Your browser is old and dusty. Try Google Chrome!

Details for sll1666

ORF sll1666
Accession NP_440138.1
Symbol
Category Chaperones
Definition DnaJ-like protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -193 -179 6.6861 0.115
NP_441061.1_2 Reverse -186 -200 6.29277 0.121
NP_441061.1_2 Forward -221 -207 3.34284 0.165
NP_440557.1_1 Reverse -114 -133 -2.16383 0.284
NP_440795.1_7 Forward -193 -186 14.6904 0.0123
NP_440795.1_7 Reverse -186 -193 14.6904 0.0123
NP_441418.1_6 Reverse -185 -204 -0.885524 0.0111
NP_441418.1_6 Forward -194 -175 -29.3032 0.221
NP_442291.1_5 Reverse -212 -228 -1.61309 0.201
NP_442291.1_5 Reverse -184 -200 -2.98973 0.232
NP_442538.1_2 Forward -214 -195 17.5024 0.13
NP_440897.1_6 Forward -194 -175 -2.16459 0.205
NP_441453.1_4 Reverse -185 -193 16.539 0.00633
NP_441453.1_4 Forward -194 -186 16.539 0.00633
NP_441453.1_4 Forward -85 -77 4.34598 0.257
NP_441453.1_7 Reverse -252 -259 11.9372 0.298
NP_442877.1_3 Forward -96 -77 12.9783 0.214
NP_441960.1_3 Reverse -185 -204 14.8467 0.237
NP_442151.1_6 Forward -180 -166 9.04604 0.159
NP_442838.1_7 Forward -199 -180 -0.787193 0.121
NP_440226.1_1 Forward -194 -175 10.9142 0.0579
NP_440226.1_1 Reverse -185 -204 7.07928 0.114
NP_441630.1_3 Forward -202 -183 6.58763 0.126
NP_441630.1_3 Reverse -193 -212 -0.197208 0.285
NP_442173.1_1 Forward -193 -185 15.4574 0.00633
NP_442173.1_1 Reverse -186 -194 15.4574 0.00633
NP_442752.1_4 Forward -194 -187 13.8055 0.0199
NP_442752.1_4 Reverse -185 -192 13.8055 0.0199
NP_443027.1_4 Reverse -183 -193 14.828 0.0437
NP_443027.1_4 Forward -196 -186 13.943 0.0452
NP_443027.1_4 Forward -224 -214 7.45319 0.24
NP_443027.1_4 Forward -87 -77 5.87989 0.294
NP_441812.1_3 Reverse -184 -198 11.996 0.21
NP_441812.1_3 Forward -334 -320 8.55439 0.251
NP_442975.1_10 Forward -198 -184 12.8803 0.0459
NP_442975.1_10 Reverse -181 -195 4.42388 0.245
NP_440784.1_7 Forward -193 -186 15.9687 0.0123
NP_440784.1_7 Reverse -186 -193 15.9687 0.0123
NP_441250.1_3 Forward -30 -11 3.93269 0.252
NP_440061.1_9 Reverse -255 -269 5.30886 0.29
NP_440061.1_9 Reverse -78 -92 4.91554 0.3
NP_440110.1_8 Forward -196 -177 0.786102 0.211
NP_441476.1_5 Forward -199 -180 -1.37718 0.205
NP_442062.1_8 Forward -194 -184 19.4496 0.000558
NP_442062.1_8 Reverse -185 -195 19.4496 0.000558
NP_441859.1_3 Reverse -184 -203 8.35677 0.139
NP_441859.1_3 Forward -223 -204 6.09517 0.184
NP_441859.1_3 Forward -346 -327 3.73524 0.236
NP_440304.1_4 Reverse -183 -193 10.8948 0.051
NP_440304.1_4 Forward -196 -186 9.91146 0.051
NP_440304.1_4 Forward -32 -22 3.42162 0.299
NP_442242.1_4 Forward -193 -186 14.3954 0.0124
NP_442242.1_4 Reverse -186 -193 14.3954 0.0124
NP_440044.1_8 Reverse -186 -205 5.11266 0.106
NP_441200.1_4 Forward -177 -158 5.80098 0.294
NP_441208.1_1 Forward -267 -248 -5.60541 0.284
NP_442726.1_1 Reverse -180 -199 11.7008 0.184
NP_441925.1_2 Forward -50 -31 1.0811 0.282
NP_440769.1_8 Forward -61 -42 6.98095 0.286
NP_441083.1_5 Forward -194 -184 11.3864 0.0159
NP_441083.1_5 Reverse -185 -195 11.3864 0.0159
NP_441083.1_5 Forward -149 -139 2.83163 0.191
NP_442827.1_8 Reverse -177 -196 2.6536 0.156
NP_442827.1_8 Forward -202 -183 -2.95123 0.294
NP_441434.1_7 Reverse -187 -201 5.1128 0.225
NP_441434.1_8 Forward -29 -10 8.61937 0.285
NP_442245.1_1 Forward -277 -263 19.7641 0.258
NP_441738.1_2 Forward -192 -185 15.28 0.0102
NP_441738.1_2 Reverse -187 -194 15.28 0.0102
NP_441955.1_8 Reverse -188 -205 5.9387 0.287
NP_440209.1_1 Reverse -185 -193 18.1123 0.00295
NP_440209.1_1 Forward -194 -186 18.1123 0.00295
NP_442889.1_8 Forward -197 -183 11.2087 0.0735
NP_442889.1_8 Reverse -182 -196 2.8506 0.299
NP_440447.1_1 Forward -84 -66 3.75572 0.246
NP_440178.1_5 Reverse -191 -200 18.3876 0.137
NP_440178.1_7 Forward -195 -176 -22.2233 0.258
NP_442570.1_3 Reverse -68 -87 -6.58872 0.258
NP_442111.1_4 Forward -195 -181 7.76774 0.0867
NP_441831.1_5 Forward -54 -35 12.7825 0.201
NP_440906.1_5 Forward -193 -186 15.8704 0.0124
NP_440906.1_5 Reverse -186 -193 15.8704 0.0124
NP_440747.1_10 Forward -197 -185 -2.02597 0.0196
NP_440747.1_10 Reverse -182 -194 -2.1243 0.0225
NP_441130.1_10 Reverse -183 -197 20.3541 0.00768
NP_441486.1_1 Forward -197 -183 10.4227 0.0207
NP_441486.1_1 Reverse -182 -196 3.14618 0.0662
