Your browser is old and dusty. Try Google Chrome!

Details for sll1667

ORF sll1667
Accession NP_440137.1
Symbol
Category periplasmic protein, similar to mitochondrial outer membrane 72K protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -72 -58 -0.885388 0.242
NP_440795.1_7 Reverse -239 -246 14.1988 0.0267
NP_441418.1_6 Forward -176 -157 -23.2067 0.192
NP_442291.1_5 Reverse -237 -253 1.04184 0.154
NP_442291.1_5 Forward -248 -232 -3.67804 0.249
NP_440295.1_9 Forward -203 -184 6.68596 0.124
NP_441453.1_4 Reverse -238 -246 6.80426 0.121
NP_441453.1_4 Forward -247 -239 6.80426 0.121
NP_441453.1_4 Reverse -206 -214 4.24765 0.259
NP_441623.1_1 Reverse -185 -203 -5.29072 0.288
NP_442151.1_6 Reverse -51 -65 12.6843 0.0691
NP_442151.1_6 Reverse -376 -390 10.816 0.114
NP_442151.1_6 Forward -247 -233 5.89945 0.256
NP_441818.1_1 Reverse -239 -250 13.4312 0.0745
NP_441818.1_9 Forward -215 -196 -8.94866 0.285
NP_440226.1_1 Forward -385 -366 2.0644 0.278
NP_440348.1_8 Forward -205 -186 10.9142 0.295
NP_440150.1_6 Reverse -235 -254 7.66927 0.223
NP_442173.1_1 Reverse -239 -247 7.59091 0.163
NP_442173.1_1 Forward -246 -238 5.72262 0.203
NP_442752.1_4 Reverse -310 -317 12.1338 0.0546
NP_442752.1_4 Forward -145 -138 12.1338 0.0546
NP_442752.1_4 Reverse -376 -383 4.26735 0.293
NP_442752.1_4 Reverse -238 -245 4.26735 0.293
NP_443027.1_4 Reverse -236 -246 6.37155 0.283
NP_440784.1_7 Forward -246 -239 13.2155 0.0365
NP_440784.1_7 Reverse -239 -246 12.1338 0.0604
NP_440784.1_7 Reverse -207 -214 10.2655 0.0801
NP_441093.1_8 Forward -57 -38 18.1213 0.265
NP_441934.1_8 Forward -63 -44 10.9142 0.292
NP_440061.1_9 Reverse -236 -250 5.40719 0.286
NP_441054.1_2 Forward -186 -167 9.24257 0.299
NP_439979.1_4 Reverse -313 -332 18.1326 0.204
NP_442062.1_8 Reverse -238 -248 7.35486 0.101
NP_442062.1_8 Forward -247 -237 5.48657 0.168
NP_440839.1_4 Reverse -41 -60 11.7983 0.268
NP_440304.1_4 Reverse -236 -246 9.51814 0.0562
NP_440304.1_4 Reverse -38 -48 4.69992 0.252
NP_442242.1_4 Reverse -239 -246 12.0355 0.0521
NP_442242.1_4 Forward -246 -239 11.5438 0.089
NP_442359.1_5 Forward -323 -304 9.93088 0.26
NP_441200.1_4 Forward -309 -290 5.11266 0.297
NP_442110.1_7 Reverse -376 -390 4.62115 0.197
NP_442259.1_3 Reverse -3 -22 11.5042 0.202
NP_441925.1_4 Forward -30 -11 -10.916 0.243
NP_441925.1_4 Reverse -168 -187 -14.8492 0.263
NP_441925.1_4 Forward -329 -310 -17.2092 0.29
NP_441925.1_4 Reverse -167 -186 -17.4058 0.294
NP_440856.1_4 Reverse -355 -374 1.96607 0.157
NP_441083.1_5 Reverse -238 -248 7.94484 0.048
NP_441083.1_5 Reverse -376 -386 5.48657 0.116
NP_441083.1_5 Forward -247 -237 0.471689 0.226
NP_441083.1_5 Forward -385 -375 -0.806614 0.28
NP_441434.1_7 Forward -245 -231 2.16287 0.288
NP_440209.1_1 Reverse -238 -246 8.37755 0.0576
NP_442889.1_8 Reverse -235 -249 4.91554 0.247
NP_440178.1_7 Forward -248 -229 -15.8318 0.163
NP_440178.1_7 Reverse -39 -58 -23.1083 0.294
NP_442570.1_3 Reverse -292 -311 -2.65548 0.212
NP_442570.1_3 Forward -202 -183 -3.04881 0.216
NP_442570.1_3 Forward -249 -230 -9.44032 0.299
NP_440906.1_5 Forward -246 -239 13.3138 0.0268
NP_440906.1_5 Reverse -239 -246 6.13563 0.241
NP_440747.1_10 Forward -250 -238 -2.71429 0.0639
NP_441486.1_1 Forward -250 -236 1.67122 0.103
NP_441486.1_1 Reverse -235 -249 -3.44199 0.178
NP_440944.1_2 Reverse -28 -47 0.786102 0.256
NP_442330.1_9 Reverse -211 -230 8.16093 0.263
NP_442634.1_2 Forward -151 -132 6.58763 0.205
NP_442634.1_4 Reverse -38 -52 -5.60527 0.264
NP_440403.1_4 Forward -256 -237 -7.37537 0.241
NP_440842.1_10 Reverse -165 -179 3.63784 0.255
NP_441014.1_8 Reverse -225 -244 16.0274 0.0707
NP_441014.1_8 Reverse -168 -187 -8.16202 0.283
NP_442848.1_1 Forward -391 -377 3.04785 0.146
NP_443018.1_3 Forward -59 -52 9.38056 0.128
NP_443018.1_3 Forward -12 -5 5.34899 0.212
NP_443018.1_3 Reverse -239 -246 5.15232 0.226
