9.53783 0.0183
NP_442381.1_8 Reverse -81 -100 -12.9802 0.267
NP_443009.1_5 Forward -94 -83 20.6093 0.001
NP_443009.1_5 Reverse -83 -94 9.10461 0.0965
NP_442301.1_2 Reverse -180 -199 6.68515 0.263
NP_442408.2_1 Reverse -84 -103 -7.67036 0.3
NP_441715.1_4 Forward -92 -82 16.303 0.0117
NP_440183.1_9 Reverse -240 -259 -15.5368 0.273
NP_441198.1_8 Forward -95 -85 15.2245 0.0427
NP_441468.1_1 Forward -92 -85 15.8704 0.0124
NP_441468.1_1 Reverse -85 -92 15.8704 0.0124
NP_441468.1_1 Forward -167 -160 3.97235 0.277
NP_441020.2_6 Reverse -82 -99 14.0018 0.0632
NP_441020.2_6 Forward -192 -175 10.9536 0.131
NP_441673.1_1 Forward -93 -84 20.8459 0.000698
NP_441673.1_1 Reverse -84 -93 20.8459 0.000698
NP_441673.1_1 Reverse -153 -162 -7.76842 0.168
NP_441673.1_1 Forward -190 -181 -8.06341 0.254
NP_441673.1_1 Forward -162 -153 -8.06341 0.254
NP_441016.2_6 Reverse -241 -260 9.43841 0.222
NP_442253.1_5 Reverse -312 -329 0.235503 0.203
NP_441876.1_9 Reverse -344 -354 11.3859 0.275
NP_441826.1_2 Forward -99 -85 5.21113 0.0978
NP_441826.1_2 Reverse -153 -167 1.86788 0.14
NP_441826.1_2 Reverse -288 -302 -1.37704 0.245
NP_442490.1_9 Forward -105 -86 -7.4737 0.278
NP_442490.1_9 Reverse -316 -335 -8.65367 0.293
NP_442868.1_6 Forward -95 -85 16.7946 0.0131
NP_442868.1_6 Forward -305 -295 3.42162 0.199
NP_442868.1_6 Reverse -82 -92 0.963343 0.205
NP_442719.1_2 Forward -130 -112 -8.63467 0.252
NP_442719.1_2 Reverse -358 -376 -11.7812 0.296
NP_441056.1_1 Reverse -84 -103 -7.37537 0.272
NP_442808.1_1 Reverse -83 -93 18.4657 0.00201
NP_442808.1_1 Forward -240 -230 13.0576 0.0481
NP_442808.1_1 Forward -94 -84 8.73102 0.0481
NP_442808.1_1 Reverse -180 -190 5.58445 0.146
NP_442808.1_1 Reverse -246 -256 4.7978 0.19
NP_442692.1_1 Forward -103 -84 -4.22878 0.274
NP_440145.1_3 Reverse -74 -93 0.196116 0.137
NP_442542.1_2 Forward -95 -82 13.9823 0.114
NP_442542.1_9 Reverse -92 -106 6.58715 0.229
NP_442113.1_10 Reverse -177 -196 -8.45701 0.282
NP_442050.1_5 Forward -95 -85 14.9258 0.0175
NP_442050.1_5 Forward -305 -295 10.1076 0.168
NP_442050.1_5 Reverse -82 -92 9.12434 0.193
NP_440038.1_2 Reverse -308 -327 14.0608 0.267
NP_440038.1_8 Forward -262 -243 13.5683 0.273
NP_442342.1_9 Reverse -82 -98 6.74504 0.217
NP_442342.1_9 Forward -95 -79 6.54838 0.218
NP_442342.1_9 Forward -155 -139 4.68009 0.245
NP_440342.1_1 Reverse -12 -31 14.3558 0.192
NP_441518.1_3 Reverse -74 -93 3.04771 0.0566
NP_441878.1_6 Forward -94 -84 20.2362 0.0046
NP_441878.1_6 Reverse -83 -93 10.4031 0.0176
NP_441878.1_6 Forward -191 -181 -7.19813 0.21
NP_441036.1_8 Reverse -83 -93 17.7779 0.000554
NP_441036.1_8 Forward -94 -84 8.4365 0.174
NP_441557.1_5 Forward -93 -84 19.9609 0.000699
NP_441557.1_5 Reverse -84 -93 19.9609 0.000699
NP_441557.1_8 Forward -104 -94 11.5826 0.244
NP_441445.1_1 Reverse -75 -94 19.9606 0.0276
NP_441445.1_1 Forward -102 -83 0.294447 0.278
NP_442777.1_3 Reverse -188 -206 6.99988 0.195
NP_441308.1_8 Reverse -82 -92 10.1081 0.22
NP_440101.1_5 Reverse -321 -340 10.3242 0.16
NP_442183.1_1 Forward -93 -79 10.226 0.0869
NP_442183.1_1 Reverse -84 -98 8.25939 0.119
NP_442183.1_1 Reverse -294 -308 4.91614 0.239
NP_442397.1_9 Forward -331 -312 3.83436 0.262
NP_442397.1_9 Reverse -294 -313 2.16274 0.283
NP_441574.1_1 Forward -202 -183 -2.16383 0.224
NP_441549.1_9 Reverse -311 -329 -10.5023 0.279