NP_441486.1_1 Reverse -73 -87 -0.295402 0.152
NP_442634.1_4 Forward -196 -182 -3.54032 0.161
NP_441265.1_3 Reverse -165 -179 1.17956 0.217
NP_440403.1_4 Forward -203 -184 -7.37537 0.241
NP_440403.1_10 Reverse -185 -204 2.94938 0.278
NP_441014.1_8 Forward -102 -83 -3.3438 0.242
NP_441014.1_10 Forward -195 -176 1.47364 0.227
NP_441014.1_10 Reverse -112 -131 -0.0996487 0.246
NP_442848.1_1 Forward -200 -186 -3.63866 0.268
NP_442848.1_1 Reverse -179 -193 -4.03198 0.279
NP_441012.1_4 Forward -220 -207 8.47575 0.272
NP_441012.1_4 Forward -250 -237 5.42749 0.297
NP_443018.1_3 Forward -193 -186 14.8871 0.0123
NP_443018.1_3 Reverse -186 -193 14.8871 0.0123
NP_443018.1_3 Forward -84 -77 12.5271 0.0523
NP_443018.1_3 Reverse -77 -84 12.5271 0.0523
NP_443018.1_3 Reverse -214 -221 4.26735 0.267
NP_443018.1_3 Forward -221 -214 4.07068 0.299
NP_441316.1_7 Reverse -183 -198 -3.36336 0.273
NP_441634.1_1 Reverse -71 -90 -3.3438 0.275
NP_441634.1_8 Reverse -183 -197 12.1926 0.0529
NP_441634.1_8 Reverse -74 -88 -4.62196 0.295
NP_440376.1_1 Forward -194 -185 19.4693 0.000692
NP_440376.1_1 Reverse -185 -194 19.4693 0.000692
NP_441857.1_5 Forward -201 -183 3.46073 0.244
NP_441588.1_4 Reverse -187 -197 6.96153 0.178
NP_442687.1_7 Forward -195 -185 15.8113 0.0125
NP_442687.1_7 Reverse -184 -194 15.8113 0.0125
NP_442687.1_7 Reverse -242 -252 3.81494 0.286
NP_442485.1_3 Forward -101 -82 5.11266 0.169
NP_442485.1_3 Forward -205 -186 -1.7705 0.261
NP_440642.1_10 Reverse -162 -176 5.1122 0.242
NP_442658.1_1 Forward -196 -186 18.7607 0.00222
NP_442658.1_1 Reverse -183 -193 15.9091 0.00966
NP_442658.1_1 Forward -87 -77 5.97777 0.242
NP_442658.1_1 Reverse -241 -251 4.7978 0.297
NP_442782.1_2 Reverse -16 -30 8.84938 0.198
NP_442782.1_2 Forward -194 -180 3.34284 0.265
NP_442782.1_2 Forward -30 -16 1.86788 0.281
NP_440656.1_8 Forward -205 -186 -7.96535 0.27
NP_441414.1_9 Forward -194 -175 3.44104 0.0588
NP_441487.1_9 Reverse -149 -168 -0.0988766 0.247
NP_442937.1_5 Forward -199 -180 15.7324 0.0546
NP_441317.1_4 Reverse -307 -321 15.6709 0.161
NP_441958.1_5 Forward -195 -185 12.2714 0.00183
NP_441958.1_5 Reverse -184 -194 12.2714 0.00183
NP_439905.1_1 Forward -84 -71 6.70579 0.279
NP_442876.1_3 Forward -36 -17 4.71934 0.281
NP_440984.1_7 Forward -199 -185 6.88276 0.195
NP_440984.1_7 Reverse -255 -269 5.99778 0.231
NP_442911.1_2 Reverse -175 -194 6.09597 0.03
NP_440153.1_5 Reverse -186 -200 0.392915 0.299
NP_442119.1_9 Reverse -184 -203 11.1109 0.248
NP_443055.1_6 Forward -202 -184 11.0314 0.114
NP_440993.1_2 Reverse -180 -196 2.12349 0.269
NP_440993.1_2 Forward -199 -183 1.33684 0.284
NP_440138.1_1 Forward -252 -234 25.781 0.0115
NP_440138.1_2 Forward -391 -372 23.733 0.00329
NP_440138.1_4 Forward -229 -210 29.6954 0.000506
NP_440138.1_5 Forward -334 -315 28.6129 0.00105
NP_440138.1_7 Forward -355 -337 17.9545 0.245
NP_441099.1_5 Forward -204 -185 -5.21209 0.15
NP_442002.1_9 Forward -195 -188 10.7572 0.185
NP_442002.1_9 Reverse -184 -191 10.7572 0.185
NP_442567.1_3 Reverse -297 -313 13.5299 0.238
NP_442013.1_10 Reverse -200 -219 13.3725 0.109
NP_441294.1_7 Forward -198 -184 8.57871 0.294
NP_441646.1_1 Reverse -178 -197 3.83436 0.204
NP_442438.1_10 Reverse -180 -194 14.0609 0.0322
NP_442438.1_10 Forward -199 -185 3.04785 0.166
NP_441000.1_6 Reverse -184 -198 13.2743 0.0396
NP_441000.1_6 Forward -195 -181 4.71948 0.0933
NP_441000.1_6 Reverse -75 -89 -4.7203 0.251
NP_442771.1_1 Forward -196 -178 11.8189 0.0174
NP_440147.1_3 Reverse -143 -162 2.45773 0.278
NP_440147.1_4 Reverse -183 -196 11.524 0.0326
NP_440147.1_4 Forward -196 -183 2.08423 0.21
NP_441550.1_8 Forward -196 -186 10.501 0.066
NP_441550.1_8 Reverse -169 -179 8.3377 0.124
NP_441550.1_8 Reverse -183 -193 6.0761 0.214
NP_441916.1_7 Forward -194 -184 18.4663 0.00144
NP_441916.1_7 Reverse -185 -195 18.4663 0.00144
NP_441041.1_4 Forward -194 -175 -7.17871 0.182
NP_441041.1_7 Forward -197 -185 19.5648 0.00277
NP_442396.1_5 Reverse -181 -194 15.3589 0.0669
NP_443063.1_2 Forward -107 -88 4.42435 0.299
NP_442004.1_6 Forward -194 -180 3.04785 0.251
NP_440703.1_9 Forward -85 -72 7.19687 0.266
NP_441725.1_5 Forward -193 -183 11.2881 0.0247
NP_441725.1_5 Reverse -186 -196 9.02648 0.0553
NP_439966.1_7 Reverse -183 -193 18.4657 0.00473
