Your browser is old and dusty. Try Google Chrome!

Details for sll1671

ORF sll1671
Accession NP_440127.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_7 Reverse -302 -309 11.6422 0.298
NP_442151.1_6 Forward -324 -310 6.78443 0.221
NP_441465.1_5 Reverse -337 -351 17.4042 0.286
NP_440259.1_4 Forward -74 -60 11.4317 0.255
NP_440120.1_4 Reverse -259 -273 14.4542 0.273
NP_442623.1_4 Forward -281 -262 -0.4922 0.252
NP_440150.1_2 Reverse -334 -353 10.6184 0.201
NP_442744.1_9 Reverse -93 -107 13.1262 0.28
NP_442861.1_1 Reverse -21 -40 9.63589 0.295
NP_442861.1_4 Reverse -121 -140 11.0117 0.129
NP_440061.1_9 Forward -88 -74 6.68548 0.235
NP_441054.1_2 Reverse -186 -205 15.5357 0.136
NP_440044.1_8 Forward -397 -378 -1.47551 0.246
NP_441781.1_7 Reverse -179 -198 -1.08219 0.268
NP_441781.1_7 Forward -347 -328 -2.16383 0.288
NP_441492.1_5 Reverse -42 -61 2.87099 0.3
NP_439918.1_2 Reverse -238 -257 -3.44213 0.254
NP_439957.1_5 Reverse -94 -113 8.25926 0.273
NP_441434.1_7 Reverse -317 -331 1.86788 0.29
NP_440655.1_2 Reverse -352 -371 0.884433 0.293
NP_442889.1_1 Reverse -331 -350 -2.95047 0.145
NP_442889.1_1 Forward -353 -334 -10.9153 0.217
NP_442445.1_1 Forward -193 -174 17.699 0.122
NP_442111.1_4 Reverse -286 -300 3.04785 0.257
NP_441163.1_1 Reverse -330 -347 7.90458 0.235
NP_441163.1_1 Forward -383 -366 6.23297 0.264
NP_440747.1_10 Reverse -334 -346 -12.1541 0.227
NP_440376.1_1 Reverse -75 -84 1.1797 0.255
NP_441002.1_5 Reverse -94 -113 9.3409 0.296
NP_442687.1_7 Forward -325 -315 4.0116 0.271
NP_442946.1_7 Reverse -177 -192 19.5528 0.142
NP_442530.1_2 Forward -53 -43 13.1564 0.263
NP_442205.1_9 Reverse -71 -87 2.02515 0.224
NP_442223.1_7 Forward -92 -73 10.0292 0.239
NP_442544.1_2 Reverse -299 -313 -1.18038 0.272
NP_440720.1_6 Forward -54 -36 18.407 0.174
NP_440607.1_8 Forward -196 -177 8.75091 0.153
NP_442937.1_5 Forward -193 -174 13.0775 0.095
NP_440318.1_1 Reverse -173 -192 7.86593 0.2
NP_442836.1_10 Reverse -224 -234 13.1564 0.227
NP_439905.1_1 Forward -15 -2 8.37742 0.234
NP_440858.1_1 Reverse -80 -99 0.884433 0.212
NP_442064.1_4 Reverse -379 -398 10.52 0.195
NP_442064.1_4 Reverse -175 -194 10.4217 0.196
NP_442236.1_3 Reverse -170 -189 7.66927 0.248
NP_440993.1_4 Forward -316 -299 7.512 0.227
NP_440827.1_3 Forward -232 -213 10.3242 0.299
NP_440138.1_6 Forward -193 -174 2.35861 0.267
NP_441099.1_6 Forward -304 -285 10.8159 0.282
NP_441646.1_1 Forward -353 -334 7.07928 0.164
NP_440147.1_4 Forward -326 -313 5.13249 0.136
NP_441550.1_8 Forward -326 -316 5.58445 0.242
NP_440736.1_4 Forward -127 -108 8.35677 0.295
NP_440983.1_5 Reverse -179 -198 -7.96535 0.294