NP_441238.1_10 Forward -387 -373 12.7826 0.292
NP_442347.1_2 Forward -92 -83 11.1111 0.056
NP_442347.1_2 Reverse -343 -352 4.0313 0.284
NP_442347.1_2 Forward -302 -293 3.63797 0.284
NP_442347.1_2 Reverse -85 -94 3.34298 0.284
NP_441037.1_4 Forward -95 -85 18.9151 0.00351
NP_441037.1_4 Reverse -82 -92 7.02532 0.237
NP_441633.1_3 Reverse -82 -95 15.4572 0.0103
NP_441633.1_3 Forward -95 -82 -5.88057 0.236
NP_440136.1_2 Forward -92 -85 15.9687 0.0123
NP_440136.1_2 Reverse -85 -92 15.9687 0.0123
NP_440136.1_2 Reverse -295 -302 11.1505 0.0519
NP_442998.1_10 Forward -91 -84 15.5754 0.0102
NP_442998.1_10 Reverse -86 -93 15.5754 0.0102
NP_440299.1_1 Forward -97 -84 18.6032 0.00369
NP_440299.1_1 Reverse -155 -168 2.96866 0.265
NP_440299.1_1 Reverse -80 -93 2.28034 0.292
NP_441799.1_1 Forward -97 -83 9.14375 0.0988
NP_441007.1_10 Forward -195 -182 7.00078 0.152
NP_441007.1_10 Forward -98 -85 2.18257 0.195
NP_441007.1_10 Forward -209 -196 0.412608 0.23
NP_441435.1_4 Reverse -312 -331 8.45592 0.255
NP_440256.1_1 Forward -96 -77 0.982764 0.0791
NP_441362.1_2 Reverse -276 -295 5.17403 0.253
NP_441559.1_8 Forward -98 -84 2.85119 0.143
NP_441559.1_8 Forward -243 -229 -4.81863 0.238
NP_441559.1_8 Reverse -79 -93 -6.19526 0.275
NP_441559.1_8 Forward -185 -171 -6.88358 0.281
NP_440915.1_6 Forward -97 -83 15.2409 0.0183
NP_440915.1_6 Reverse -80 -94 4.62115 0.0953
NP_440915.1_6 Reverse -353 -367 4.42448 0.0953
NP_440915.1_6 Forward -172 -158 -0.787057 0.209
NP_441464.1_2 Reverse -246 -256 15.418 0.25
NP_441939.1_3 Reverse -85 -104 15.2408 0.0608
NP_441199.1_6 Reverse -80 -99 14.3558 0.0409
NP_441494.1_6 Forward -98 -85 10.8357 0.225
NP_441494.1_6 Reverse -154 -167 6.31247 0.289
NP_442993.1_1 Forward -93 -77 10.8749 0.0164
NP_442993.1_1 Forward -190 -174 -12.1345 0.266
NP_440677.1_1 Forward -199 -180 6.68596 0.258
NP_442386.1_9 Reverse -83 -92 15.7322 0.0144
NP_442386.1_9 Forward -304 -295 9.34074 0.166
NP_442386.1_9 Forward -240 -231 7.47246 0.219
NP_442386.1_9 Forward -94 -85 6.39082 0.219
NP_440570.1_5 Forward -103 -84 2.16274 0.234
NP_441291.1_3 Reverse -359 -378 17.2074 0.173
NP_441340.1_5 Forward -92 -85 15.6737 0.0124
NP_441340.1_5 Reverse -85 -92 15.6737 0.0124
NP_441947.1_4 Reverse -73 -92 14.8474 0.164
NP_441947.1_10 Reverse -82 -100 -0.865831 0.284
NP_442484.1_2 Reverse -215 -234 -1.27885 0.288
NP_440168.1_10 Forward -223 -204 14.5524 0.298
NP_440327.1_6 Reverse -346 -365 3.34271 0.285
NP_440161.1_3 Forward -95 -76 7.27595 0.299
NP_440586.1_8 Forward -92 -85 13.2151 0.026
NP_440586.1_8 Reverse -85 -92 13.2151 0.026
NP_440586.1_8 Forward -167 -160 7.70858 0.227
NP_440586.1_9 Forward -233 -214 4.916 0.288
NP_442251.1_6 Forward -92 -85 15.2804 0.0124
NP_442251.1_6 Reverse -85 -92 15.2804 0.0124
NP_442959.1_7 Forward -176 -157 -4.81876 0.289
NP_441262.1_3 Reverse -84 -91 14.7888 0.0223
NP_441262.1_3 Forward -93 -86 14.7888 0.0223
NP_443051.1_1 Forward -94 -85 18.0926 0.00402
NP_443051.1_1 Reverse -83 -92 10.4228 0.00754
NP_439937.1_9 Reverse -83 -100 1.11978 0.0948
NP_439937.1_9 Forward -94 -77 -7.13998 0.157
NP_439937.1_9 Forward -239 -222 -13.0398 0.279
NP_441595.1_5 Forward -100 -82 4.83737 0.274
NP_440439.1_1 Reverse -81 -94 10.344 0.0369
NP_440439.1_1 Forward -96 -83 8.67241 0.0513
NP_440372.1_2 Forward -92 -85 16.3621 0.0124
