Your browser is old and dusty. Try Google Chrome!

Details for sll1675

ORF sll1675
Accession NP_440121.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -331 -312 -20.2567 0.108
NP_441418.1_6 Reverse -211 -230 -29.5982 0.23
NP_441418.1_6 Reverse -223 -242 -30.5815 0.286
NP_441480.1_2 Reverse -44 -63 8.35759 0.299
NP_440897.1_6 Forward -220 -201 -0.886293 0.187
NP_441453.1_7 Reverse -260 -267 11.9372 0.298
NP_441818.1_6 Forward -380 -366 8.75105 0.274
NP_441818.1_9 Reverse -221 -240 -2.36049 0.203
NP_440150.1_6 Forward -394 -375 1.37609 0.293
NP_001035873.1_1 Reverse -92 -111 14.8072 0.295
NP_442861.1_1 Reverse -58 -77 15.6341 0.227
NP_441054.1_2 Forward -155 -136 11.8975 0.254
NP_440916.1_1 Reverse -196 -210 14.1593 0.206
NP_442110.1_1 Forward -129 -110 16.712 0.229
NP_441925.1_4 Reverse -303 -322 -16.6192 0.284
NP_440856.1_7 Forward -391 -372 -5.21209 0.226
NP_441083.1_5 Forward -63 -53 0.963343 0.218
NP_441434.1_3 Forward -252 -233 0.0977854 0.222
NP_441434.1_7 Reverse -48 -62 2.75286 0.27
NP_441955.1_8 Reverse -367 -384 5.84037 0.287
NP_442889.1_8 Forward -58 -44 5.50552 0.226
NP_440178.1_7 Reverse -223 -242 -22.8133 0.279
NP_441716.1_1 Forward -274 -260 3.34284 0.268
NP_441163.1_1 Reverse -216 -233 13.7061 0.183
NP_441533.1_2 Reverse -258 -277 17.3057 0.171
NP_440747.1_10 Reverse -262 -274 -12.4491 0.282
NP_442848.1_4 Forward -196 -182 9.43936 0.282
NP_443018.1_3 Forward -381 -374 9.38056 0.128
NP_442687.1_7 Forward -234 -224 3.61828 0.299
NP_441846.1_10 Reverse -332 -351 -22.0267 0.257
NP_441846.1_10 Forward -96 -77 -23.305 0.282
NP_441029.1_3 Forward -336 -317 13.2741 0.277
NP_441950.1_7 Reverse -46 -65 -8.16202 0.287
NP_442658.1_1 Reverse -222 -232 9.22267 0.165
NP_442658.1_1 Forward -107 -97 6.96107 0.214
NP_440141.1_8 Reverse -151 -170 5.89931 0.271
NP_440141.1_8 Reverse -205 -224 3.93269 0.296
NP_442782.1_2 Forward -160 -146 5.50613 0.242
NP_442496.1_5 Forward -100 -82 4.6407 0.289
NP_442205.1_9 Reverse -5 -21 1.14018 0.255
NP_441487.1_9 Reverse -345 -364 -0.197208 0.25
NP_442937.1_5 Forward -32 -13 8.84924 0.209
NP_442321.1_4 Forward -308 -289 -8.94866 0.292
NP_441127.1_1 Reverse -53 -67 9.14437 0.278
NP_439905.1_1 Reverse -374 -387 7.78743 0.244
NP_443001.1_6 Reverse -161 -180 18.584 0.152
NP_440984.1_7 Reverse -219 -233 6.78443 0.2
NP_440993.1_3 Forward -284 -265 11.0117 0.0979
NP_440388.1_7 Forward -328 -309 -0.4922 0.252
NP_441129.1_3 Reverse -147 -166 -10.3253 0.281
NP_441099.1_5 Reverse -255 -274 -11.7019 0.288
NP_442431.1_10 Reverse -218 -236 1.00246 0.262
NP_442431.1_10 Forward -322 -304 0.314141 0.278
NP_442885.1_5 Forward -284 -265 13.47 0.279
NP_441674.1_10 Forward -391 -373 2.28076 0.259
NP_440147.1_4 Reverse -263 -276 0.904263 0.244
NP_441041.1_4 Forward -274 -255 -13.9635 0.299
NP_441041.1_7 Reverse -50 -62 5.27969 0.265