NP_443018.1_3 Forward -246 -239 5.05399 0.238
NP_443018.1_3 Forward -214 -207 4.26735 0.267
NP_443018.1_3 Reverse -207 -214 4.16902 0.278
NP_440376.1_1 Reverse -343 -352 5.3096 0.137
NP_440376.1_1 Forward -176 -167 4.52295 0.156
NP_440376.1_1 Forward -247 -238 0.0980582 0.285
NP_440376.1_1 Reverse -238 -247 -0.0986038 0.285
NP_440376.1_1 Reverse -311 -320 -0.68859 0.291
NP_442687.1_7 Reverse -237 -247 7.84651 0.123
NP_442687.1_7 Reverse -166 -176 4.89658 0.23
NP_442687.1_7 Reverse -342 -352 3.81494 0.286
NP_441846.1_10 Reverse -10 -29 -20.4534 0.256
NP_441846.1_10 Reverse -2 -21 -21.0434 0.256
NP_441846.1_10 Reverse -3 -22 -22.0267 0.257
NP_441846.1_10 Reverse -4 -23 -23.6 0.294
NP_442958.1_3 Forward -258 -239 -1.27885 0.276
NP_440667.1_2 Forward -233 -214 -2.85214 0.232
NP_441950.1_7 Forward -152 -133 -8.94866 0.287
NP_442658.1_1 Reverse -236 -246 5.19112 0.28
NP_441971.1_5 Forward -385 -366 8.84924 0.288
NP_442782.1_2 Forward -187 -173 0.687908 0.286
NP_442496.1_5 Forward -281 -263 7.68896 0.256
NP_441487.1_6 Forward -57 -38 0.687771 0.254
NP_441256.1_8 Forward -166 -147 3.24438 0.284
NP_441958.1_5 Reverse -237 -247 9.51814 0.0198
NP_442836.1_5 Forward -253 -234 1.27776 0.287
NP_440153.1_5 Forward -246 -232 2.45787 0.223
NP_440153.1_8 Forward -23 -10 -2.34066 0.235
NP_440858.1_1 Forward -313 -294 0.786102 0.212
NP_443055.1_6 Forward -247 -229 0.411736 0.243
NP_440169.1_5 Reverse -307 -326 17.5024 0.223
NP_440602.1_8 Forward -247 -233 9.5377 0.298
NP_441099.1_5 Forward -329 -310 -7.27704 0.172
NP_442002.1_9 Reverse -237 -244 14.1004 0.074
NP_442002.1_9 Reverse -39 -46 12.4288 0.185
NP_442002.1_9 Reverse -375 -382 10.7572 0.185
NP_442002.1_9 Forward -392 -385 9.97054 0.246
NP_440106.1_2 Forward -59 -41 9.85225 0.298
NP_441292.1_2 Forward -194 -175 -6.49039 0.245
NP_441000.1_6 Reverse -237 -251 2.35953 0.141
NP_441000.1_6 Forward -386 -372 -5.21195 0.266
NP_440147.1_4 Reverse -236 -249 6.50913 0.0911
NP_441550.1_8 Reverse -236 -246 10.3043 0.0709
NP_441550.1_8 Forward -249 -239 7.74772 0.149
NP_441550.1_8 Forward -387 -377 5.19112 0.26
NP_441916.1_7 Forward -247 -237 7.74818 0.0608
NP_441041.1_4 Reverse -52 -71 -6.88371 0.176
NP_441041.1_4 Forward -152 -133 -11.4069 0.246
NP_441041.1_4 Reverse -40 -59 -11.8003 0.252
NP_441041.1_4 Reverse -58 -77 -13.2752 0.285
NP_442004.1_6 Forward -391 -377 1.86788 0.276
NP_440703.1_9 Reverse -168 -181 17.7182 0.111
NP_441725.1_5 Forward -246 -236 11.1898 0.0247
NP_441725.1_5 Forward -48 -38 -0.118297 0.232
NP_441725.1_5 Forward -175 -165 -0.314959 0.246
NP_439966.1_7 Forward -387 -377 5.68278 0.214
NP_442941.1_3 Reverse -239 -249 14.1397 0.0116
NP_442941.1_3 Forward -246 -236 1.84832 0.147
NP_440289.1_2 Reverse -235 -248 3.5592 0.0767
NP_440289.1_2 Reverse -373 -386 0.60927 0.156
NP_440289.1_2 Reverse -340 -353 -0.767364 0.209
NP_440289.1_2 Reverse -201 -214 -3.52063 0.267
NP_440260.1_7 Forward -191 -172 -0.4922 0.241
NP_440260.1_8 Forward -185 -167 6.11567 0.154
NP_440260.1_8 Reverse -291 -309 -6.66736 0.294
NP_441678.1_9 Reverse -10 -29 -1.08219 0.238
NP_441678.1_9 Forward -199 -180 -1.96717 0.257
NP_441678.1_9 Reverse -114 -133 -5.31042 0.297
NP_442281.1_1 Reverse -53 -67 9.04542 0.0747
NP_442281.1_1 Forward -65 -51 8.45543 0.0808
NP_442281.1_1 Reverse -201 -215 8.06211 0.0869
NP_442281.1_1 Reverse -233 -247 7.66879 0.0949
NP_442281.1_1 Reverse -162 -176 6.48882 0.124
NP_442281.1_1 Reverse -35 -49 3.04726 0.246
NP_442281.1_1 Forward -28 -14 2.06395 0.278
NP_442281.1_1 Reverse -127 -141 1.67063 0.293
NP_441556.1_4 Reverse -364 -383 12.5117 0.214
NP_441644.1_6 Forward -60 -50 11.1893 0.0538
NP_441644.1_6 Reverse -238 -248 4.69947 0.228
NP_441644.1_6 Reverse -167 -177 4.50281 0.235
NP_441644.1_6 Forward -247 -237 3.51951 0.277
NP_442215.1_2 Forward -354 -338 -2.69473 0.202