NP_439966.1_7 Forward -196 -186 17.4824 0.00636
NP_439966.1_9 Forward -196 -187 10.7178 0.0863
NP_439966.1_9 Reverse -183 -192 0.983037 0.253
NP_442941.1_3 Forward -193 -183 11.4848 0.0116
NP_442941.1_3 Reverse -186 -196 2.53664 0.14
NP_440289.1_2 Forward -197 -184 12.999 0.0132
NP_440289.1_2 Reverse -182 -195 5.13249 0.0636
NP_440260.1_8 Reverse -176 -194 -7.06068 0.295
NP_442281.1_1 Forward -199 -185 18.7801 0.00389
NP_442281.1_1 Reverse -180 -194 1.76896 0.29
NP_441334.1_7 Forward -196 -177 -19.7651 0.275
NP_442575.1_7 Reverse -123 -142 9.83255 0.27
NP_442575.1_8 Forward -179 -160 -0.590531 0.232
NP_440437.1_1 Reverse -179 -198 5.70265 0.0851
NP_442012.1_1 Reverse -143 -162 3.14605 0.186
NP_441644.1_6 Forward -194 -184 10.1076 0.0628
NP_441644.1_6 Reverse -185 -195 10.1076 0.0628
NP_441644.1_6 Forward -85 -75 9.12434 0.084
NP_440867.1_10 Reverse -184 -203 1.47442 0.295
NP_442215.1_2 Forward -196 -180 -7.11963 0.286
NP_442247.1_6 Reverse -242 -261 11.7008 0.219
NP_440253.1_2 Reverse -185 -203 19.9803 0.00546
NP_440253.1_2 Reverse -295 -313 2.28076 0.141
NP_440253.1_2 Forward -194 -176 -2.93078 0.28
NP_440253.1_2 Reverse -90 -108 -3.42244 0.294
NP_440929.1_8 Forward -194 -185 19.2726 0.000701
NP_440929.1_8 Reverse -185 -194 19.2726 0.000701
NP_442933.1_10 Forward -194 -185 17.601 0.00325
NP_442933.1_10 Reverse -185 -194 17.601 0.00325
NP_441751.2_8 Forward -193 -179 -1.5737 0.129
NP_441751.2_8 Reverse -186 -200 -3.93365 0.157
NP_442554.1_8 Reverse -186 -196 16.008 0.0065
NP_442554.1_8 Forward -193 -183 13.8447 0.0145
NP_442554.1_8 Forward -84 -74 9.81313 0.0545
NP_442554.1_8 Forward -221 -211 4.10993 0.198
NP_442554.1_8 Reverse -77 -87 2.33998 0.274
NP_442554.1_8 Reverse -214 -224 1.74999 0.298
NP_442554.1_9 Reverse -110 -129 15.457 0.217
NP_441762.1_7 Reverse -184 -196 21.5735 0.00342
NP_441762.1_7 Forward -195 -183 12.0354 0.0142
NP_442313.1_5 Reverse -180 -199 11.7008 0.185
NP_442142.1_4 Forward -197 -184 16.4399 0.0264
NP_442142.1_4 Reverse -182 -195 10.4418 0.0724
NP_442142.1_9 Forward -201 -182 0.982764 0.291
NP_442142.1_9 Forward -106 -87 0.982764 0.291
NP_442292.1_1 Forward -193 -184 9.63616 0.0183
NP_442292.1_1 Reverse -186 -195 9.63616 0.0183
NP_442292.1_1 Forward -84 -75 5.21127 0.152
NP_442292.1_1 Forward -221 -212 5.11294 0.162
NP_442476.1_6 Forward -193 -179 1.96621 0.199
NP_440895.1_10 Reverse -184 -201 -5.36936 0.29
NP_442381.1_8 Forward -197 -178 3.73603 0.0708
NP_442381.1_8 Reverse -182 -201 -14.3569 0.28
NP_443009.1_5 Reverse -184 -195 11.6612 0.0602
NP_443009.1_5 Forward -195 -184 11.6612 0.0602
NP_443009.1_5 Forward -253 -242 7.62965 0.124
NP_441715.1_4 Forward -193 -183 16.303 0.0117
NP_441715.1_4 Reverse -186 -196 9.32148 0.097
NP_440015.1_9 Forward -194 -176 0.21581 0.255
NP_440183.1_9 Forward -250 -231 -20.0601 0.282
NP_441468.1_1 Forward -193 -186 15.8704 0.0124
NP_441468.1_1 Reverse -186 -193 15.8704 0.0124
NP_441468.1_1 Reverse -214 -221 4.07068 0.263
NP_441468.1_1 Reverse -77 -84 3.97235 0.277
NP_441468.1_1 Forward -84 -77 3.97235 0.277
NP_441020.2_6 Forward -196 -179 22.7533 0.00162
NP_441020.2_6 Reverse -183 -200 18.4267 0.0118
NP_441015.1_10 Reverse -71 -90 -3.14714 0.185
NP_441673.1_1 Forward -194 -185 20.8459 0.000698
NP_441673.1_1 Reverse -185 -194 20.8459 0.000698
NP_440265.1_8 Forward -319 -301 12.9005 0.282
NP_441826.1_2 Forward -200 -186 1.57289 0.147
NP_442490.1_6 Reverse -139 -158 17.994 0.241
NP_442490.1_9 Reverse -173 -192 -7.76869 0.278
NP_442868.1_6 Forward -196 -186 8.53483 0.0555
NP_442868.1_6 Reverse -183 -193 0.963343 0.205
NP_442719.1_2 Forward -25 -7 -11.0929 0.287
NP_441911.1_10 Forward -128 -109 13.4757 0.21
NP_442808.1_1 Forward -195 -185 18.4657 0.00201
NP_442808.1_1 Reverse -184 -194 18.4657 0.00201
NP_442820.1_3 Reverse -79 -89 13.2542 0.277
NP_442542.1_2 Forward -196 -183 12.409 0.114
NP_442542.1_9 Forward -201 -187 11.9953 0.11
NP_442050.1_5 Reverse -183 -193 9.12434 0.193
NP_442050.1_5 Forward -196 -186 8.23937 0.234
NP_442342.1_9 Forward -161 -145 7.04003 0.216
NP_441114.1_4 Forward -257 -246 17.9549 0.263
NP_440558.1_2 Forward -89 -70 -3.44213 0.236
NP_440558.1_2 Reverse -110 -129 -5.70374 0.264
NP_442789.1_4 Forward -196 -177 -3.54046 0.25
NP_442789.1_4 Reverse -313 -332 -8.06369 0.299