NP_441725.1_4 Reverse -118 -132 5.89884 0.278
NP_441678.1_9 Forward -206 -187 -5.31042 0.297
NP_001035871.2_2 Forward -131 -112 15.1509 0.296
NP_440437.1_1 Forward -239 -220 -3.3438 0.234
NP_442215.1_2 Reverse -143 -159 -6.82463 0.28
NP_442029.1_6 Reverse -323 -342 6.19431 0.242
NP_442933.1_10 Forward -27 -18 7.86621 0.103
NP_442926.1_5 Forward -21 -2 8.61992 0.299
NP_442554.1_8 Reverse -374 -384 1.94665 0.288
NP_441762.1_7 Reverse -372 -384 -3.89426 0.14
NP_441525.1_1 Reverse -220 -233 17.6205 0.136
NP_441448.1_1 Forward -393 -374 3.83436 0.287
NP_441015.1_10 Reverse -334 -353 -4.52377 0.205
NP_441015.1_10 Reverse -209 -228 -10.7186 0.287
NP_441826.1_2 Forward -33 -19 0.786239 0.172
NP_441056.1_1 Forward -388 -369 -9.14533 0.291
NP_443058.1_7 Forward -162 -143 10.3242 0.206
NP_442808.1_1 Forward -343 -333 2.73286 0.256
NP_440918.1_2 Forward -393 -374 9.73422 0.282
NP_442542.1_2 Reverse -222 -235 6.60746 0.216
NP_440038.1_4 Forward -374 -355 -1.18052 0.296
NP_442576.1_2 Forward -372 -353 11.5042 0.242
NP_441048.1_4 Reverse -346 -365 16.4207 0.183
NP_442789.1_4 Reverse -377 -396 -3.83545 0.254
NP_442789.1_4 Reverse -347 -366 -5.60541 0.273
NP_442789.1_8 Forward -390 -371 17.6007 0.219
NP_440274.1_2 Reverse -98 -112 11.012 0.285
NP_441557.1_8 Forward -168 -158 10.796 0.275
NP_441445.1_1 Reverse -37 -56 2.94938 0.224
NP_441590.1_4 Reverse -136 -155 5.99684 0.26
NP_442777.1_1 Forward -168 -149 9.34008 0.194
NP_440276.1_8 Reverse -319 -338 10.4225 0.232
NP_442347.1_2 Forward -350 -341 4.91628 0.249
NP_442888.1_7 Forward -393 -374 12.3892 0.281
NP_441633.1_3 Reverse -263 -276 -1.94734 0.168
NP_441633.1_3 Forward -222 -209 -5.58558 0.236
NP_442998.1_5 Forward -207 -197 14.7297 0.149
NP_442998.1_5 Forward -251 -241 12.7631 0.159
NP_440731.1_9 Forward -90 -71 30.6787 0.0000514
NP_441799.1_9 Forward -342 -323 -4.6221 0.264
NP_442334.1_2 Reverse -4 -21 -7.82764 0.297
NP_442526.1_3 Forward -301 -282 21.1851 0.128
NP_441559.1_8 Forward -356 -342 2.06454 0.148
NP_441559.1_8 Forward -346 -332 -4.4253 0.223
NP_441559.1_8 Forward -225 -211 -5.50694 0.264
NP_441559.1_8 Reverse -260 -274 -5.60527 0.267
NP_441559.1_8 Forward -395 -381 -7.2769 0.289
NP_440915.1_6 Reverse -220 -234 -2.26202 0.265
NP_442158.1_4 Reverse -326 -336 12.3697 0.253
NP_442069.1_4 Reverse -362 -381 7.96426 0.245
NP_442069.1_7 Reverse -371 -390 10.4217 0.291
NP_441464.1_10 Reverse -44 -58 9.73436 0.262
NP_440787.1_5 Forward -71 -57 10.3243 0.256
NP_440695.1_6 Forward -298 -284 12.7383 0.26
NP_441939.1_3 Forward -232 -213 6.4893 0.235
NP_442386.1_9 Forward -343 -334 11.4057 0.0942
NP_442386.1_9 Forward -383 -374 10.324 0.132
NP_442186.1_9 Reverse -221 -240 3.73603 0.294
NP_442240.1_1 Forward -399 -380 6.68515 0.256
NP_442240.1_1 Reverse -215 -234 4.91521 0.266
NP_440161.1_3 Reverse -149 -168 12.6841 0.173