NP_440983.1_5 Forward -316 -297 -8.752 0.295
NP_440260.1_8 Forward -293 -275 -3.12744 0.249
NP_440260.1_8 Reverse -298 -316 -3.81576 0.257
NP_441079.1_7 Forward -111 -92 7.27514 0.122
NP_001035871.2_7 Reverse -222 -232 12.8614 0.243
NP_442012.1_1 Forward -353 -334 -1.57384 0.292
NP_443030.1_4 Reverse -331 -350 -7.4737 0.295
NP_441644.1_6 Forward -398 -388 7.15773 0.133
NP_441644.1_6 Forward -301 -291 3.32285 0.288
NP_442215.1_2 Forward -184 -168 0.746852 0.148
NP_442215.1_2 Forward -349 -333 -1.90808 0.189
NP_442215.1_2 Reverse -177 -193 -4.26803 0.23
NP_442029.1_10 Reverse -319 -338 5.11266 0.287
NP_440253.1_2 Forward -203 -185 6.41066 0.0812
NP_440253.1_2 Reverse -345 -363 -2.3408 0.265
NP_440780.1_1 Reverse -14 -33 12.9387 0.234
NP_441751.2_8 Forward -295 -281 3.93283 0.0596
NP_442554.1_8 Reverse -390 -400 4.50326 0.184
NP_442142.1_4 Reverse -80 -93 5.32859 0.194
NP_442142.1_4 Reverse -176 -189 2.18201 0.299
NP_440357.1_3 Reverse -72 -91 2.75272 0.245
NP_441015.1_10 Reverse -72 -91 -6.49039 0.249
NP_441876.1_9 Forward -20 -10 12.0743 0.267
NP_441764.1_4 Forward -58 -41 12.9419 0.173
NP_442719.1_2 Reverse -204 -222 -8.63467 0.252
NP_441612.1_2 Forward -182 -172 8.25885 0.228
NP_440031.1_10 Reverse -220 -239 4.916 0.256
NP_442342.1_9 Forward -85 -69 1.92682 0.296
NP_441114.1_3 Forward -289 -280 7.86621 0.231
NP_441114.1_3 Reverse -339 -348 7.37455 0.239
NP_441114.1_3 Reverse -181 -190 7.37455 0.239
NP_441114.1_3 Forward -345 -336 7.27622 0.247
NP_440558.1_2 Reverse -176 -195 7.07928 0.124
NP_441878.1_6 Reverse -337 -347 -7.49312 0.231
NP_441557.1_4 Forward -185 -171 10.521 0.291
NP_441433.1_8 Reverse -78 -97 -0.295539 0.244
NP_441739.1_2 Reverse -92 -108 2.51614 0.288
NP_440101.1_3 Reverse -378 -397 1.37609 0.276
NP_442397.1_1 Reverse -172 -186 15.6542 0.24
NP_442645.1_2 Reverse -171 -190 -20.65 0.288
NP_442594.1_10 Reverse -360 -379 7.76679 0.288
NP_442998.1_5 Reverse -260 -270 8.23984 0.267
NP_442998.1_10 Forward -294 -287 10.2655 0.0946
NP_440299.1_1 Reverse -385 -398 4.83694 0.197
NP_442007.1_6 Reverse -4 -23 6.09597 0.212
NP_441559.1_8 Reverse -333 -347 -4.62196 0.231
NP_441559.1_8 Reverse -332 -346 -7.2769 0.289
NP_440702.1_2 Forward -394 -375 -3.44213 0.257
NP_442993.1_1 Forward -222 -206 -12.7245 0.278
NP_442386.1_9 Reverse -280 -289 6.68581 0.219
NP_441404.1_8 Forward -299 -285 12.6836 0.271
NP_441271.1_8 Reverse -31 -41 14.0414 0.266
NP_440168.1_2 Reverse -171 -190 -4.42544 0.282
NP_440168.1_9 Forward -205 -186 -1.27885 0.273
NP_441776.1_5 Reverse -334 -353 12.6841 0.229
NP_442474.1_7 Reverse -239 -258 14.5524 0.154