NP_441518.1_3 Forward -204 -185 6.19431 0.05
NP_441518.1_3 Reverse -175 -194 -7.17871 0.152
NP_441878.1_4 Forward -175 -156 15.5357 0.0798
NP_441878.1_6 Forward -195 -185 10.4031 0.0176
NP_441878.1_6 Reverse -184 -194 10.4031 0.0176
NP_441878.1_6 Reverse -200 -210 -7.98478 0.285
NP_441036.1_8 Forward -195 -185 17.7779 0.000554
NP_441036.1_8 Reverse -184 -194 17.7779 0.000554
NP_441557.1_5 Forward -194 -185 19.9609 0.000699
NP_441557.1_5 Reverse -185 -194 19.9609 0.000699
NP_441445.1_1 Reverse -176 -195 0.491109 0.275
NP_441445.1_1 Reverse -195 -214 0.0977854 0.283
NP_442066.2_9 Forward -198 -185 8.47575 0.185
NP_442419.1_2 Forward -199 -180 0.58944 0.242
NP_441739.1_2 Forward -159 -143 2.02449 0.288
NP_441308.1_8 Reverse -183 -193 10.1081 0.22
NP_441308.1_8 Forward -196 -186 9.22315 0.226
NP_440101.1_3 Reverse -65 -84 10.9142 0.111
NP_441458.1_10 Reverse -176 -195 1.96607 0.277
NP_442183.1_1 Reverse -185 -199 18.8791 0.00656
NP_442183.1_1 Forward -194 -180 11.8976 0.0663
NP_441407.1_5 Forward -204 -185 6.19431 0.197
NP_442444.1_6 Reverse -177 -195 12.437 0.272
NP_442464.1_7 Forward -150 -131 13.2741 0.261
NP_442347.1_2 Forward -193 -184 11.1111 0.056
NP_442347.1_2 Reverse -186 -195 11.1111 0.056
NP_442347.1_2 Reverse -289 -298 7.96454 0.122
NP_442645.1_2 Reverse -177 -196 -4.13045 0.054
NP_441037.1_4 Forward -196 -186 16.2838 0.0168
NP_441037.1_4 Reverse -183 -193 7.02532 0.237
NP_442317.1_6 Reverse -238 -257 4.52268 0.247
NP_441633.1_3 Reverse -183 -196 13.3923 0.018
NP_441633.1_3 Forward -196 -183 3.5592 0.0699
NP_441633.1_3 Reverse -241 -254 -5.38892 0.236
NP_441633.1_3 Reverse -88 -101 -5.48725 0.236
NP_440136.1_2 Forward -193 -186 15.9687 0.0123
NP_440136.1_2 Reverse -186 -193 15.9687 0.0123
NP_442998.1_5 Forward -54 -44 10.8948 0.201
NP_442998.1_10 Forward -192 -185 15.5754 0.0102
NP_442998.1_10 Reverse -187 -194 15.5754 0.0102
NP_442998.1_10 Forward -226 -219 7.21728 0.144
NP_440299.1_1 Reverse -181 -194 16.8333 0.00835
NP_441799.1_1 Reverse -181 -195 12.5853 0.0421
NP_441799.1_1 Forward -198 -184 11.602 0.0558
NP_441007.1_10 Forward -199 -186 3.26421 0.182
NP_441007.1_10 Reverse -71 -84 -0.865694 0.295
NP_442334.1_10 Reverse -244 -263 -16.8151 0.282
NP_442201.1_10 Reverse -174 -193 2.26107 0.107
NP_440256.1_1 Forward -197 -178 -1.18052 0.101
NP_440256.1_1 Reverse -182 -201 -2.85214 0.123
NP_440087.1_1 Reverse -234 -253 -7.57203 0.276
NP_441559.1_8 Reverse -252 -266 -6.19526 0.275
NP_441559.1_8 Forward -153 -139 -6.49025 0.279
NP_440915.1_6 Forward -198 -184 6.3911 0.0826
NP_440915.1_6 Reverse -181 -195 2.65453 0.113
NP_441179.1_9 Forward -87 -77 13.6475 0.246
NP_441866.1_4 Reverse -308 -321 13.0504 0.276
NP_442866.1_1 Forward -185 -166 -2.45882 0.214
NP_441464.1_8 Reverse -185 -199 7.9644 0.204
NP_441464.1_8 Reverse -150 -164 5.1128 0.26
NP_441464.1_10 Reverse -61 -75 8.45605 0.281
NP_441113.1_3 Forward -169 -155 16.0269 0.235
NP_441939.1_3 Reverse -77 -96 7.07928 0.212
NP_442993.1_1 Reverse -185 -201 -7.80794 0.146
NP_442993.1_1 Forward -194 -178 -9.08625 0.179
NP_442386.1_9 Reverse -184 -193 15.7322 0.0144
NP_442386.1_9 Forward -195 -186 15.7322 0.0144
NP_442386.1_9 Forward -86 -77 13.1756 0.0406
NP_442386.1_9 Reverse -75 -84 9.04574 0.175
NP_441340.1_5 Forward -193 -186 15.6737 0.0124
NP_441340.1_5 Reverse -186 -193 15.6737 0.0124
NP_441340.1_5 Reverse -77 -84 4.07068 0.239
NP_441340.1_5 Forward -84 -77 4.07068 0.239
NP_441340.1_5 Forward -221 -214 3.97235 0.274
NP_442484.1_9 Reverse -226 -245 18.6815 0.136
NP_442791.1_5 Reverse -177 -196 -7.86702 0.279
NP_442240.1_2 Forward -193 -174 -4.72043 0.0848
NP_440161.1_3 Forward -254 -235 9.93088 0.237
NP_440161.1_3 Reverse -183 -202 9.24257 0.251
NP_440586.1_8 Forward -193 -186 13.2151 0.026
NP_440586.1_8 Reverse -186 -193 13.2151 0.026
NP_440586.1_8 Forward -221 -214 9.57686 0.146
NP_440586.1_8 Forward -84 -77 7.61025 0.227
NP_440586.1_8 Reverse -77 -84 7.61025 0.227
NP_440586.1_8 Reverse -172 -179 7.41359 0.251
NP_442251.1_6 Forward -193 -186 15.2804 0.0124
NP_442251.1_6 Reverse -186 -193 15.2804 0.0124
NP_442251.1_6 Reverse -337 -344 6.43063 0.298
NP_442959.1_4 Reverse -71 -90 6.19431 0.224
NP_441262.1_3 Reverse -185 -192 14.7888 0.0223
NP_441262.1_3 Forward -194 -187 14.7888 0.0223