NP_440372.1_2 Reverse -85 -92 16.3621 0.0124
NP_440171.1_3 Forward -380 -361 1.47442 0.294
NP_441181.1_6 Forward -198 -180 5.62401 0.221
NP_441803.1_2 Forward -246 -227 2.3594 0.213
NP_439977.1_5 Reverse -78 -97 6.19431 0.135
NP_440139.1_1 Reverse -78 -97 10.7167 0.0897
NP_440267.1_2 Reverse -256 -270 13.6669 0.125
NP_442384.1_10 Reverse -84 -97 11.9173 0.0319
NP_442384.1_10 Forward -324 -311 1.19926 0.267
NP_441604.1_4 Forward -101 -82 -6.68705 0.293
NP_441018.1_7 Reverse -149 -168 12.5858 0.157
NP_442262.1_10 Forward -92 -85 14.1988 0.0123
NP_442262.1_10 Reverse -85 -92 14.1988 0.0123
NP_441689.1_5 Reverse -82 -92 8.53436 0.132
NP_440163.1_10 Reverse -81 -91 15.2213 0.0762
NP_440344.1_10 Reverse -77 -94 10.4619 0.00708
NP_440344.1_10 Forward -100 -83 5.54538 0.0204
NP_440344.1_10 Reverse -222 -239 -5.07437 0.104
NP_440487.1_1 Forward -340 -321 -7.37537 0.296
NP_441335.1_8 Reverse -47 -66 10.5209 0.204
NP_441640.1_8 Reverse -85 -104 -5.80207 0.289
NP_440297.1_1 Reverse -150 -169 15.4374 0.134
NP_440297.1_9 Reverse -85 -95 9.51814 0.0917
NP_440297.1_9 Forward -92 -82 9.32148 0.0917
NP_442187.1_3 Forward -251 -241 13.1564 0.275
NP_441896.1_3 Reverse -75 -94 -3.04881 0.294
NP_440894.1_10 Forward -98 -79 3.24438 0.276
NP_440937.1_5 Forward -254 -235 8.45592 0.286
NP_442067.1_4 Forward -393 -374 5.80098 0.231
NP_440999.1_9 Reverse -177 -191 6.09611 0.102
NP_440999.1_9 Forward -97 -83 3.93283 0.12
NP_440999.1_9 Reverse -80 -94 2.35953 0.151
NP_440888.1_2 Forward -93 -79 15.5352 0.0102
NP_440888.1_2 Reverse -84 -98 9.14375 0.137
NP_440888.1_2 Forward -366 -352 6.39049 0.236
NP_442147.1_3 Reverse -88 -107 20.059 0.144
NP_439969.1_3 Forward -98 -79 0.491109 0.266
NP_442033.1_10 Reverse -82 -101 -5.60541 0.179
NP_442033.1_10 Reverse -365 -384 -6.68705 0.186
NP_442033.1_10 Forward -250 -231 -12.4886 0.271
NP_441543.1_2 Forward -92 -83 18.486 0.00236
NP_441543.1_2 Reverse -85 -94 9.34117 0.0818
NP_442845.1_2 Reverse -351 -365 4.03116 0.271
NP_442845.1_4 Forward -95 -76 7.96426 0.189
NP_440380.1_1 Reverse -211 -230 -10.7186 0.284
NP_441469.1_8 Reverse -83 -92 16.126 0.00797
NP_441469.1_8 Forward -94 -85 13.3727 0.073
NP_443064.1_6 Reverse -84 -94 13.8273 0.0796
NP_442337.1_8 Reverse -304 -323 -2.26216 0.297
NP_442578.1_7 Forward -92 -85 14.5921 0.026
NP_442578.1_7 Reverse -85 -92 14.5921 0.026
NP_440220.1_4 Forward -32 -13 2.85027 0.227
NP_441462.1_2 Reverse -84 -94 20.1379 0.000967
NP_441462.1_2 Forward -93 -83 11.5831 0.00406
NP_441462.1_2 Forward -162 -152 -0.609952 0.24
NP_441462.1_5 Reverse -15 -34 3.44104 0.285
NP_441621.1_7 Reverse -82 -96 6.48943 0.068
NP_441621.1_7 Forward -95 -81 4.42448 0.0934
NP_443062.1_1 Forward -93 -75 11.5686 0.0962
NP_443062.1_1 Reverse -84 -102 6.10824 0.209
NP_443062.1_6 Forward -101 -82 6.78429 0.18
NP_443062.1_6 Reverse -76 -95 4.62101 0.216
NP_440349.1_4 Forward -257 -238 21.7306 0.0478
NP_442204.1_1 Forward -97 -86 2.51695 0.266
NP_441560.1_8 Forward -98 -79 20.5698 0.0072
NP_440504.1_3 Reverse -95 -114 9.83255 0.285
NP_440504.1_7 Forward -330 -311 -3.73712 0.249
NP_441351.1_8 Forward -192 -173 5.40766 0.202
NP_441351.1_8 Forward -132 -113 0.786102 0.285
NP_440516.1_8 Forward -93 -84 16.9127 0.00442
NP_440516.1_8 Reverse -84 -93 16.9127 0.00442
NP_441785.1_1 Forward -93 -79 11.3809 0.3