NP_440586.1_8 Forward -397 -390 5.8403 0.283
NP_440027.1_3 Forward -398 -380 3.36165 0.273
NP_439937.1_9 Forward -348 -331 -13.9248 0.287
NP_441167.1_1 Reverse -42 -61 4.42435 0.256
NP_440408.1_7 Forward -376 -357 7.86593 0.284
NP_442511.1_5 Forward -49 -30 12.9603 0.265
NP_442384.1_10 Reverse -315 -328 10.344 0.0461
NP_442384.1_10 Forward -182 -169 0.707601 0.282
NP_441018.1_7 Reverse -106 -125 6.78429 0.282
NP_441018.1_7 Forward -198 -179 6.29264 0.294
NP_440562.1_2 Reverse -115 -132 16.1651 0.187
NP_441592.1_4 Forward -188 -169 -1.08219 0.247
NP_441592.1_4 Forward -290 -271 -3.04881 0.274
NP_440888.1_2 Forward -83 -69 9.43874 0.127
NP_440822.1_8 Reverse -228 -247 7.37428 0.262
NP_441469.1_8 Reverse -337 -346 7.57121 0.227
NP_442736.1_1 Forward -345 -326 7.66927 0.177
NP_441410.1_3 Reverse -278 -297 10.8159 0.185
NP_441785.1_1 Reverse -173 -187 12.4475 0.245
NP_441033.1_4 Reverse -3 -22 18.3865 0.0594
NP_440128.1_3 Reverse -205 -224 18.0924 0.181
NP_440128.1_4 Reverse -15 -34 19.3707 0.0835
NP_441353.1_4 Forward -365 -346 19.5673 0.193
NP_440673.1_2 Reverse -379 -398 11.0725 0.188
NP_440673.1_3 Reverse -181 -188 8.98723 0.203
NP_441052.1_2 Forward -290 -280 2.92996 0.187
NP_441052.1_2 Reverse -77 -87 2.14332 0.216
NP_441052.1_2 Reverse -173 -183 1.84832 0.225
NP_442219.1_8 Forward -393 -374 7.87721 0.26
NP_440436.1_4 Reverse -180 -189 7.76745 0.124
NP_441884.1_9 Reverse -71 -90 -11.9969 0.135
NP_441884.1_9 Forward -104 -85 -23.7966 0.284
NP_442907.1_9 Reverse -282 -301 -0.000545616 0.212
NP_442873.1_9 Forward -337 -318 3.83357 0.287
NP_443054.1_2 Reverse -335 -349 1.96621 0.245
NP_441966.1_8 Reverse -332 -350 6.214 0.0979
NP_441668.1_4 Forward -392 -373 1.37609 0.215
NP_442515.1_1 Reverse -74 -88 2.45787 0.135
NP_442689.1_8 Reverse -84 -101 -2.3211 0.235
NP_442843.1_1 Reverse -187 -206 -10.9153 0.282
NP_442843.1_1 Forward -397 -378 -11.8986 0.295
NP_440431.1_3 Forward -142 -123 -8.16202 0.226
NP_440588.1_2 Forward -95 -76 -1.96717 0.158
NP_440588.1_5 Forward -178 -164 15.6743 0.215
NP_439950.1_1 Forward -366 -357 14.8477 0.189
NP_440023.1_7 Reverse -265 -284 5.99764 0.269
NP_441003.1_9 Forward -95 -76 14.1591 0.213
NP_442243.1_1 Forward -291 -273 -1.75153 0.279
NP_442038.1_7 Forward -282 -263 13.8641 0.101
NP_442729.1_5 Forward -189 -179 9.12481 0.235
NP_442348.1_2 Forward -221 -212 10.6195 0.259
NP_441432.1_3 Forward -48 -29 9.53674 0.298
NP_441432.1_8 Forward -189 -180 5.40793 0.158
NP_441333.1_1 Forward -68 -58 14.0684 0.217
NP_441659.2_8 Forward -398 -388 -0.314959 0.298
NP_441040.1_5 Forward -352 -333 1.96607 0.295