NP_443051.1_1 Reverse -184 -193 10.4228 0.00754
NP_443051.1_1 Forward -195 -186 10.4228 0.00754
NP_441232.1_10 Reverse -174 -193 4.62101 0.193
NP_439937.1_8 Reverse -183 -202 -5.40875 0.295
NP_439937.1_9 Forward -305 -288 -12.6465 0.274
NP_440408.1_7 Forward -173 -154 10.3242 0.247
NP_440408.1_7 Reverse -336 -355 7.17762 0.291
NP_440626.1_1 Reverse -186 -205 13.2733 0.203
NP_440439.1_1 Forward -197 -184 9.65572 0.0447
NP_440439.1_1 Reverse -182 -195 8.27909 0.0547
NP_440372.1_2 Forward -193 -186 16.3621 0.0124
NP_440372.1_2 Reverse -186 -193 16.3621 0.0124
NP_441181.1_6 Reverse -186 -204 7.59063 0.219
NP_439977.1_5 Reverse -179 -198 -2.95047 0.293
NP_440139.1_1 Reverse -179 -198 14.5516 0.048
NP_440139.1_1 Forward -186 -167 11.3067 0.0819
NP_440139.1_1 Forward -200 -181 7.07848 0.137
NP_441572.1_7 Forward -186 -167 -6.09707 0.281
NP_440267.1_3 Forward -235 -221 20.6379 0.232
NP_442384.1_10 Forward -194 -181 15.0639 0.0117
NP_442114.1_4 Reverse -185 -196 12.1534 0.107
NP_441877.1_5 Reverse -105 -124 -1.08219 0.283
NP_441018.1_3 Reverse -123 -142 10.9134 0.286
NP_441018.1_7 Reverse -72 -91 13.4708 0.135
NP_442790.1_4 Forward -203 -184 -15.3402 0.293
NP_442262.1_10 Forward -193 -186 14.1988 0.0123
NP_442262.1_10 Reverse -186 -193 14.1988 0.0123
NP_442262.1_10 Forward -84 -77 10.4622 0.145
NP_442262.1_10 Reverse -77 -84 10.4622 0.145
NP_441689.1_5 Reverse -183 -193 8.53436 0.132
NP_440163.1_10 Reverse -182 -192 14.238 0.102
NP_440344.1_10 Forward -201 -184 13.8052 0.00599
NP_440344.1_10 Reverse -178 -195 -0.452814 0.0426
NP_440531.1_6 Reverse -89 -108 2.65439 0.152
NP_442123.1_3 Reverse -185 -204 16.2241 0.0904
NP_441965.1_10 Forward -88 -72 4.3851 0.242
NP_440297.1_9 Forward -193 -183 9.32148 0.0917
NP_440297.1_9 Forward -84 -74 0.176696 0.282
NP_440297.1_9 Reverse -186 -196 -0.216628 0.282
NP_440297.1_9 Reverse -214 -224 -0.41329 0.283
NP_442280.1_10 Reverse -115 -133 4.67522 0.296
NP_441896.1_3 Forward -203 -184 0.0977854 0.23
NP_440999.1_9 Forward -198 -184 5.1128 0.113
NP_440888.1_2 Forward -194 -180 17.6985 0.00337
NP_440888.1_2 Reverse -185 -199 15.6336 0.00976
NP_442892.1_9 Reverse -112 -126 14.5519 0.293
NP_440491.1_1 Forward -197 -178 8.18396 0.249
NP_442948.1_2 Reverse -184 -203 4.03102 0.274
NP_442277.1_4 Forward -203 -184 5.2102 0.175
NP_442033.1_10 Forward -268 -249 -8.85033 0.207
NP_441543.1_2 Forward -193 -184 18.486 0.00236
NP_441543.1_2 Reverse -186 -195 18.486 0.00236
NP_442845.1_2 Reverse -70 -84 7.37441 0.195
NP_442845.1_8 Forward -306 -287 15.2408 0.291
NP_441319.1_8 Reverse -179 -197 6.31233 0.27
NP_441469.1_8 Reverse -184 -193 16.126 0.00797
NP_441469.1_8 Forward -195 -186 16.126 0.00797
NP_441469.1_8 Forward -86 -77 5.60459 0.258
NP_442578.1_7 Forward -193 -186 14.5921 0.026
NP_442578.1_7 Reverse -186 -193 14.5921 0.026
NP_440710.1_1 Reverse -177 -195 8.47561 0.102
NP_440220.1_4 Reverse -112 -131 -0.39464 0.262
NP_441462.1_2 Forward -194 -184 11.5831 0.00406
NP_441462.1_2 Reverse -185 -195 11.5831 0.00406
NP_441621.1_7 Forward -196 -182 6.09611 0.068
NP_441621.1_7 Reverse -183 -197 6.09611 0.068
NP_441621.1_7 Forward -205 -191 -4.22864 0.214
NP_441621.1_7 Forward -101 -87 -5.21195 0.248
NP_441929.1_6 Forward -79 -60 9.53756 0.262
NP_441929.1_6 Forward -66 -47 9.24257 0.262
NP_443062.1_1 Forward -222 -204 5.81572 0.218
NP_443062.1_1 Forward -194 -176 5.03566 0.242
NP_443062.1_6 Reverse -235 -254 10.1275 0.118
NP_440519.1_8 Forward -268 -252 4.97508 0.21
NP_441351.1_8 Reverse -192 -211 0.0977854 0.292
NP_440516.1_8 Forward -194 -185 16.9127 0.00442
NP_440516.1_8 Reverse -185 -194 16.9127 0.00442
NP_441785.1_1 Reverse -185 -199 12.4475 0.245
NP_442428.1_5 Forward -193 -186 15.8704 0.0124
NP_442428.1_5 Reverse -186 -193 15.8704 0.0124
NP_442428.1_5 Reverse -214 -221 4.46401 0.267
NP_442428.1_5 Forward -84 -77 4.36568 0.271
NP_442428.1_5 Reverse -77 -84 4.36568 0.271
NP_440783.1_5 Forward -185 -166 1.37609 0.19
NP_441353.1_7 Forward -198 -180 15.358 0.291
NP_442859.1_2 Forward -193 -174 13.8641 0.0878
NP_442859.1_2 Reverse -77 -96 4.22769 0.219
NP_442859.1_6 Forward -84 -65 4.91521 0.253
NP_440673.1_2 Forward -204 -185 12.3406 0.149
NP_440673.1_3 Forward -192 -185 12.4288 0.0426
NP_440673.1_3 Reverse -187 -194 12.4288 0.0426