NP_442428.1_4 Reverse -83 -102 13.9625 0.118
NP_442428.1_5 Forward -92 -85 15.8704 0.0124
NP_442428.1_5 Reverse -85 -92 15.8704 0.0124
NP_442428.1_5 Forward -167 -160 4.36568 0.271
NP_440783.1_2 Forward -164 -145 -2.16383 0.175
NP_441443.1_7 Forward -202 -183 10.0292 0.11
NP_442120.1_10 Reverse -78 -97 -15.8318 0.296
NP_440673.1_3 Reverse -161 -168 13.2155 0.0426
NP_440673.1_3 Forward -91 -84 12.4288 0.0426
NP_440673.1_3 Reverse -86 -93 12.4288 0.0426
NP_440673.1_7 Forward -233 -214 0.392778 0.269
NP_440865.1_9 Reverse -78 -97 10.2259 0.0497
NP_441052.1_2 Forward -93 -83 10.5014 0.0285
NP_441052.1_2 Reverse -84 -94 10.4031 0.0285
NP_441052.1_2 Forward -303 -293 -0.511621 0.282
NP_442219.1_8 Forward -134 -115 12.3223 0.158
NP_442219.1_8 Reverse -155 -174 8.36037 0.249
NP_442219.1_9 Forward -92 -83 8.35786 0.0681
NP_442219.1_9 Reverse -85 -94 8.25953 0.0681
NP_440436.1_4 Forward -92 -83 18.1905 0.00233
NP_440436.1_4 Reverse -85 -94 15.9289 0.00508
NP_440436.1_4 Reverse -160 -169 9.73406 0.0871
NP_440436.1_4 Forward -390 -381 8.06244 0.118
NP_441884.1_9 Forward -222 -203 -11.8003 0.129
NP_441884.1_9 Reverse -81 -100 -12.7836 0.138
NP_441884.1_9 Reverse -214 -233 -19.6667 0.155
NP_441884.1_9 Reverse -178 -197 -25.8616 0.29
NP_442086.1_3 Forward -92 -73 6.29264 0.288
NP_440648.1_1 Reverse -84 -103 6.98095 0.19
NP_442907.1_2 Reverse -85 -103 7.78729 0.282
NP_441719.1_4 Forward -92 -85 16.3621 0.0124
NP_441719.1_4 Reverse -85 -92 16.3621 0.0124
NP_441733.1_10 Forward -96 -83 16.9322 0.0382
NP_441733.1_10 Reverse -81 -94 8.47575 0.14
NP_441004.1_5 Forward -260 -246 10.0294 0.248
NP_442366.1_3 Reverse -83 -101 7.29564 0.0754
NP_442366.1_3 Forward -94 -76 -5.29072 0.286
NP_442366.1_5 Reverse -319 -329 10.1076 0.289
NP_441115.1_4 Reverse -83 -101 12.5064 0.102
NP_442694.1_4 Forward -264 -255 12.0944 0.268
NP_443054.1_2 Reverse -82 -96 10.3243 0.0761
NP_443054.1_2 Reverse -237 -251 7.66941 0.147
NP_443054.1_2 Forward -95 -81 5.21113 0.237
NP_441851.1_10 Forward -94 -84 17.4829 0.0027
NP_441851.1_10 Reverse -83 -93 16.008 0.00552
NP_442622.1_5 Forward -95 -76 -3.93378 0.187
NP_442856.1_7 Reverse -172 -191 -5.99873 0.291
NP_441668.1_4 Reverse -286 -305 -0.000545616 0.248
NP_442515.1_1 Forward -94 -80 2.65453 0.131
NP_442515.1_1 Reverse -83 -97 -1.47537 0.255
NP_440593.1_3 Forward -173 -154 4.52268 0.133
NP_440940.1_7 Forward -103 -85 13.3914 0.0831
NP_440940.1_7 Forward -319 -301 5.32826 0.226
NP_441409.1_6 Forward -99 -80 1.57275 0.0595
NP_441409.1_6 Reverse -78 -97 -14.2585 0.253
NP_442314.1_4 Reverse -217 -235 21.357 0.0273
NP_440432.1_9 Reverse -85 -100 0.27489 0.159
NP_440432.1_9 Forward -92 -77 -1.49507 0.167
NP_440432.1_9 Forward -365 -350 -5.03498 0.233
NP_440474.1_8 Forward -92 -78 13.4703 0.0696
NP_440474.1_8 Reverse -191 -205 7.66879 0.202
NP_440726.1_2 Forward -103 -84 0.294447 0.288
NP_442450.1_5 Forward -95 -85 10.1081 0.115
NP_442450.1_5 Reverse -82 -92 9.32148 0.115
NP_440588.1_2 Forward -102 -83 -1.18052 0.155
NP_441031.1_10 Forward -294 -275 16.1741 0.224
NP_442006.1_2 Reverse -90 -107 -6.451 0.164
NP_442006.1_2 Forward -199 -182 -14.8091 0.21
NP_441570.1_1 Forward -93 -75 -8.04399 0.101
NP_441570.1_1 Forward -204 -186 -11.3872 0.194
NP_441570.1_1 Reverse -84 -102 -17.4838 0.278
NP_441078.1_4 Forward -93 -84 19.6659 0.0007