NP_442215.1_2 Forward -249 -233 -2.79306 0.204
NP_442215.1_2 Forward -69 -53 -3.77637 0.222
NP_442215.1_2 Reverse -49 -65 -5.25134 0.248
NP_442215.1_2 Reverse -123 -139 -5.34967 0.249
NP_442933.1_10 Forward -247 -238 13.9627 0.0192
NP_442933.1_10 Reverse -238 -247 7.86621 0.103
NP_442933.1_10 Forward -215 -206 3.7363 0.284
NP_441751.2_8 Reverse -239 -253 -5.60527 0.223
NP_442554.1_8 Reverse -52 -62 10.7964 0.043
NP_442554.1_8 Forward -246 -236 5.28991 0.153
NP_442554.1_8 Reverse -168 -178 3.71661 0.215
NP_442554.1_8 Forward -175 -165 3.12662 0.239
NP_442142.1_4 Reverse -235 -248 8.2785 0.118
NP_442142.1_4 Reverse -164 -177 4.64028 0.214
NP_442292.1_1 Reverse -207 -216 5.50626 0.143
NP_442292.1_1 Forward -246 -237 0.0980582 0.239
NP_442292.1_1 Reverse -239 -248 -0.196935 0.239
NP_440122.1_2 Forward -184 -165 -0.4922 0.276
NP_441024.1_6 Forward -286 -267 6.82725 0.292
NP_442476.1_6 Reverse -239 -253 1.27789 0.223
NP_443009.1_5 Forward -248 -237 8.12131 0.117
NP_443009.1_5 Forward -353 -342 3.99143 0.268
NP_442741.1_5 Forward -214 -195 13.6675 0.198
NP_441715.1_4 Reverse -239 -249 16.1063 0.0144
NP_440015.1_9 Forward -247 -229 3.95239 0.164
NP_441448.1_1 Forward -193 -174 6.4893 0.249
NP_441198.1_8 Reverse -308 -318 11.1228 0.222
NP_441198.1_8 Reverse -236 -246 10.4392 0.271
NP_441468.1_1 Forward -214 -207 10.2655 0.0906
NP_441468.1_1 Forward -246 -239 6.3323 0.202
NP_441468.1_1 Reverse -239 -246 6.13563 0.209
NP_441618.1_3 Forward -319 -300 11.4058 0.0815
NP_441015.1_9 Reverse -214 -227 20.2748 0.143
NP_441673.1_1 Forward -247 -238 1.27803 0.155
NP_441673.1_1 Reverse -238 -247 1.27803 0.155
NP_441826.1_2 Reverse -232 -246 3.14618 0.115
NP_441826.1_2 Forward -391 -377 0.392915 0.187
NP_442811.1_2 Reverse -26 -45 1.67108 0.252
NP_441764.1_8 Forward -305 -295 11.6935 0.284
NP_442868.1_6 Forward -249 -239 0.57002 0.217
NP_442868.1_6 Reverse -236 -246 -0.314959 0.284
NP_442719.1_2 Forward -280 -262 -4.50479 0.212
NP_441612.1_2 Reverse -238 -248 7.96841 0.239
NP_442227.1_2 Forward -28 -9 6.68596 0.198
NP_443058.1_7 Forward -386 -367 7.7676 0.232
NP_442808.1_1 Reverse -342 -352 4.7978 0.19
NP_442808.1_1 Forward -320 -310 4.60114 0.195
NP_442820.1_9 Forward -135 -117 5.52568 0.262
NP_442542.1_2 Reverse -12 -25 5.32916 0.272
NP_442542.1_9 Reverse -224 -238 11.012 0.111
NP_442113.1_10 Reverse -171 -190 -6.49039 0.263
NP_441114.1_3 Forward -65 -56 17.1093 0.113
NP_440558.1_2 Forward -70 -51 -1.7705 0.218
NP_440558.1_2 Forward -180 -161 -6.29373 0.273
NP_441878.1_6 Reverse -166 -176 10.7964 0.0176
NP_441878.1_6 Forward -177 -167 1.455 0.0979
NP_441878.1_6 Reverse -237 -247 0.668351 0.139
NP_441878.1_6 Reverse -21 -31 -7.29646 0.217
NP_441878.1_6 Reverse -57 -67 -7.39479 0.222
NP_441878.1_6 Reverse -3 -13 -7.49312 0.231
NP_441036.1_8 Reverse -233 -243 6.27322 0.239
NP_441557.1_5 Reverse -238 -247 8.94785 0.0289
NP_441557.1_5 Forward -247 -238 0.688044 0.128
NP_442777.1_1 Forward -20 -1 9.24175 0.197
NP_441308.1_8 Reverse -308 -318 16.598 0.218
NP_440101.1_10 Reverse -126 -145 2.55606 0.251
NP_442183.1_1 Forward -49 -35 6.88276 0.157
NP_442397.1_9 Forward -73 -54 1.0811 0.295
NP_441549.1_9 Forward -251 -233 -5.29072 0.198
NP_441549.1_9 Reverse -36 -54 -8.24065 0.223
NP_442347.1_2 Forward -384 -375 11.2095 0.056
NP_442347.1_2 Forward -246 -237 5.60459 0.229
NP_442888.1_6 Forward -71 -52 6.29264 0.225
NP_441633.1_3 Forward -249 -236 3.16588 0.0738
NP_440136.1_2 Forward -246 -239 6.43063 0.154
NP_440136.1_2 Reverse -239 -246 6.23397 0.171
NP_442590.1_10 Forward -183 -164 6.39097 0.245
NP_442998.1_5 Forward -304 -294 11.6814 0.179
NP_442998.1_5 Forward -305 -295 11.0914 0.196
NP_442998.1_10 Forward -47 -40 9.28223 0.117
NP_442998.1_10 Forward -383 -376 5.93897 0.206
NP_442998.1_10 Forward -245 -238 5.93897 0.206
NP_440899.1_1 Forward -187 -168 6.65079 0.267