NP_440673.1_3 Forward -250 -243 8.98723 0.203
NP_441052.1_2 Forward -194 -184 10.5014 0.0285
NP_441052.1_2 Reverse -185 -195 10.5014 0.0285
NP_442219.1_9 Forward -193 -184 8.35786 0.0681
NP_442219.1_9 Reverse -186 -195 8.35786 0.0681
NP_442219.1_9 Reverse -71 -80 1.76968 0.298
NP_440436.1_4 Forward -193 -184 18.1905 0.00233
NP_440436.1_4 Reverse -186 -195 18.1905 0.00233
NP_440436.1_4 Forward -251 -242 8.75075 0.0995
NP_440436.1_4 Reverse -77 -86 4.42421 0.265
NP_441884.1_9 Reverse -182 -201 -13.8652 0.138
NP_441884.1_9 Forward -197 -178 -22.125 0.275
NP_442086.1_3 Forward -193 -174 11.7992 0.176
NP_440314.1_9 Forward -156 -137 -10.227 0.291
NP_442907.1_9 Forward -168 -149 -4.91709 0.282
NP_441719.1_4 Forward -193 -186 16.3621 0.0124
NP_441719.1_4 Reverse -186 -193 16.3621 0.0124
NP_441733.1_10 Forward -197 -184 19.9805 0.0151
NP_441733.1_10 Reverse -182 -195 7.49244 0.153
NP_441004.1_1 Reverse -195 -214 -16.1268 0.283
NP_442366.1_3 Reverse -184 -202 7.59063 0.0743
NP_442366.1_3 Forward -195 -177 -3.22577 0.244
NP_442694.1_3 Reverse -66 -84 2.57575 0.265
NP_443054.1_2 Reverse -183 -197 22.0257 0.00482
NP_443054.1_2 Reverse -293 -307 1.86788 0.245
NP_441851.1_10 Forward -195 -185 16.008 0.00552
NP_441851.1_10 Reverse -184 -194 16.008 0.00552
NP_441851.1_10 Reverse -75 -85 4.10993 0.287
NP_442622.1_1 Reverse -184 -203 -11.4069 0.257
NP_442515.1_1 Reverse -184 -198 -3.44199 0.29
NP_442515.1_1 Forward -195 -181 -4.4253 0.298
NP_441982.1_6 Forward -57 -48 13.0583 0.274
NP_440432.1_9 Reverse -186 -201 19.1544 0.00961
NP_442758.1_7 Reverse -162 -181 17.7974 0.295
NP_440474.1_8 Reverse -186 -200 17.3052 0.0432
NP_440474.1_8 Forward -193 -179 16.4202 0.0486
NP_440474.1_8 Reverse -325 -339 10.6187 0.13
NP_442450.1_5 Reverse -183 -193 9.32148 0.115
NP_440588.1_2 Reverse -162 -181 1.27776 0.138
NP_440588.1_2 Reverse -67 -86 -6.09707 0.269
NP_442006.1_2 Forward -203 -186 -16.5791 0.256
NP_443047.1_7 Forward -193 -174 5.99764 0.228
NP_441570.1_1 Reverse -70 -88 -3.42244 0.0709
NP_441570.1_1 Forward -194 -176 -6.4707 0.0796
NP_441570.1_1 Reverse -185 -203 -9.0273 0.127
NP_441078.1_4 Forward -194 -185 19.6659 0.0007
NP_441078.1_4 Reverse -185 -194 19.6659 0.0007
NP_442729.1_8 Reverse -181 -194 9.85238 0.125
NP_441663.1_7 Reverse -182 -201 7.96426 0.209
NP_440526.1_3 Forward -221 -210 14.6111 0.0646
NP_440526.1_3 Reverse -186 -197 11.7595 0.0646
NP_441432.1_8 Reverse -184 -193 8.25953 0.0755
NP_441432.1_8 Forward -195 -186 8.25953 0.0755
NP_441432.1_8 Forward -80 -71 5.3096 0.17
NP_442320.1_8 Forward -200 -186 14.1593 0.0138
NP_442320.1_8 Reverse -179 -193 6.6861 0.0257
NP_441732.1_2 Reverse -181 -197 -16.3627 0.165
NP_440760.1_1 Forward -194 -175 -17.7985 0.204
NP_442797.1_6 Reverse -154 -173 7.54634 0.283
NP_442797.1_7 Forward -98 -80 0.0191479 0.279
NP_443011.1_4 Reverse -124 -143 9.3409 0.225
NP_441023.1_1 Reverse -260 -278 12.9005 0.233
NP_442400.1_1 Reverse -87 -106 -4.72043 0.275
NP_442400.1_10 Forward -313 -300 12.8577 0.2
NP_442489.1_2 Forward -205 -186 0.884433 0.297
NP_442489.1_7 Forward -194 -185 20.1576 0.000695
NP_442489.1_7 Reverse -185 -194 20.1576 0.000695
NP_442079.1_7 Forward -193 -174 1.76941 0.241
NP_440559.1_1 Reverse -186 -195 8.75118 0.0586
NP_440559.1_1 Forward -193 -184 8.75118 0.0586
NP_441659.2_8 Forward -194 -184 11.9764 0.0147
NP_441659.2_8 Reverse -185 -195 11.9764 0.0147
NP_441659.2_8 Forward -85 -75 0.766681 0.258
NP_441659.2_8 Forward -222 -212 -0.118297 0.287
NP_440708.1_6 Reverse -72 -91 -3.83545 0.225
NP_440779.1_5 Reverse -185 -202 13.4119 0.0212
NP_442346.1_5 Forward -195 -185 9.02648 0.118
NP_442346.1_5 Reverse -184 -194 9.02648 0.118
NP_442346.1_5 Reverse -75 -85 4.79825 0.272
NP_442346.1_10 Reverse -183 -202 3.14605 0.194
NP_440545.1_3 Forward -269 -252 -0.747806 0.157
NP_440545.1_3 Forward -198 -181 -4.97604 0.237
NP_440545.1_3 Reverse -72 -89 -6.35267 0.276
NP_440831.1_3 Forward -210 -191 5.80468 0.28
NP_440486.1_6 Forward -174 -155 10.2259 0.219
NP_440459.1_2 Forward -182 -165 12.5269 0.146
NP_440459.1_2 Forward -94 -77 9.28195 0.23
NP_441653.1_2 Forward -107 -88 14.256 0.0943
NP_441653.1_2 Reverse -202 -221 7.10507 0.223
NP_441653.1_2 Reverse -325 -344 6.52526 0.23
NP_440010.1_4 Reverse -203 -222 6.48849 0.199