NP_441078.1_4 Reverse -84 -93 19.6659 0.0007
NP_441078.1_4 Forward -190 -181 -1.77023 0.266
NP_442729.1_5 Forward -169 -159 15.713 0.199
NP_442729.1_8 Forward -97 -84 8.9674 0.125
NP_442443.1_1 Forward -255 -236 0.491109 0.218
NP_442443.1_1 Forward -383 -364 -2.45882 0.256
NP_442443.1_1 Forward -381 -362 -4.6221 0.275
NP_441094.1_6 Reverse -77 -94 12.2311 0.253
NP_440526.1_3 Reverse -85 -96 18.446 0.0306
NP_440526.1_3 Forward -302 -291 6.35136 0.205
NP_440526.1_3 Forward -92 -81 1.92649 0.267
NP_441432.1_8 Forward -94 -85 8.35786 0.0755
NP_441432.1_8 Reverse -83 -92 8.25953 0.0755
NP_442320.1_8 Reverse -78 -92 15.4376 0.0102
NP_441732.1_2 Forward -97 -81 -15.9694 0.164
NP_441732.1_2 Reverse -80 -96 -16.2644 0.165
NP_441732.1_2 Reverse -149 -165 -17.2477 0.247
NP_442815.1_2 Reverse -227 -245 4.34571 0.243
NP_440760.1_1 Reverse -84 -103 -4.03212 0.0386
NP_440760.1_1 Forward -68 -49 -5.01543 0.0475
NP_440199.1_10 Reverse -81 -91 14.533 0.0861
NP_441057.1_3 Reverse -307 -326 -10.9153 0.214
NP_442353.1_4 Reverse -147 -166 0.981987 0.259
NP_443011.1_4 Reverse -299 -318 9.83255 0.216
NP_440713.1_4 Forward -103 -84 4.12936 0.231
NP_442489.1_7 Forward -93 -84 20.1576 0.000695
NP_442489.1_7 Reverse -84 -93 20.1576 0.000695
NP_442489.1_7 Forward -190 -181 -1.27858 0.185
NP_442489.1_7 Reverse -181 -190 -2.06522 0.288
NP_442079.1_7 Forward -92 -73 7.27595 0.142
NP_440559.1_1 Reverse -85 -94 17.306 0.00658
NP_440559.1_1 Forward -92 -83 8.75118 0.0586
NP_440559.1_1 Reverse -160 -169 4.62128 0.24
NP_441659.2_8 Reverse -84 -94 19.3512 0.000966
NP_441659.2_8 Forward -93 -83 11.9764 0.0147
NP_441659.2_8 Reverse -181 -191 3.51995 0.157
NP_442913.1_10 Forward -102 -83 1.57275 0.141
NP_442008.1_2 Forward -392 -373 3.14605 0.262
NP_440779.1_5 Reverse -84 -101 -13.0392 0.21
NP_442346.1_5 Forward -94 -84 17.9746 0.00128
NP_442346.1_5 Reverse -83 -93 9.02648 0.118
NP_440545.1_3 Forward -97 -80 6.33202 0.0564
NP_440545.1_3 Reverse -80 -97 0.137172 0.144
NP_441856.1_3 Reverse -81 -100 6.29264 0.118
NP_440831.1_3 Reverse -201 -220 10.9498 0.166
NP_440010.1_10 Reverse -297 -316 2.65439 0.275
NP_440010.1_10 Reverse -361 -380 1.86774 0.292
NP_442551.1_4 Forward -186 -171 -3.36336 0.287
NP_440847.1_3 Forward -296 -282 12.782 0.234
NP_442603.1_7 Reverse -84 -98 17.6002 0.0211
NP_443022.1_3 Forward -389 -370 15.3391 0.188
NP_441948.1_4 Reverse -77 -95 7.19731 0.0626
NP_441948.1_4 Reverse -223 -241 -5.48739 0.268
NP_441833.1_4 Forward -92 -85 15.9687 0.0124
NP_441833.1_4 Reverse -85 -92 15.9687 0.0124
NP_442799.1_8 Reverse -288 -307 9.4509 0.22
NP_442162.1_9 Forward -92 -85 16.2637 0.0124
NP_442162.1_9 Reverse -85 -92 16.2637 0.0124
NP_440671.1_4 Reverse -78 -92 14.5526 0.0587
NP_440671.1_4 Reverse -288 -302 5.50613 0.281
NP_442140.1_3 Reverse -85 -95 14.828 0.0433
NP_442140.1_3 Forward -167 -157 14.1397 0.0501
NP_442140.1_3 Forward -92 -82 8.33817 0.119
NP_442723.1_1 Reverse -367 -386 1.47364 0.298
NP_440875.1_9 Reverse -86 -96 9.24806 0.233
NP_440875.1_9 Forward -91 -81 8.37203 0.233
NP_441813.1_5 Reverse -82 -92 17.188 0.00979
NP_441813.1_5 Forward -95 -85 8.92815 0.0347
NP_440590.1_4 Reverse -85 -98 6.4108 0.0575
NP_440590.1_4 Forward -92 -79 5.23083 0.0585
NP_440590.1_4 Reverse -160 -173 -3.32397 0.255
NP_440567.1_1 Reverse -85 -99 8.45605 0.0577