NP_440586.1_1 Reverse -219 -238 2.16274 0.227
NP_440586.1_8 Forward -54 -47 7.02027 0.279
NP_439937.1_8 Forward -143 -124 -1.18052 0.249
NP_439937.1_8 Reverse -377 -396 -4.22878 0.28
NP_439937.1_8 Reverse -218 -237 -4.42544 0.284
NP_439937.1_9 Forward -234 -217 -10.0899 0.221
NP_439937.1_9 Reverse -107 -124 -12.8431 0.276
NP_439937.1_9 Forward -354 -337 -12.8431 0.276
NP_440439.1_1 Reverse -339 -352 7.39411 0.0659
NP_440819.1_5 Forward -208 -200 7.98423 0.228
NP_440316.1_10 Reverse -372 -382 5.38824 0.299
NP_441803.1_2 Reverse -215 -234 0.982764 0.242
NP_442384.1_10 Forward -274 -261 4.24752 0.163
NP_441980.1_8 Reverse -9 -28 11.2092 0.227
NP_442262.1_10 Forward -381 -374 9.47889 0.187
NP_440487.1_1 Reverse -208 -227 -0.000545616 0.214
NP_442556.1_10 Reverse -46 -65 11.4091 0.229
NP_442280.1_10 Reverse -87 -105 6.03883 0.28
NP_441896.1_5 Forward -317 -310 15.3787 0.268
NP_441896.1_5 Forward -155 -148 15.3787 0.268
NP_440894.1_10 Forward -225 -206 6.29264 0.217
NP_440999.1_9 Forward -224 -210 -0.000409212 0.195
NP_440999.1_9 Forward -236 -222 -2.16369 0.261
NP_442033.1_8 Forward -357 -339 19.4887 0.175
NP_442033.1_10 Forward -354 -335 4.42435 0.083
NP_441469.1_4 Reverse -336 -355 15.6341 0.249
NP_440071.1_6 Reverse -340 -354 14.0957 0.25
NP_440148.1_1 Forward -73 -54 8.84924 0.186
NP_441621.1_7 Reverse -380 -394 1.76955 0.136
NP_441621.1_7 Reverse -209 -223 -3.83532 0.195
NP_443062.1_1 Forward -382 -364 9.32598 0.136
NP_440519.1_8 Reverse -208 -224 4.3851 0.227
NP_441351.1_8 Reverse -230 -249 0.982764 0.276
NP_442428.1_4 Forward -391 -372 2.94938 0.247
NP_442120.1_10 Reverse -346 -365 -12.5869 0.273
NP_442120.1_10 Forward -238 -219 -14.9469 0.289
NP_441884.1_9 Forward -223 -204 -22.42 0.278
NP_440121.1_1 Forward -390 -371 26.6471 0.00268
NP_440121.1_4 Forward -320 -303 19.3117 0.237
NP_440121.1_7 Forward -347 -328 18.0915 0.292
NP_441004.1_1 Reverse -208 -227 -14.3569 0.267
NP_441004.1_2 Forward -259 -240 -2.36049 0.264
NP_441004.1_3 Forward -325 -306 5.40766 0.224
NP_441004.1_4 Forward -189 -179 7.74818 0.289
NP_442813.1_4 Forward -225 -206 -9.24366 0.3
NP_440129.1_10 Forward -269 -255 5.70279 0.185
NP_442873.1_3 Forward -228 -209 6.58682 0.223
NP_442694.1_3 Forward -392 -374 5.03403 0.242
NP_442515.1_1 Forward -79 -65 -3.34366 0.29
NP_441396.1_5 Reverse -47 -56 8.35786 0.224
NP_441982.1_6 Reverse -285 -294 13.0583 0.274
NP_441046.1_2 Forward -75 -56 -0.590531 0.282
NP_441046.1_2 Forward -35 -16 -1.08219 0.288
NP_442006.1_2 Forward -331 -314 -7.23765 0.171
NP_442006.1_2 Forward -105 -88 -18.0541 0.287
NP_440707.1_7 Reverse -335 -354 3.04771 0.288
NP_442443.1_1 Reverse -206 -225 -2.65548 0.259
NP_442443.1_1 Reverse -336 -355 -2.85214 0.264
NP_440793.1_1 Reverse -93 -107 10.717 0.284
NP_441432.1_9 Reverse -58 -71 8.79228 0.287