NP_440899.1_5 Forward -40 -21 5.40766 0.242
NP_441799.1_1 Reverse -234 -248 6.0955 0.183
NP_441799.1_9 Forward -320 -301 9.43923 0.108
NP_441007.1_10 Reverse -282 -295 1.78924 0.203
NP_440256.1_1 Forward -355 -336 0.982764 0.0791
NP_440256.1_1 Reverse -1 -20 -9.83364 0.289
NP_440087.1_1 Forward -256 -237 -8.752 0.285
NP_441559.1_4 Forward -179 -160 6.39097 0.139
NP_441559.1_8 Reverse -131 -145 -6.88358 0.281
NP_441270.1_5 Forward -219 -200 12.1159 0.248
NP_441270.1_5 Forward -240 -221 11.0424 0.294
NP_440915.1_6 Forward -149 -135 -1.47537 0.236
NP_440915.1_6 Reverse -306 -320 -3.34366 0.293
NP_442855.1_3 Forward -156 -137 14.1591 0.21
NP_441296.1_9 Forward -71 -58 15.7516 0.18
NP_440717.1_3 Reverse -139 -153 11.602 0.23
NP_442866.1_1 Forward -252 -233 -8.45701 0.279
NP_442866.1_1 Forward -188 -169 -8.65367 0.282
NP_441464.1_1 Reverse -175 -194 7.07928 0.27
NP_441113.1_3 Reverse -341 -355 15.5352 0.235
NP_441199.1_3 Reverse -299 -317 -2.73412 0.274
NP_441199.1_3 Forward -315 -297 -2.93078 0.281
NP_440677.1_6 Forward -197 -178 12.8808 0.194
NP_442386.1_9 Forward -61 -52 6.48915 0.219
NP_442386.1_9 Forward -248 -239 5.40752 0.253
NP_441340.1_5 Reverse -239 -246 5.93897 0.198
NP_441340.1_5 Forward -246 -239 5.84064 0.208
NP_441340.1_5 Reverse -207 -214 4.07068 0.239
NP_440137.1_2 Forward -29 -10 18.2882 0.296
NP_440137.1_3 Forward -326 -307 18.0915 0.266
NP_440137.1_5 Forward -210 -191 20.0581 0.112
NP_440137.1_10 Forward -152 -134 19.6845 0.271
NP_442484.1_2 Forward -71 -52 0.392778 0.248
NP_440586.1_1 Forward -231 -212 6.58763 0.182
NP_440586.1_1 Forward -228 -209 -5.40875 0.285
NP_440586.1_8 Reverse -239 -246 11.1501 0.0845
NP_442251.1_6 Reverse -239 -246 13.7071 0.0268
NP_442251.1_6 Forward -48 -41 6.43063 0.298
NP_442251.1_7 Forward -157 -138 22.1239 0.0701
NP_440192.1_4 Reverse -260 -279 18.9056 0.145
NP_440684.1_9 Forward -253 -239 6.88276 0.288
NP_440027.1_3 Reverse -167 -185 6.60656 0.225
NP_440027.1_3 Reverse -168 -186 2.57501 0.289
NP_443051.1_1 Reverse -237 -246 8.35786 0.0371
NP_439937.1_9 Reverse -261 -278 -11.9582 0.269
NP_441665.1_2 Forward -357 -338 8.35759 0.248
NP_443039.1_7 Forward -72 -58 7.07881 0.19
NP_440408.1_7 Reverse -370 -389 7.37428 0.29
NP_440439.1_1 Reverse -307 -320 2.47756 0.133
NP_440372.1_2 Reverse -239 -246 6.62729 0.151
NP_440372.1_2 Forward -246 -239 6.52896 0.188
NP_440372.1_2 Reverse -377 -384 4.07068 0.262
NP_441789.1_7 Reverse -127 -146 -2.75457 0.262
NP_441789.1_9 Reverse -108 -127 11.0125 0.21
NP_440139.1_1 Reverse -370 -389 18.3865 0.0402
NP_440139.1_2 Reverse -333 -352 34.8086 0.00000207
NP_440139.1_6 Reverse -309 -328 21.2389 0.0406
NP_440267.1_2 Reverse -150 -164 7.57046 0.196
NP_440267.1_2 Reverse -233 -247 6.39049 0.229
NP_442887.1_5 Reverse -286 -305 -7.86702 0.264
NP_442384.1_10 Reverse -238 -251 7.49244 0.0807
NP_442384.1_10 Reverse -167 -180 2.77255 0.213
NP_441877.1_5 Reverse -263 -282 6.98095 0.195
NP_441018.1_1 Forward -241 -222 26.1555 0.00735
NP_441018.1_3 Forward -217 -198 15.1416 0.286
NP_441018.1_4 Forward -394 -375 24.1889 0.0107
NP_441018.1_5 Forward -195 -176 19.174 0.219
NP_441018.1_6 Forward -262 -243 13.8641 0.191
NP_441018.1_7 Forward -174 -155 9.83255 0.218
NP_441018.1_7 Forward -192 -173 6.98095 0.278
NP_441018.1_8 Forward -369 -350 22.6156 0.017
NP_441018.1_9 Forward -343 -324 11.7992 0.13
NP_442790.1_4 Forward -256 -237 -10.9153 0.219
NP_442262.1_10 Forward -59 -52 9.47889 0.187
NP_442262.1_10 Forward -12 -5 7.6106 0.274
NP_440163.1_10 Reverse -373 -383 11.3864 0.169
NP_440344.1_10 Reverse -336 -353 1.41547 0.0308
NP_440531.1_6 Reverse -198 -217 -4.32711 0.279
NP_440562.1_1 Forward -63 -44 13.175 0.235
NP_441965.1_10 Reverse -235 -251 4.68009 0.234
NP_441965.1_10 Forward -148 -132 2.22182 0.289
NP_440297.1_9 Forward -175 -165 9.51814 0.0917