NP_440567.1_1 Forward -92 -78 1.17956 0.214
NP_440567.1_1 Forward -167 -153 -0.295402 0.276
NP_442497.1_10 Reverse -85 -94 19.8626 0.00532
NP_442497.1_10 Forward -92 -83 10.4228 0.0087
NP_440821.1_4 Forward -95 -85 19.5479 0.00399
NP_440821.1_4 Reverse -82 -92 19.0562 0.00399
NP_440821.1_4 Reverse -292 -302 4.69992 0.126
NP_441239.1_9 Forward -95 -83 17.0502 0.0153
NP_441239.1_9 Reverse -82 -94 16.8536 0.0155
NP_441951.1_4 Reverse -153 -172 1.17943 0.287
NP_441009.1_4 Reverse -84 -103 24.2872 0.00457
NP_441892.1_1 Forward -102 -85 1.21881 0.155
NP_441892.1_1 Forward -177 -160 -0.354483 0.182
NP_441892.1_1 Reverse -150 -167 -3.5994 0.244
NP_440604.1_6 Reverse -84 -103 3.83436 0.131
NP_442325.1_6 Forward -301 -282 5.89931 0.254
NP_442193.1_1 Forward -205 -187 13.4905 0.215
NP_442270.1_9 Reverse -179 -198 -11.0136 0.266
NP_442643.1_1 Reverse -78 -97 -11.1119 0.231
NP_441017.1_6 Reverse -80 -94 12.9786 0.209
NP_440949.1_7 Forward -311 -292 14.3549 0.192
NP_440354.1_7 Forward -99 -81 7.59063 0.26
NP_442138.1_10 Forward -93 -74 2.85105 0.115
NP_442809.1_1 Forward -364 -345 9.93006 0.295
NP_440546.1_4 Reverse -84 -94 12.8578 0.0572
NP_440546.1_4 Forward -168 -158 12.1791 0.0679
NP_440546.1_4 Reverse -357 -367 11.8882 0.0679
NP_440546.1_4 Forward -93 -83 11.8882 0.0679
NP_440462.1_6 Reverse -82 -92 15.418 0.0142
NP_440462.1_6 Forward -95 -85 10.4031 0.0396
NP_442465.1_1 Reverse -131 -150 1.47442 0.229
NP_442611.1_1 Forward -204 -185 1.57275 0.236
NP_440868.1_4 Reverse -80 -92 8.49544 0.0602
NP_440868.1_4 Forward -97 -85 0.727295 0.201
NP_442039.1_4 Forward -92 -85 15.1821 0.0124
NP_442039.1_4 Reverse -85 -92 15.1821 0.0124
NP_441811.1_8 Reverse -153 -167 7.76774 0.241
NP_441811.1_8 Forward -99 -85 6.78443 0.263
NP_441926.1_3 Forward -303 -287 2.51681 0.269
NP_440825.1_6 Reverse -286 -305 13.9625 0.242
NP_440825.1_6 Forward -273 -254 9.3409 0.285
NP_442837.1_3 Forward -92 -85 15.7721 0.0124
NP_442837.1_3 Reverse -85 -92 15.7721 0.0124
NP_439994.1_3 Reverse -83 -102 10.1945 0.222
NP_442053.1_1 Forward -93 -84 18.3876 0.0007
NP_442053.1_1 Reverse -84 -93 18.3876 0.0007
NP_440505.1_3 Reverse -82 -92 13.8447 0.0247
NP_440505.1_3 Forward -95 -85 7.84651 0.147
NP_440505.1_3 Reverse -170 -180 5.97822 0.202
NP_441203.1_1 Reverse -85 -104 -20.2567 0.297
NP_440914.1_1 Forward -303 -293 10.2742 0.147
NP_440914.1_1 Forward -93 -83 8.6151 0.186
NP_440914.1_1 Reverse -84 -94 8.51751 0.186
NP_441011.1_8 Forward -92 -83 16.9127 0.00602
NP_441011.1_8 Reverse -85 -94 14.356 0.0249
NP_442101.1_10 Reverse -187 -206 -5.01543 0.158
NP_442533.1_6 Forward -93 -84 17.2076 0.00137
NP_442533.1_6 Reverse -84 -93 17.2076 0.00137
NP_442533.1_6 Reverse -153 -162 9.34117 0.0634
NP_442533.1_6 Forward -190 -181 3.83464 0.202
NP_442533.1_6 Forward -366 -357 1.96635 0.28
NP_442541.1_10 Forward -298 -284 2.35894 0.262
NP_442541.1_10 Forward -324 -310 0.785655 0.298
NP_442232.1_3 Forward -101 -82 -13.1769 0.282
NP_441326.1_2 Reverse -217 -236 8.06259 0.288
NP_441482.1_7 Forward -99 -85 0.982901 0.0554
NP_439944.1_9 Reverse -85 -95 17.4829 0.00423
NP_439944.1_9 Forward -92 -82 10.3048 0.0887
NP_440116.1_8 Reverse -85 -104 -5.21209 0.188
NP_440115.1_6 Forward -96 -86 19.2529 0.0106
NP_439965.1_1 Reverse -75 -94 -5.99873 0.211
NP_441680.1_4 Forward -240 -221 2.0644 0.246