NP_442849.1_1 Forward -378 -364 10.226 0.207
NP_441800.1_3 Reverse -270 -288 5.23069 0.286
NP_441185.1_2 Forward -40 -21 5.11266 0.26
NP_442346.1_5 Forward -399 -389 11.6814 0.0606
NP_440545.1_3 Forward -305 -288 -7.13932 0.298
NP_441786.1_3 Reverse -302 -321 6.68596 0.287
NP_441923.1_6 Forward -193 -179 8.16106 0.28
NP_440486.1_6 Reverse -76 -95 13.4708 0.207
NP_440459.1_2 Forward -197 -180 14.4935 0.119
NP_440010.1_3 Forward -232 -213 -6.29373 0.25
NP_440010.1_10 Reverse -303 -322 3.14605 0.264
NP_442551.1_4 Forward -349 -334 -0.905081 0.245
NP_442603.1_7 Reverse -77 -91 7.07881 0.216
NP_440751.1_3 Forward -90 -71 17.1082 0.127
NP_441329.1_6 Forward -163 -144 -1.57604 0.293
NP_442699.1_3 Forward -251 -232 2.0644 0.226
NP_440671.1_5 Forward -83 -69 15.9285 0.208
NP_442140.1_3 Forward -397 -387 6.96153 0.156
NP_442089.1_6 Forward -83 -64 3.93269 0.262
NP_440590.1_4 Reverse -180 -193 -3.32397 0.255
NP_441892.1_1 Forward -310 -293 -5.76269 0.288
NP_442669.1_1 Reverse -130 -149 2.85105 0.175
NP_442044.1_1 Reverse -69 -88 5.70265 0.119
NP_442270.1_9 Forward -199 -180 -6.58872 0.207
NP_442270.1_9 Reverse -378 -397 -9.93197 0.247
NP_441874.1_1 Forward -192 -178 12.291 0.24
NP_440462.1_4 Forward -338 -324 10.6193 0.23
NP_442479.1_5 Reverse -18 -37 10.1721 0.222
NP_441582.1_5 Forward -349 -330 6.68515 0.192
NP_442402.1_10 Reverse -173 -183 10.5993 0.287
NP_440036.1_10 Reverse -269 -281 14.592 0.284
NP_441848.1_7 Forward -204 -185 -3.14789 0.277
NP_441084.1_6 Forward -373 -359 9.53803 0.278
NP_440696.1_3 Reverse -379 -397 -2.93078 0.28
NP_440843.1_4 Reverse -190 -209 12.5858 0.181
NP_442039.1_4 Forward -353 -346 8.69224 0.172
NP_442360.1_5 Forward -228 -218 12.6647 0.298
NP_441959.1_5 Forward -244 -225 13.4708 0.113
NP_441102.1_2 Forward -109 -90 10.7175 0.226
NP_442533.1_6 Reverse -77 -86 2.458 0.255
NP_442533.1_6 Forward -284 -275 1.96635 0.28
NP_442203.1_1 Reverse -57 -71 17.4866 0.15
NP_440816.1_8 Forward -42 -28 16.2235 0.282
NP_442202.1_6 Forward -119 -100 2.85105 0.265
NP_442202.1_10 Forward -17 -3 4.03116 0.278
NP_441527.1_4 Forward -376 -357 -9.69285 0.261
NP_441106.1_3 Reverse -144 -163 15.5357 0.135
NP_442058.1_1 Reverse -151 -170 17.6982 0.115
NP_441930.1_2 Reverse -337 -347 16.008 0.19
NP_440083.1_9 Forward -133 -114 10.7772 0.281
NP_442382.1_9 Reverse -369 -388 11.2084 0.281
NP_442072.1_9 Forward -366 -348 -12.8622 0.0926
NP_442264.1_2 Reverse -73 -90 4.95539 0.288
NP_440841.1_4 Forward -190 -171 -9.63698 0.26
NP_442794.1_1 Forward -207 -195 5.34885 0.225
NP_440387.1_1 Reverse -287 -303 -6.13632 0.268
NP_440855.1_5 Forward -292 -273 5.11187 0.285