NP_440297.1_9 Forward -246 -236 9.22315 0.0917
NP_440297.1_9 Forward -214 -204 0.668351 0.282
NP_442280.1_10 Forward -186 -168 5.25962 0.289
NP_441592.1_4 Reverse -238 -257 15.5357 0.0619
NP_442067.1_4 Reverse -195 -214 1.96607 0.299
NP_440999.1_9 Forward -251 -237 5.40779 0.113
NP_440888.1_2 Forward -385 -371 10.1271 0.104
NP_440888.1_2 Forward -23 -9 8.16044 0.171
NP_440888.1_2 Forward -352 -338 6.88214 0.217
NP_440888.1_2 Forward -319 -305 6.0955 0.249
NP_440888.1_2 Forward -247 -233 5.1122 0.293
NP_441123.1_8 Forward -187 -168 19.5673 0.14
NP_441759.1_2 Reverse -213 -232 11.2092 0.0856
NP_441543.1_2 Reverse -239 -248 10.8161 0.0666
NP_442845.1_2 Forward -200 -186 4.91614 0.249
NP_442845.1_2 Forward -221 -207 3.8345 0.275
NP_441304.1_10 Reverse -259 -268 13.0777 0.255
NP_441469.1_8 Reverse -237 -246 10.1278 0.227
NP_443064.1_6 Reverse -238 -248 12.8578 0.0796
NP_443064.1_6 Reverse -136 -146 11.5004 0.13
NP_443064.1_6 Reverse -125 -135 9.07643 0.247
NP_442578.1_7 Reverse -239 -246 12.5271 0.0544
NP_441462.1_2 Reverse -238 -248 0.865012 0.117
NP_441462.1_2 Forward -247 -237 0.57002 0.144
NP_443062.1_1 Forward -385 -367 6.10824 0.209
NP_441410.1_4 Forward -203 -184 13.47 0.22
NP_442600.1_7 Forward -394 -375 21.421 0.0482
NP_441560.1_10 Reverse -230 -249 11.3075 0.17
NP_440516.1_8 Reverse -376 -385 9.24284 0.0264
NP_440516.1_8 Reverse -238 -247 -0.295266 0.232
NP_440516.1_8 Reverse -310 -319 -0.590259 0.283
NP_442846.1_2 Forward -330 -311 8.75091 0.17
NP_442428.1_4 Forward -20 -1 5.50599 0.212
NP_442428.1_5 Forward -246 -239 13.1171 0.038
NP_442428.1_5 Reverse -239 -246 6.23397 0.201
NP_442428.1_5 Forward -214 -207 4.66067 0.244
NP_440783.1_5 Reverse -300 -319 -4.81876 0.276
NP_442120.1_10 Forward -293 -274 -15.2418 0.292
NP_442823.1_8 Forward -304 -285 10.5209 0.297
NP_440673.1_3 Forward -383 -376 10.1672 0.149
NP_440673.1_3 Forward -245 -238 10.1672 0.149
NP_440673.1_3 Forward -65 -58 8.98723 0.203
NP_441052.1_2 Reverse -238 -248 7.05986 0.0818
NP_441052.1_2 Reverse -167 -177 4.3066 0.161
NP_441052.1_2 Forward -247 -237 -0.314959 0.273
NP_442219.1_9 Reverse -239 -248 8.94785 0.0681
NP_442219.1_9 Forward -246 -237 5.01461 0.193
NP_440436.1_4 Reverse -239 -248 6.39082 0.162
NP_440436.1_4 Forward -246 -237 6.09583 0.172
NP_441884.1_9 Reverse -235 -254 -23.895 0.284
NP_440314.1_9 Reverse -207 -226 -2.0655 0.146
NP_441719.1_4 Reverse -239 -246 6.62729 0.151
NP_441719.1_4 Forward -246 -239 6.52896 0.188
NP_441733.1_10 Forward -148 -135 6.1158 0.203
NP_441733.1_10 Reverse -307 -320 5.72248 0.208
NP_441004.1_1 Reverse -52 -71 -10.4236 0.219
NP_442366.1_3 Forward -142 -124 6.80398 0.0773
NP_442366.1_3 Forward -68 -50 0.510803 0.169
NP_441115.1_4 Forward -68 -50 9.16315 0.223
NP_442694.1_4 Forward -225 -216 11.0128 0.286
NP_440094.1_9 Forward -353 -334 22.6156 0.00246
NP_443054.1_2 Reverse -341 -355 8.45605 0.119
NP_441851.1_10 Forward -146 -136 11.5831 0.0685
NP_441851.1_10 Reverse -237 -247 9.32148 0.114
NP_441851.1_10 Forward -216 -206 4.40493 0.271
NP_441668.1_4 Reverse -48 -67 1.0811 0.224
NP_441668.1_4 Forward -225 -206 -2.26216 0.288
NP_442515.1_1 Reverse -237 -251 7.9644 0.0844
NP_441396.1_5 Forward -232 -223 7.57121 0.241
NP_440940.1_7 Reverse -366 -384 11.3264 0.112
NP_440940.1_7 Reverse -228 -246 3.06666 0.282
NP_441349.1_10 Reverse -228 -247 -4.52377 0.173
NP_440432.1_9 Forward -246 -231 -3.26502 0.179
NP_442843.1_1 Forward -308 -289 -3.73712 0.228
NP_442843.1_1 Reverse -5 -24 -11.3086 0.288
NP_439960.1_10 Reverse -221 -239 3.46073 0.163
NP_439960.1_10 Forward -241 -223 -2.24246 0.252
NP_440474.1_8 Forward -295 -281 9.14375 0.167
NP_442450.1_5 Reverse -236 -246 9.81313 0.115
NP_442450.1_5 Reverse -204 -214 6.17489 0.197
NP_440588.1_2 Forward -256 -237 14.8474 0.0149
NP_440588.1_2 Forward -394 -375 -6.58872 0.285