NP_441961.1_4 Forward -256 -237 3.6377 0.277
NP_441972.1_5 Reverse -85 -104 -2.85214 0.192
NP_441106.1_1 Reverse -83 -92 18.191 0.0028
NP_441106.1_1 Forward -94 -85 9.73449 0.0311
NP_442306.1_10 Reverse -234 -253 -11.1119 0.119
NP_441286.1_1 Reverse -83 -95 14.6903 0.00418
NP_441286.1_1 Forward -94 -82 5.05386 0.0259
NP_441286.1_1 Forward -169 -157 1.80894 0.0791
NP_441286.1_1 Reverse -293 -305 -0.452677 0.133
NP_440670.1_8 Forward -93 -84 18.3876 0.000699
NP_440670.1_8 Reverse -84 -93 18.3876 0.000699
NP_440886.1_7 Reverse -83 -93 17.7774 0.0011
NP_440886.1_7 Forward -94 -84 8.04271 0.0805
NP_440886.1_7 Reverse -180 -190 7.15773 0.103
NP_440886.1_7 Reverse -246 -256 5.87944 0.158
NP_440886.1_7 Forward -156 -146 3.91283 0.26
NP_440828.1_4 Reverse -194 -213 -8.35941 0.296
NP_442614.1_2 Reverse -84 -98 9.63603 0.242
NP_441399.1_6 Forward -330 -311 10.9134 0.295
NP_442072.1_9 Reverse -83 -101 -21.5153 0.209
NP_442072.1_9 Forward -94 -76 -21.6137 0.211
NP_442213.1_5 Forward -197 -178 0.392778 0.272
NP_440907.2_8 Reverse -85 -95 19.449 0.00351
NP_440907.2_8 Forward -92 -82 7.84605 0.117
NP_441021.1_1 Reverse -85 -104 -0.688862 0.104
NP_441463.1_3 Reverse -74 -93 -8.752 0.273
NP_441463.1_6 Reverse -82 -96 10.3779 0.242
NP_441626.1_2 Forward -92 -85 15.7721 0.0124
NP_441626.1_2 Reverse -85 -92 15.7721 0.0124
NP_441988.1_10 Forward -173 -161 16.2636 0.278
NP_442365.1_7 Forward -307 -288 -4.6221 0.248
NP_442794.1_1 Forward -97 -85 3.57889 0.286
NP_442615.1_1 Forward -102 -84 -1.65248 0.131
NP_442615.1_1 Reverse -75 -93 -4.60241 0.19
NP_441962.1_4 Reverse -176 -195 -9.14533 0.213
NP_441962.1_4 Forward -98 -79 -10.227 0.224
NP_440387.1_1 Reverse -84 -100 6.74504 0.0282
NP_441431.1_2 Forward -96 -82 9.73373 0.18
NP_441431.1_2 Reverse -81 -95 6.68548 0.263
NP_441431.1_2 Reverse -156 -170 6.29216 0.275
NP_441431.1_3 Forward -262 -243 3.04771 0.275
NP_442647.1_7 Reverse -185 -198 6.60746 0.257
NP_441993.1_1 Reverse -153 -172 0.484826 0.298
NP_440114.1_5 Forward -233 -214 21.4356 0.0247
NP_440114.1_10 Forward -93 -79 14.1593 0.0429
NP_440114.1_10 Reverse -357 -371 8.55439 0.2
NP_442323.1_7 Reverse -190 -209 2.85027 0.258
NP_441510.2_2 Reverse -80 -99 1.6703 0.296
NP_441510.2_7 Forward -309 -295 10.717 0.28
NP_440766.1_4 Forward -97 -83 17.6992 0.0255
NP_440766.1_4 Reverse -80 -94 5.80112 0.109
NP_439988.1_7 Reverse -83 -97 15.5352 0.292
NP_441237.1_3 Reverse -225 -244 18.9474 0.178
NP_441237.1_9 Reverse -85 -95 17.2863 0.00348
NP_439910.1_2 Reverse -76 -93 6.62702 0.0086
NP_442867.1_8 Forward -364 -345 7.66927 0.242
NP_440457.1_1 Forward -97 -85 16.4603 0.0486
NP_440457.1_1 Reverse -80 -92 0.0389777 0.25
NP_440457.1_1 Forward -381 -369 -0.452677 0.263
NP_440798.1_6 Reverse -85 -98 0.805932 0.248
NP_440801.1_10 Reverse -226 -245 3.83436 0.297
NP_440473.1_9 Reverse -346 -365 -9.34199 0.26
NP_442509.1_9 Reverse -84 -94 17.3841 0.00128
NP_442509.1_9 Forward -93 -83 16.2041 0.00739
NP_442509.1_9 Forward -239 -229 8.23937 0.192
NP_442509.1_9 Forward -68 -58 7.0594 0.24
NP_442509.1_9 Forward -51 -41 6.0761 0.293
NP_440524.1_8 Forward -384 -370 22.3207 0.0761
YP_003858595.1_8 Forward -210 -191 11.0125 0.136
NP_440554.1_4 Forward -92 -82 14.6313 0.02
NP_440554.1_4 Reverse -85 -95 6.27322 0.123
NP_441885.1_5 Forward -93 -83 11.4848 0.00668
NP_441885.1_5 Reverse -84 -94 11.3864 0.00668