NP_440010.1_4 Forward -198 -179 -0.984623 0.267
NP_442027.1_5 Reverse -244 -263 11.1109 0.269
NP_441888.1_7 Forward -199 -185 2.35953 0.225
NP_441888.1_7 Reverse -238 -252 1.67122 0.241
NP_441948.1_4 Reverse -178 -196 8.47561 0.0623
NP_441948.1_4 Forward -201 -183 0.0191479 0.137
NP_441833.1_4 Forward -193 -186 15.9687 0.0124
NP_441833.1_4 Reverse -186 -193 15.9687 0.0124
NP_442436.1_4 Reverse -121 -135 22.3207 0.15
NP_442162.1_9 Forward -193 -186 16.2637 0.0124
NP_442162.1_9 Reverse -186 -193 16.2637 0.0124
NP_442199.1_5 Forward -93 -74 2.85105 0.141
NP_442199.1_5 Reverse -177 -196 -1.86883 0.183
NP_442140.1_3 Reverse -186 -196 17.4829 0.0159
NP_442140.1_3 Forward -221 -211 9.22315 0.111
NP_442140.1_3 Reverse -77 -87 9.12481 0.111
NP_442140.1_3 Forward -84 -74 8.4365 0.119
NP_442140.1_3 Forward -193 -183 8.33817 0.119
NP_440875.1_9 Reverse -187 -197 17.619 0.0104
NP_440875.1_9 Reverse -78 -88 6.81464 0.297
NP_441813.1_5 Reverse -183 -193 17.188 0.00979
NP_441813.1_5 Forward -196 -186 10.0098 0.0208
NP_440590.1_4 Reverse -186 -199 4.8375 0.0585
NP_440590.1_4 Forward -193 -180 1.69091 0.115
NP_440567.1_1 Forward -193 -179 17.2075 0.0153
NP_440567.1_1 Reverse -186 -200 9.04604 0.0501
NP_442497.1_10 Forward -193 -184 10.4228 0.0087
NP_442497.1_10 Reverse -186 -195 10.4228 0.0087
NP_440821.1_4 Reverse -183 -193 19.0562 0.00399
NP_440821.1_4 Forward -196 -186 18.7612 0.00422
NP_441239.1_9 Forward -196 -184 18.6235 0.0114
NP_441239.1_9 Reverse -183 -195 15.8703 0.0178
NP_441239.1_9 Forward -87 -75 8.59377 0.128
NP_441892.1_1 Forward -203 -186 -5.86102 0.29
NP_442643.1_1 Reverse -179 -198 -11.2103 0.231
NP_441017.1_6 Forward -126 -112 16.7152 0.0651
NP_441017.1_6 Forward -226 -212 12.192 0.224
NP_441567.1_4 Reverse -296 -315 2.3594 0.297
NP_440354.1_7 Reverse -179 -197 11.0322 0.224
NP_442138.1_1 Forward -196 -177 -0.197979 0.298
NP_442138.1_10 Reverse -185 -204 -5.31042 0.269
NP_442809.1_6 Forward -91 -72 6.58763 0.256
NP_440546.1_4 Forward -194 -184 11.8882 0.0679
NP_440546.1_4 Reverse -185 -195 11.8882 0.0679
NP_442041.1_5 Reverse -240 -259 0.491109 0.257
NP_441230.1_5 Forward -199 -180 -1.08219 0.298
NP_440462.1_6 Forward -196 -186 17.9746 0.00578
NP_440462.1_6 Reverse -183 -193 15.418 0.0142
NP_440868.1_4 Forward -198 -186 9.77374 0.043
NP_440868.1_4 Reverse -181 -193 8.6921 0.0582
NP_442402.1_4 Reverse -38 -57 -6.49113 0.259
NP_441848.1_4 Forward -60 -44 11.4658 0.224
NP_440696.1_3 Reverse -66 -84 0.707465 0.228
NP_440696.1_3 Reverse -76 -94 -4.11075 0.296
NP_442039.1_4 Forward -193 -186 15.1821 0.0124
NP_442039.1_4 Reverse -186 -193 15.1821 0.0124
NP_442039.1_7 Forward -83 -73 13.648 0.211
NP_441926.1_3 Forward -194 -178 3.40179 0.226
NP_440825.1_7 Reverse -289 -299 13.6904 0.152
NP_440825.1_7 Forward -179 -169 10.7626 0.294
NP_442696.1_2 Reverse -184 -202 11.1305 0.18
NP_442837.1_3 Forward -193 -186 15.7721 0.0124
NP_442837.1_3 Reverse -186 -193 15.7721 0.0124
NP_440160.1_2 Forward -31 -12 1.17943 0.217
NP_442053.1_1 Forward -194 -185 18.3876 0.0007
NP_442053.1_1 Reverse -185 -194 18.3876 0.0007
NP_440505.1_3 Forward -196 -186 14.1397 0.0235
NP_440505.1_3 Reverse -183 -193 13.8447 0.0247
NP_440505.1_3 Reverse -138 -148 4.60159 0.277
NP_442532.1_7 Reverse -185 -199 4.62115 0.171
NP_440914.1_1 Forward -194 -184 8.6151 0.186
NP_440914.1_1 Reverse -185 -195 8.6151 0.186
NP_441011.1_8 Forward -193 -184 16.9127 0.00602
NP_441011.1_8 Reverse -186 -195 16.9127 0.00602
NP_441011.1_8 Reverse -77 -86 5.01461 0.289
NP_442533.1_6 Forward -194 -185 17.2076 0.00137
NP_442533.1_6 Reverse -185 -194 17.2076 0.00137
NP_442533.1_6 Reverse -76 -85 4.62128 0.179
NP_442533.1_6 Forward -89 -80 2.35967 0.259
NP_442541.1_10 Reverse -76 -90 4.71887 0.248
NP_442232.1_3 Reverse -177 -196 -14.7502 0.288
NP_442232.1_3 Forward -273 -254 -15.5368 0.292
NP_441482.1_7 Reverse -179 -193 -1.5737 0.0755
NP_441482.1_7 Forward -85 -71 -9.34185 0.198
NP_439944.1_9 Reverse -186 -196 10.4031 0.0887
NP_439944.1_9 Forward -193 -183 10.3048 0.0887
NP_439944.1_9 Forward -221 -211 5.28991 0.262
NP_441028.1_6 Reverse -161 -171 10.1076 0.21
NP_441028.1_6 Reverse -24 -34 5.19112 0.265
NP_442202.1_2 Forward -163 -144 15.0432 0.29
NP_442202.1_4 Forward -196 -182 15.1623 0.194
NP_441527.1_4 Forward -128 -109 -5.68219 0.206