NP_440954.1_1 Forward -230 -211 -11.4069 0.293
NP_441003.1_9 Reverse -221 -240 4.32602 0.281
NP_443047.1_7 Forward -246 -227 4.12936 0.271
NP_442243.1_1 Reverse -45 -63 4.63995 0.195
NP_441570.1_1 Forward -247 -229 -1.35749 0.0562
NP_441570.1_1 Reverse -58 -76 -8.43732 0.112
NP_441570.1_1 Forward -230 -212 -17.8771 0.295
NP_441078.1_4 Forward -352 -343 6.19458 0.0801
NP_441078.1_4 Reverse -238 -247 0.29472 0.205
NP_441078.1_4 Forward -247 -238 0.0980582 0.205
NP_441078.1_4 Reverse -167 -176 -1.37691 0.254
NP_441078.1_4 Forward -176 -167 -1.47524 0.266
NP_441078.1_4 Reverse -343 -352 -1.86856 0.272
NP_442729.1_5 Reverse -10 -20 15.5163 0.199
NP_442348.1_2 Forward -226 -217 7.57121 0.28
NP_442443.1_1 Forward -334 -315 -1.67217 0.24
NP_440526.1_3 Forward -246 -235 1.04151 0.267
NP_440526.1_3 Reverse -137 -148 0.943182 0.267
NP_441432.1_8 Reverse -237 -246 5.3096 0.17
NP_441432.1_8 Forward -177 -168 3.44131 0.245
NP_442320.1_8 Reverse -232 -246 -5.60527 0.236
NP_442320.1_8 Reverse -337 -351 -6.19526 0.269
NP_442320.1_9 Forward -180 -166 11.111 0.271
NP_441732.1_5 Reverse -186 -200 15.7325 0.168
NP_441737.1_1 Forward -53 -34 15.1424 0.102
NP_442003.1_4 Forward -246 -227 16.1257 0.19
NP_440760.1_1 Forward -49 -30 -22.8133 0.271
NP_440199.1_10 Reverse -373 -383 12.6647 0.119
NP_442400.1_1 Forward -250 -231 10.3242 0.11
NP_440713.1_4 Reverse -300 -319 6.78429 0.185
NP_442489.1_7 Forward -49 -40 5.01461 0.0832
NP_442489.1_7 Forward -247 -238 0.589713 0.17
NP_442489.1_7 Reverse -238 -247 0.589713 0.17
NP_442489.1_7 Reverse -167 -176 -1.37691 0.195
NP_442489.1_7 Forward -176 -167 -1.47524 0.203
NP_442489.1_7 Forward -352 -343 -2.06522 0.288
NP_440559.1_1 Reverse -239 -248 7.76787 0.0918
NP_440559.1_1 Forward -246 -237 7.47288 0.108
NP_441659.2_8 Forward -247 -237 7.25653 0.0622
NP_441659.2_8 Reverse -206 -216 1.16001 0.248
NP_441659.2_8 Forward -60 -50 -0.118297 0.287
NP_442913.1_10 Forward -143 -124 -6.1954 0.296
NP_441040.1_3 Forward -187 -168 7.96426 0.289
NP_441040.1_5 Forward -396 -377 1.86774 0.296
NP_440779.1_5 Forward -247 -230 -14.9075 0.287
NP_442346.1_5 Reverse -237 -247 14.1397 0.0164
NP_442346.1_5 Forward -248 -238 10.1081 0.107
NP_442346.1_5 Reverse -166 -176 6.66654 0.195
NP_442346.1_5 Forward -177 -167 5.19158 0.256
NP_440352.1_5 Reverse -103 -122 9.83295 0.289
NP_441744.1_6 Reverse -309 -328 17.4724 0.21
NP_440459.1_2 Reverse -49 -66 10.0686 0.21
NP_440459.1_2 Reverse -2 -19 10.0686 0.21
NP_440847.1_8 Reverse -295 -314 13.0775 0.273
NP_442603.1_7 Reverse -238 -252 11.897 0.109
NP_441833.1_4 Forward -246 -239 6.3323 0.134
NP_441833.1_4 Reverse -239 -246 6.23397 0.163
NP_440751.1_3 Reverse -134 -153 5.99684 0.29
NP_442162.1_9 Reverse -239 -246 6.52896 0.178
NP_442162.1_9 Forward -246 -239 6.43063 0.208
NP_440671.1_4 Forward -391 -377 10.0294 0.165
NP_440671.1_6 Forward -322 -303 19.9598 0.0624
NP_441044.1_4 Reverse -213 -231 6.41066 0.223
NP_442199.1_5 Reverse -159 -178 -2.16383 0.185
NP_442140.1_3 Forward -59 -49 4.40493 0.243
NP_441813.1_5 Forward -249 -239 7.55152 0.0735
NP_441813.1_5 Reverse -236 -246 6.37155 0.0947
NP_441813.1_5 Forward -387 -377 2.92996 0.181
NP_441259.1_7 Forward -302 -284 12.9005 0.291
NP_440590.1_4 Reverse -52 -65 -0.767364 0.2
NP_440567.1_4 Forward -188 -169 1.0811 0.266
NP_442497.1_10 Forward -246 -237 10.0295 0.0222
NP_442497.1_10 Reverse -239 -248 -1.18024 0.256
NP_440821.1_4 Reverse -236 -246 10.1081 0.0188
NP_440821.1_4 Reverse -374 -384 -0.41329 0.257
NP_441009.1_7 Reverse -300 -319 10.2259 0.246
NP_440400.1_1 Forward -76 -57 -2.36125 0.285
NP_441892.1_1 Reverse -197 -214 8.10198 0.0829
NP_441892.1_1 Reverse -229 -246 -0.256152 0.181
NP_441892.1_1 Reverse -49 -66 -0.649475 0.188
NP_440665.1_2 Reverse -183 -202 -5.01543 0.247
NP_442193.1_1 Forward -227 -209 7.59063 0.288