NP_442341.1_7 Reverse -83 -97 17.1092 0.0138
NP_442341.1_7 Reverse -180 -194 7.76774 0.0994
NP_442341.1_7 Forward -94 -80 7.76774 0.0994
NP_442341.1_7 Forward -220 -206 2.06454 0.271
NP_442341.1_7 Reverse -246 -260 1.08123 0.299
NP_442341.1_9 Reverse -151 -165 8.94708 0.162
NP_442341.1_9 Reverse -82 -96 8.45543 0.17
NP_441756.1_5 Forward -97 -78 -4.81876 0.296
NP_442395.2_4 Reverse -83 -102 3.04693 0.212
NP_440750.1_8 Forward -347 -329 13.6864 0.237
NP_443000.1_7 Reverse -82 -92 8.73149 0.0437
NP_443000.1_7 Forward -95 -85 2.14332 0.226
NP_440507.2_3 Forward -102 -83 10.2251 0.208
NP_440507.2_3 Forward -257 -238 7.86512 0.268
NP_443059.1_10 Forward -317 -298 8.75009 0.194
NP_441842.1_10 Forward -175 -161 13.1759 0.0809
NP_440275.1_3 Forward -95 -85 19.5479 0.00756
NP_440275.1_3 Reverse -82 -92 8.4365 0.0602
NP_440091.1_1 Reverse -80 -92 18.3285 0.0114
NP_443010.1_10 Reverse -81 -98 7.31258 0.175
NP_442451.1_2 Reverse -76 -95 1.27776 0.146
NP_442451.1_2 Reverse -202 -221 -8.94866 0.258
NP_439962.1_4 Reverse -365 -384 -6.68705 0.283
NP_439962.1_4 Forward -221 -202 -7.76869 0.29
NP_441105.1_3 Reverse -148 -167 -5.9004 0.225
NP_442373.1_1 Forward -333 -314 -1.67217 0.183
NP_440216.1_1 Forward -93 -79 6.3911 0.0156
NP_440216.1_1 Reverse -84 -98 -2.16369 0.0482
NP_440172.1_1 Reverse -84 -94 16.303 0.00854
NP_440172.1_1 Forward -93 -83 8.73149 0.0586
NP_442015.1_10 Forward -97 -84 13.0973 0.0365
NP_442015.1_10 Reverse -80 -93 0.904263 0.216
NP_441226.1_7 Forward -92 -85 14.4934 0.0123
NP_441226.1_7 Reverse -85 -92 14.4934 0.0123
NP_441226.1_7 Forward -365 -358 8.29857 0.205
NP_440198.1_3 Reverse -367 -386 14.4533 0.277
NP_441111.1_7 Forward -92 -84 18.7023 0.00294
NP_441111.1_7 Reverse -85 -93 18.7023 0.00294
NP_441766.1_2 Forward -93 -84 17.5026 0.00297
NP_441766.1_2 Reverse -84 -93 17.5026 0.00297
NP_443052.1_8 Reverse -74 -93 -0.983855 0.0754
NP_442154.1_1 Forward -198 -180 -6.1757 0.132
NP_442154.1_1 Forward -264 -246 -18.3687 0.281
NP_440261.1_5 Reverse -85 -98 16.2439 0.0122
NP_440261.1_5 Reverse -196 -209 -11.2888 0.255
NP_440261.1_5 Forward -92 -79 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATTCAAAATACCCTCGCTGCGGGGGGAACAGTGCCCCATCCCTACATTGGGGTGCAAATGATGAATATCACGGTGGACCAAGCCCAGCAGAATAATCGCAATCCCAATTCTCCCTTTATCATTCCTGAAGTGGATGGCATTTTGGTGATGCGGGTCTTGCCCGGAACCCCCGCTGAAAGGGCCGGTATCCGTCGGGGAGATGTCATTGTGGCGGTGGACGGTACTCCCATTAGCGATGGTGCCCGCCTACAGCGCATAGTAGAACAAGCCGGTTTGAACAAAGCTCTCAAACTCGACCTACTCCGGGGCGATCGCCGTTTAAGCCTAACCGTACAAACGGCCCAACTTCGTAATCCCACCAGTTAAGTTTCCCGTACCTCACCCATCCAAACTTTAACC

CDS

ATGAAAAGACGTTACCTTTTAGAAGTGGGCACCGCCTCCTTGGGAGCTTTCTGGCTGGCTCAATATGTAAATTCAACCAACCAATCCCAACCCCAACTTAAATCCGAACTAGAACCTCAAATCATGCCTAAAACAAACGAAGTTTTTGAAGTCACCAAAACCGATGCAGAATGGCAACAGCAACTAAGTCCAGAGGCCTATAAAGTACTCCGCAAACATGGCACGGAAAGAGCTGGTACTAGCCCCCTGGACAAAAACTATGATTTAGGTACTTACGAATGTGCTGGTTGCGAGCTTCCCTTATTTTCTTCCGAAACCAAGTTTAATTCCGGCACCGGCTGGCCTAGTTTCTATGCTCCCTTGGAAAATGCTGTGGCTTACACTGTCGATAAATCCTTTTTCATGACTCGCACTGAAGTTCATTGCGCCCGTTGTGGCGGCCATTTAGGTCACGTTTTTGATGATGGTCCCCAGCCCACCGGTAAACGCTATTGCATGAACGGTGTTTCCCTCAAGTTTGTCGGCGCTTAG

Protein

MKRRYLLEVGTASLGAFWLAQYVNSTNQSQPQLKSELEPQIMPKTNEVFEVTKTDAEWQQQLSPEAYKVLRKHGTERAGTSPLDKNYDLGTYECAGCELPLFSSETKFNSGTGWPSFYAPLENAVAYTVDKSFFMTRTEVHCARCGGHLGHVFDDGPQPTGKRYCMNGVSLKFVGA