NP_442797.1_7 Reverse -372 -390 4.34571 0.231
NP_442146.1_5 Forward -365 -346 17.699 0.148
NP_440578.1_7 Forward -365 -346 11.5033 0.198
NP_440565.1_7 Reverse -335 -354 6.98095 0.246
NP_441022.1_1 Reverse -194 -203 15.9587 0.163
NP_441022.1_1 Forward -73 -64 13.7524 0.188
NP_441040.1_2 Forward -399 -380 -15.1435 0.286
NP_442849.1_1 Forward -189 -175 8.45605 0.282
NP_442346.1_10 Forward -393 -374 -3.73712 0.296
NP_440352.1_7 Forward -14 -1 18.4065 0.194
NP_440010.1_10 Reverse -218 -237 2.65439 0.275
NP_442551.1_4 Forward -393 -378 -1.98672 0.252
NP_442603.1_7 Reverse -265 -279 5.89884 0.269
NP_441948.1_4 Reverse -326 -344 -4.11075 0.217
NP_441895.1_2 Forward -337 -318 -17.4051 0.224
NP_441895.1_10 Forward -111 -92 -18.3884 0.282
NP_440671.1_4 Reverse -382 -396 14.2576 0.0654
NP_442140.1_3 Forward -381 -371 10.3048 0.0902
NP_442140.1_3 Reverse -374 -384 5.19158 0.221
NP_440875.1_9 Forward -380 -370 10.1241 0.231
NP_441239.1_9 Forward -384 -372 13.0187 0.0389
NP_440156.1_4 Reverse -196 -206 11.9759 0.176
NP_440706.1_5 Reverse -110 -129 21.9585 0.0846
NP_442629.1_3 Reverse -369 -388 1.0811 0.284
NP_442216.1_4 Forward -166 -158 8.08217 0.255
NP_443035.1_10 Forward -389 -372 10.5603 0.273
NP_440354.1_7 Forward -220 -202 6.80398 0.278
NP_442052.1_7 Reverse -219 -233 11.6026 0.298
NP_442052.1_8 Reverse -344 -354 13.2547 0.253
NP_440546.1_4 Reverse -373 -383 12.5669 0.0664
NP_441509.1_1 Forward -203 -184 13.8641 0.209
NP_442592.1_3 Forward -399 -380 7.96426 0.298
NP_441474.1_1 Forward -290 -271 0.392004 0.255
NP_442402.1_4 Forward -304 -285 -3.24622 0.213
NP_442402.1_10 Forward -295 -285 15.0242 0.18
NP_441848.1_7 Reverse -194 -213 -3.34455 0.282
NP_441843.2_9 Reverse -48 -66 11.5619 0.205
NP_442039.1_7 Forward -82 -72 11.3864 0.257
NP_442039.1_7 Reverse -375 -385 9.81313 0.257
NP_441811.1_1 Forward -392 -373 9.0459 0.27
NP_441811.1_8 Reverse -218 -232 8.35772 0.238
NP_440505.1_3 Forward -265 -255 6.76487 0.169
NP_440505.1_7 Reverse -62 -81 0.196116 0.259
NP_440505.1_7 Forward -395 -376 -2.55715 0.289
NP_442533.1_6 Forward -55 -46 2.26134 0.266
NP_442533.1_6 Forward -382 -373 1.67135 0.293
NP_440816.1_2 Reverse -182 -201 7.30627 0.267
NP_441028.1_6 Forward -228 -218 5.68278 0.243
NP_441028.1_6 Reverse -199 -209 3.51951 0.292
NP_441527.1_4 Forward -98 -79 -12.3666 0.285
NP_441059.1_2 Reverse -147 -166 0.491109 0.233
NP_443045.1_2 Forward -397 -378 16.1257 0.204
NP_440429.1_2 Forward -225 -206 8.94757 0.272
NP_442704.1_7 Forward -377 -358 11.0125 0.272
NP_442058.1_6 Reverse -300 -319 5.99764 0.114
NP_442058.1_6 Reverse -67 -86 3.73603 0.18
NP_440886.1_7 Forward -56 -46 5.97777 0.151
NP_440886.1_7 Forward -221 -211 5.48612 0.181
NP_442614.1_2 Reverse -379 -393 12.7826 0.145
NP_440223.1_7 Forward -111 -97 12.9793 0.231
NP_440841.1_4 Forward -258 -239 -10.1286 0.271