NP_442105.1_9 Forward -313 -299 13.7693 0.294
NP_440876.1_5 Forward -47 -28 8.94757 0.277
NP_442809.1_6 Reverse -200 -219 0.982764 0.277
NP_440868.1_4 Forward -251 -239 1.80894 0.174
NP_441868.1_3 Forward -235 -216 21.0423 0.0982
NP_442402.1_4 Reverse -129 -148 -7.76943 0.278
NP_441084.1_6 Reverse -165 -179 15.2585 0.0931
NP_440653.1_10 Reverse -52 -71 6.09597 0.218
NP_440696.1_3 Forward -186 -168 12.1139 0.114
NP_442837.1_3 Forward -246 -239 13.5105 0.0268
NP_442837.1_3 Reverse -239 -246 6.13563 0.25
NP_442837.1_3 Reverse -137 -144 5.84064 0.272
NP_440160.1_2 Reverse -172 -191 -0.688862 0.232
NP_439994.1_3 Reverse -237 -256 9.99938 0.225
NP_442053.1_1 Forward -385 -376 4.71961 0.228
NP_440505.1_3 Reverse -341 -351 9.91146 0.122
NP_440505.1_3 Reverse -308 -318 9.7148 0.122
NP_440505.1_3 Reverse -316 -326 8.04317 0.147
NP_441203.1_1 Forward -246 -227 -20.1584 0.297
NP_440914.1_1 Reverse -376 -386 10.2742 0.147
NP_440914.1_1 Forward -319 -309 7.05364 0.254
NP_440914.1_1 Reverse -238 -248 6.66328 0.269
NP_441011.1_8 Forward -246 -237 11.6028 0.0754
NP_442101.1_10 Forward -57 -38 -5.80207 0.177
NP_442533.1_6 Reverse -238 -247 12.5861 0.0277
NP_442533.1_6 Reverse -167 -176 7.27622 0.0928
NP_442533.1_6 Forward -176 -167 7.17789 0.0948
NP_442533.1_6 Forward -60 -51 4.22796 0.186
NP_442533.1_6 Reverse -318 -327 2.65466 0.246
NP_442229.1_1 Forward -119 -105 5.80051 0.25
NP_443016.1_1 Forward -182 -163 -6.29373 0.258
NP_442535.1_9 Forward -256 -238 -4.11075 0.262
NP_441482.1_7 Reverse -232 -246 -9.24352 0.196
NP_441482.1_7 Forward -391 -377 -11.0135 0.229
NP_439944.1_1 Reverse -319 -338 18.2882 0.0726
NP_439944.1_9 Forward -246 -236 7.55152 0.138
NP_442269.1_10 Forward -188 -169 7.27595 0.197
NP_442269.1_10 Forward -226 -207 2.45773 0.276
NP_440116.1_8 Forward -246 -227 -0.197208 0.105
NP_440116.1_8 Reverse -52 -71 -5.70374 0.194
NP_440115.1_6 Reverse -307 -317 4.69992 0.288
NP_440007.1_9 Forward -64 -50 0.491246 0.297
NP_439903.1_6 Forward -76 -57 6.1935 0.172
NP_439903.1_6 Forward -52 -33 2.85027 0.219
NP_441286.1_1 Forward -248 -236 4.95553 0.027
NP_441286.1_1 Forward -177 -165 -5.17256 0.192
NP_441286.1_1 Forward -216 -204 -5.86088 0.229
NP_440886.1_7 Reverse -375 -385 6.27276 0.134
NP_442614.1_2 Forward -60 -46 7.57108 0.271
NP_441753.1_10 Reverse -367 -386 0.294447 0.296
NP_440907.2_8 Forward -318 -308 13.4509 0.0399
NP_440907.2_8 Reverse -137 -147 6.0761 0.179
NP_442264.1_2 Forward -251 -234 6.92201 0.25
NP_440326.1_5 Forward -249 -236 18.1122 0.179
NP_441463.1_5 Reverse -237 -251 14.5526 0.188
NP_441463.1_6 Forward -51 -37 10.1846 0.242
NP_441626.1_2 Reverse -239 -246 6.0373 0.212
NP_441626.1_2 Forward -246 -239 5.93897 0.231
NP_441626.1_8 Reverse -220 -239 19.2715 0.0736
NP_442365.1_7 Forward -389 -370 -1.47551 0.191
NP_442238.1_1 Reverse -58 -77 6.39097 0.175
NP_442794.1_1 Forward -389 -377 6.92215 0.154
NP_441962.1_5 Reverse -139 -158 8.06259 0.234
NP_440387.1_1 Reverse -238 -254 -4.85801 0.203
NP_440387.1_1 Reverse -40 -56 -6.52964 0.292
NP_440855.1_5 Reverse -136 -155 6.39016 0.285
NP_441993.1_1 Reverse -11 -30 4.87041 0.211
NP_442084.1_6 Reverse -49 -67 4.83737 0.276
NP_440114.1_10 Forward -247 -233 8.06273 0.217
NP_442090.1_10 Forward -193 -180 12.409 0.18
NP_442698.1_10 Reverse -163 -182 0.786102 0.297
NP_440293.1_3 Forward -183 -164 -5.99873 0.285
NP_440766.1_5 Forward -277 -265 8.61071 0.277
NP_439988.1_3 Forward -180 -166 5.21113 0.288
NP_441237.1_9 Forward -66 -56 11.2881 0.189
NP_440457.1_1 Forward -149 -137 5.05386 0.149
NP_440457.1_1 Reverse -372 -384 2.10393 0.217
NP_440457.1_1 Reverse -234 -246 0.137309 0.25
NP_441801.1_4 Reverse -219 -229 3.02829 0.231
NP_441801.1_4 Reverse -181 -191 2.92996 0.231
NP_441984.1_3 Reverse -47 -65 6.01734 0.276
NP_441436.1_9 Reverse -270 -280 16.8925 0.27
NP_440473.1_9 Reverse -227 -246 -7.37537 0.236