NP_441431.1_3 Reverse -269 -288 4.916 0.263
NP_441065.1_2 Forward -35 -16 13.4617 0.18
NP_441853.1_7 Reverse -309 -328 15.8307 0.245
NP_441510.2_7 Forward -316 -302 9.83206 0.281
NP_442930.1_1 Forward -49 -39 11.091 0.26
NP_440502.1_7 Forward -190 -171 12.2908 0.291
NP_441332.1_6 Forward -284 -274 12.4212 0.23
NP_441436.1_2 Forward -382 -363 -4.6221 0.29
NP_440524.1_2 Reverse -181 -200 -2.0655 0.27
NP_442514.1_5 Forward -292 -273 19.6648 0.0153
NP_442514.1_5 Reverse -323 -342 -4.32786 0.239
NP_440756.1_2 Reverse -43 -61 19.1397 0.254
NP_440478.1_9 Forward -343 -324 9.14423 0.259
NP_441428.1_8 Forward -91 -72 1.76941 0.296
NP_442703.1_9 Reverse -42 -60 3.16574 0.299
NP_442341.1_7 Forward -348 -334 1.37622 0.292
NP_443060.1_5 Forward -355 -336 10.2251 0.186
NP_440127.1_1 Forward -283 -264 28.7121 0.000685
NP_440127.1_2 Forward -366 -347 25.7504 0.00711
NP_440127.1_3 Forward -78 -59 22.418 0.0388
NP_440127.1_4 Forward -193 -179 19.0758 0.139
NP_440127.1_5 Forward -111 -93 21.947 0.0566
NP_441207.1_7 Forward -102 -88 7.7064 0.295
NP_439929.1_4 Forward -40 -26 17.9873 0.273
NP_440216.1_9 Forward -133 -124 14.0611 0.184
NP_440216.1_9 Forward -396 -387 7.96454 0.286
NP_440216.1_9 Reverse -181 -190 5.50626 0.292
NP_440216.1_9 Forward -57 -48 5.50626 0.292
NP_442015.1_3 Forward -326 -307 16.2232 0.162
NP_442015.1_10 Forward -90 -77 1.39592 0.204
NP_442015.1_10 Reverse -385 -398 0.60927 0.221
NP_440416.1_9 Reverse -178 -197 -17.7985 0.247
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGGCCATGGTAAACGTTGACAGTGGACAAGGGAGGGAGAAATACTCGCGCTTGGGCATTTCCCAGGAACAGGGTGGGTCATCAGCTCATACCCAAGGGGGCCATTATATCGCCTTGCCCAGTCCCAAATCATTTTGCACTGTCCGATTCAAATGCAAAGTCCTGTTCCCAGACCCTAGGGGACTTGGTTTAACCCTCCAAATCTCTGCATTGGCAATGGTGAAAACCAAGGGAGTGTATTAAAACTGGTTACATTACAAGCAAGTTCCAAGGAAAGCAATTAAAACGACCAAGATATCGGAAATTTTAACCATGGTGCTGACCCCCTCTGCTTTTTAACTTTACATTGCAAAATATTTCTCAGCCAAAGATTGGCAACTTTCGTCCCAAGGTAGCCAAA

CDS

GTGAACACCATCCATCTACGCCCATATCGTCCCTCGGATTTAAACAATATCATTCAAATTTTCACTGAAGCTGTCCATCAGTTAGGTATTAAATATTATTCCCCAGCCCAACTAAGTGCTTGGGCCCCATCCGAACCAGACTTACAGCGGTGGGGCGATCGCCTGGAATCCATGGTGGTGTTGGTGGCTGAGCAAGGAGAAACCATCATTGGCTTTATTGGCTACAATGGCGCTGGATTGGTGGACCTGCTTTTTGTCCATCCAGCCTTTACCCGCCTGGGCATTGCCACCATATTGATGCAAGCAGTAGAGCAGTTGGCCATCGCTGACGGGGTAAGGGAACTTGAGACTAAAGCAAGTATGGTAGCCCGGCCCTTTTTCGAGTCCAGGGGCTTTGTGGTCATAGCGGAAGAAACCGTTACCATAGGGGGAGAAAATTTACGTCGATTTGCCATGGGTAAAACCATTGAACCAACTCATTAG

Protein

MNTIHLRPYRPSDLNNIIQIFTEAVHQLGIKYYSPAQLSAWAPSEPDLQRWGDRLESMVVLVAEQGETIIGFIGYNGAGLVDLLFVHPAFTRLGIATILMQAVEQLAIADGVRELETKASMVARPFFESRGFVVIAEETVTIGGENLRRFAMGKTIEPTH