NP_441463.1_3 Reverse -20 -39 -7.57203 0.259
NP_442211.1_9 Reverse -308 -327 2.0644 0.247
NP_441962.1_4 Reverse -218 -237 -12.5869 0.26
NP_441431.1_2 Forward -385 -371 10.6187 0.158
NP_441431.1_2 Reverse -370 -384 9.24208 0.19
NP_440114.1_10 Reverse -373 -387 7.27608 0.239
NP_441272.1_9 Forward -250 -231 19.2723 0.219
NP_439988.1_3 Forward -237 -223 4.71948 0.292
NP_441237.1_9 Forward -232 -222 12.2714 0.127
NP_442930.1_1 Reverse -196 -206 13.3526 0.239
NP_442930.1_1 Reverse -195 -205 11.091 0.26
NP_440457.1_1 Reverse -329 -341 1.41561 0.239
NP_440798.1_1 Reverse -108 -126 15.76 0.294
NP_442297.1_3 Reverse -375 -394 15.0432 0.145
NP_441332.1_6 Forward -343 -333 11.0659 0.277
NP_442509.1_9 Forward -63 -53 7.94438 0.195
NP_440734.1_8 Forward -354 -335 23.1072 0.0476
NP_442341.1_7 Reverse -264 -278 3.04785 0.237
NP_441173.1_9 Reverse -244 -252 13.1954 0.184
NP_441173.1_9 Reverse -58 -66 12.1137 0.21
NP_441173.1_9 Forward -292 -284 11.0321 0.228
NP_441173.1_9 Reverse -114 -122 9.85212 0.275
NP_441173.1_9 Reverse -200 -208 9.75379 0.284
NP_440409.1_10 Forward -151 -132 10.2259 0.29
NP_442513.1_5 Reverse -61 -80 7.96345 0.274
NP_441842.1_10 Reverse -204 -218 7.37441 0.258
NP_442932.1_9 Reverse -154 -173 5.40766 0.266
NP_442354.1_8 Reverse -176 -195 5.50599 0.299
NP_439962.1_4 Forward -390 -371 -6.1954 0.281
NP_442495.1_5 Forward -393 -374 5.60432 0.291
NP_441226.1_7 Forward -341 -334 8.29857 0.205
NP_441226.1_7 Forward -396 -389 6.82361 0.246
NP_442222.1_3 Reverse -335 -354 12.4875 0.242
NP_440244.1_1 Reverse -335 -354 -9.44032 0.287
NP_442417.1_9 Forward -55 -36 16.1257 0.246
NP_440416.1_9 Forward -225 -206 -18.3884 0.256
NP_443052.1_9 Forward -224 -205 -7.27704 0.295
NP_442403.1_9 Forward -223 -204 3.93269 0.246
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATACCCGTCGGTGTGGCCCCCATGGCTGCTAAATCCGATAAATTGGCCGCTGCTCCCCGCCAACCCACGTCAAAAGCGGAGGTGGTTTGGTCACTAAAATGGACATTTTCCACCAACATATCCGTGCTGATTACCAGGGAGTCCGAGTTGGGTAAATCGAACACAGCGGCATCGTCCCCCGTTATCTCCGCCGGGGAAAATTTTTGTAGTTGGGCCAACAGAGCTTGTTCTCCTAACTCCCCAATGGTTTGGTCAGGCTGGGACGGAGTAGATAAATTGGGTGGAAATGATTGAGACAAAGGCAGAAGAGAAGTGGAAGTTGGCGACAAAAATTTGGCAGAACCGCCCATCAACCATTAAAACAGGGACAGTGTTGATCGTTGAGCCCTTTCTCTCACC

CDS

ATGACCCTTTCTTCTGGTTTACCTATGGGTAGTTTACGGCGTGTGCACCACATTGCTTTGAACGTTAAAGATATGGAAAAATCCTGCCACTTTTACGGCCATATTTTGGGGTTGAAACCATTGGCGGGAGAAGAAATTCCCCTTACCCTCAAAACCATGGTGGAAGAGGGAAAGGTCAGCAATTTCATCACCCCCGATGGCACCGTAATTGATCTGTTTGCCACACCGAATTTATCTCCCCCGGCAGTAGATCCCCACCAATCCTTCACTCGCACCGATCATTTGGCGTTTGACATTGCCCCGGAACAGTTTGACCAGGCGATCGCCGTGTTGGAAGCCCATGGAGTGACCATTGCATCGGGCCCCGTGACCAGGCCGACGGGCCGGGGAATTTATTTTTATGACCCGGATGGCTTTCAGGTGGAAATTCGCTGTGATCCCATGGGTTTATAG

Protein

MTLSSGLPMGSLRRVHHIALNVKDMEKSCHFYGHILGLKPLAGEEIPLTLKTMVEEGKVSNFITPDGTVIDLFATPNLSPPAVDPHQSFTRTDHLAFDIAPEQFDQAIAVLEAHGVTIASGPVTRPTGRGIYFYDPDGFQVEIRCDPMGL