NP_442509.1_9 Reverse -310 -320 10.8943 0.152
NP_442509.1_9 Forward -385 -375 9.616 0.192
NP_442509.1_9 Forward -247 -237 7.74772 0.205
NP_442514.1_5 Forward -68 -49 5.80018 0.134
NP_442514.1_10 Reverse -45 -64 9.53756 0.253
NP_440185.1_9 Forward -236 -219 19.8034 0.0855
NP_440554.1_4 Forward -384 -374 2.04498 0.279
NP_441845.1_6 Forward -157 -139 -1.06249 0.28
NP_441885.1_5 Reverse -238 -248 10.2065 0.012
NP_441885.1_5 Reverse -376 -386 0.0783647 0.183
NP_441466.1_4 Reverse -114 -133 8.35759 0.295
NP_442341.1_7 Reverse -124 -138 4.32615 0.194
NP_442341.1_7 Reverse -375 -389 4.03116 0.204
NP_442341.1_7 Reverse -342 -356 1.47456 0.288
NP_442341.1_9 Reverse -374 -388 10.9137 0.133
NP_442341.1_9 Reverse -141 -155 5.99717 0.247
NP_442341.1_9 Reverse -334 -348 5.70218 0.258
NP_443000.1_7 Forward -249 -239 16.4013 0.0143
NP_443000.1_7 Reverse -236 -246 5.97822 0.125
NP_440507.2_6 Forward -169 -150 16.3224 0.235
NP_440727.1_3 Forward -41 -22 13.3725 0.276
NP_441842.1_1 Forward -317 -304 12.0151 0.23
NP_440091.1_1 Reverse -372 -384 7.4138 0.0828
NP_440091.1_1 Reverse -234 -246 5.93884 0.103
NP_441902.1_3 Forward -277 -267 15.4111 0.201
NP_443010.1_10 Forward -274 -257 5.09 0.211
NP_442451.1_2 Forward -255 -236 -10.6203 0.277
NP_440149.1_8 Forward -247 -228 -5.31042 0.223
NP_441105.1_3 Forward -71 -52 1.37609 0.114
NP_442373.1_2 Forward -218 -199 -11.3086 0.293
NP_440216.1_1 Forward -247 -233 -3.44199 0.082
NP_440216.1_9 Forward -58 -49 15.4377 0.132
NP_440216.1_9 Reverse -169 -178 6.98123 0.289
NP_440216.1_9 Reverse -208 -217 5.70292 0.29
NP_440172.1_1 Reverse -238 -248 14.4347 0.0126
NP_440172.1_1 Reverse -376 -386 3.42162 0.228
NP_440172.1_1 Reverse -40 -50 2.7333 0.268
NP_442015.1_10 Forward -251 -238 2.18257 0.199
NP_441226.1_4 Reverse -294 -313 13.7658 0.205
NP_441111.1_7 Forward -246 -238 8.86921 0.0589
NP_441766.1_2 Reverse -238 -247 8.25953 0.0612
NP_441766.1_2 Forward -385 -376 4.91628 0.154
NP_443052.1_8 Reverse -228 -247 -9.93197 0.198
NP_443052.1_8 Reverse -366 -385 -12.9802 0.27
NP_442403.1_8 Forward -245 -226 -0.885524 0.256
NP_440591.1_5 Reverse -214 -233 11.6017 0.218
NP_442154.1_1 Forward -223 -205 -16.3038 0.238
NP_440261.1_5 Forward -246 -233 -10.6988 0.203
NP_440261.1_7 Forward -311 -292 -4.81876 0.217
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCTGTATTGAGCAATCCTGATCGCCGTTCTGTGTACGACTTGCAAATTGGCTATTCCCGTTGGAATGTGATTCAGGTACCGCCGGATCCCCTCCAAGGGCAAAATTCGGCCGCATCAACAAGCTTGGGAAGAAATTCCGCCTATTTGGATGCTAGTGATCGCCCTTTGTCGGCGGGGGAGTTTTTTGCGCTGGCTCTGTTGGGTTTAACCCTGGGGGGCTGTTTGGCCTTGGCCCTGTTAATTGCCTGGCTGAGGGGGGATCCATTGGTAATTCCCAGCTTGTTACCATGGTTCATCAACTAAGGGAGTTTAATTTCATTCATTCCAAACGAATTCCATTGCCCATGGCAAGTAGATTGCCCTAATCTAGGCCAACTACCCACCTCCGCCCATTGACCTG

CDS

ATGTTAATTTTGAAAAATTCTATGGCATCCCCCCATCCTTTTCCCTGGCCCCAACGCTTCACCGTCATGGCTTTAACCTTTGCCTGGGGCTTGAGCTTGCCCGTGTTGGCCCAAACTAAGTCAGCGGTGCAATGGTACAACGATGGGGTGGACAAACTAGCGGCGCAAAATTTCTCCGGGGCGATCGCCGATTTTACCGAATCCATCAAACTCAATGACCAGGACGCCGATGCCTATTACAACCGGGGCTATGCCAAGCACGTTTTGGGGCAATACCAGGCGGCCATTACGGACTACAACCAGGCCATTAGTTTAAATCCTGAATTTGCCTATGCCCTGGGTAACCGTTGTTATGCTTATTTTTTACTGAGTCAGTACGACAAAGCCATTCAAGATTGCAGCAATGCCATCGAAATTAATCCCAACTATGCGGACTTTTATGTTTATCGGGGTAACTCCCAGTCCCAATTAGGCAATGAAACTACGGCGATCGCCGACTATAACGATGCCATTCGCATTAATGCCCAACATGCCAATGCCTATTACAACCGGGCGTTGACCCATAATCGTCTCAAGCAAGACCAACAAGCCTTAGCGGATTATAACCAAAGCATTCAGTTGGATCCCGACTCCGCTGAAGCCTATTTCAATCGAGGGTTAACCCAATATCGTCTGGGAGATGAACCCAAGGCGATCGCCGATTTAACCAAGGCCGCCGAATTATTCAACGCCCAAGAGAAAAAGGACATGGCCCAAAAAGCGGAAGCTATCCTGACCCAAATCCGGGCCATTGATGCTTAG

Protein

MLILKNSMASPHPFPWPQRFTVMALTFAWGLSLPVLAQTKSAVQWYNDGVDKLAAQNFSGAIADFTESIKLNDQDADAYYNRGYAKHVLGQYQAAITDYNQAISLNPEFAYALGNRCYAYFLLSQYDKAIQDCSNAIEINPNYADFYVYRGNSQSQLGNETTAIADYNDAIRINAQHANAYYNRALTHNRLKQDQQALADYNQSIQLDPDSAEAYFNRGLTQYRLGDEPKAIADLTKAAELFNAQEKKDMAQKAEAILTQIRAIDA