NP_441527.1_7 Reverse -114 -133 11.6017 0.282
NP_441602.1_3 Reverse -180 -199 -2.45882 0.233
NP_441106.1_1 Reverse -184 -193 18.191 0.0028
NP_441106.1_1 Forward -195 -186 18.191 0.0028
NP_441106.1_1 Forward -86 -77 4.32629 0.227
NP_442306.1_10 Reverse -180 -199 -20.7484 0.226
NP_441286.1_1 Reverse -184 -196 5.25052 0.0259
NP_441286.1_1 Forward -195 -183 4.95553 0.027
NP_441286.1_1 Forward -223 -211 -1.14099 0.14
NP_440670.1_8 Forward -194 -185 18.3876 0.000699
NP_440670.1_8 Reverse -185 -194 18.3876 0.000699
NP_441705.1_3 Forward -122 -103 -2.0655 0.281
NP_440886.1_7 Forward -195 -185 17.7774 0.0011
NP_440886.1_7 Reverse -184 -194 17.7774 0.0011
NP_440886.1_7 Forward -100 -90 5.19112 0.194
NP_440828.1_1 Forward -250 -231 -1.47628 0.287
NP_442614.1_2 Forward -79 -65 5.99778 0.295
NP_442614.1_2 Forward -168 -154 5.70279 0.298
NP_439995.1_5 Reverse -175 -194 5.30933 0.276
NP_442072.1_9 Reverse -184 -202 -21.6137 0.211
NP_442072.1_9 Forward -195 -177 -22.2037 0.225
NP_442213.1_5 Reverse -226 -245 -2.0655 0.293
NP_440907.2_8 Reverse -186 -196 17.4824 0.00685
NP_440907.2_8 Forward -193 -183 7.84605 0.117
NP_442264.1_2 Reverse -203 -220 6.62702 0.251
NP_441021.1_1 Reverse -186 -205 -10.3253 0.234
NP_441021.1_8 Reverse -180 -198 10.8356 0.122
NP_440176.1_3 Reverse -159 -173 15.9285 0.219
NP_441463.1_3 Forward -204 -185 -0.197208 0.132
NP_441463.1_3 Reverse -175 -194 -2.26216 0.152
NP_441463.1_3 Forward -220 -201 -5.40875 0.226
NP_441626.1_2 Forward -193 -186 15.7721 0.0124
NP_441626.1_2 Reverse -186 -193 15.7721 0.0124
NP_442794.1_1 Reverse -209 -221 7.90546 0.126
NP_442615.1_1 Forward -203 -185 3.46073 0.0542
NP_442615.1_1 Reverse -176 -194 0.21581 0.106
NP_441962.1_4 Reverse -180 -199 -0.787193 0.117
NP_441962.1_4 Forward -127 -108 -13.5702 0.275
NP_440387.1_1 Forward -194 -178 23.5596 0.00159
NP_440387.1_1 Reverse -185 -201 -0.236458 0.137
NP_441431.1_2 Forward -88 -74 14.8469 0.0587
NP_441431.1_2 Forward -197 -183 9.43874 0.186
NP_441488.1_8 Reverse -166 -180 7.3738 0.252
NP_441836.1_2 Forward -91 -72 2.16274 0.177
NP_440814.1_8 Forward -267 -248 -1.27885 0.297
NP_440467.1_3 Forward -221 -202 11.0609 0.284
NP_440114.1_10 Reverse -185 -199 15.0442 0.0308
NP_440114.1_10 Forward -194 -180 12.8809 0.0698
NP_441425.1_3 Forward -37 -27 15.2213 0.273
NP_440766.1_4 Forward -198 -184 8.25939 0.0871
NP_439988.1_7 Forward -192 -178 12.9786 0.292
NP_441237.1_9 Forward -221 -211 10.1081 0.248
NP_439910.1_2 Forward -202 -185 -21.299 0.183
NP_439910.1_2 Reverse -177 -194 -21.299 0.183
NP_440457.1_1 Reverse -181 -193 9.57708 0.092
NP_440798.1_6 Reverse -186 -199 2.47756 0.17
NP_440798.1_6 Forward -179 -166 1.39592 0.217
NP_440473.1_9 Forward -205 -186 -9.44032 0.26
NP_442509.1_9 Forward -194 -184 16.2041 0.00739
NP_442509.1_9 Reverse -185 -195 16.2041 0.00739
NP_442509.1_9 Forward -180 -170 7.0594 0.24
NP_442439.1_8 Forward -86 -67 11.2092 0.239
NP_440554.1_4 Forward -193 -183 14.6313 0.02
NP_440554.1_4 Reverse -186 -196 13.943 0.0218
NP_440554.1_4 Reverse -77 -87 5.87989 0.129
NP_441885.1_5 Forward -194 -184 11.4848 0.00668
NP_441885.1_5 Reverse -185 -195 11.4848 0.00668
NP_442341.1_7 Reverse -184 -198 12.291 0.0455
NP_442341.1_7 Forward -195 -181 9.34103 0.0751
NP_440423.1_6 Forward -202 -183 -12.4886 0.195
NP_440423.1_6 Forward -107 -88 -20.3551 0.256
NP_443000.1_7 Reverse -183 -193 8.73149 0.0437
NP_443000.1_7 Forward -196 -186 2.04498 0.226
NP_441842.1_10 Forward -201 -187 14.0609 0.0636
NP_441842.1_10 Reverse -178 -192 7.17775 0.264
NP_440275.1_3 Forward -196 -186 17.9746 0.0082
NP_440275.1_3 Reverse -183 -193 8.4365 0.0602
NP_440275.1_3 Reverse -211 -221 5.19158 0.161
NP_440091.1_1 Forward -198 -186 20.1968 0.00953
NP_440091.1_1 Reverse -181 -193 10.8554 0.0429
NP_442275.1_1 Forward -89 -70 1.27776 0.284
NP_440679.1_10 Reverse -326 -345 -18.1918 0.278
NP_440679.1_10 Reverse -203 -222 -18.4868 0.278
NP_442451.1_7 Reverse -6 -25 10.6192 0.217
NP_440149.1_8 Reverse -70 -89 -2.36049 0.168
NP_440149.1_8 Forward -194 -175 -5.70374 0.231
NP_440149.1_8 Reverse -185 -204 -8.06369 0.298
NP_441105.1_3 Reverse -202 -221 0.982764 0.118
NP_440216.1_1 Forward -194 -180 6.58777 0.0145
NP_440216.1_1 Reverse -185 -199 6.29277 0.0156
NP_440216.1_9 Forward -83 -74 16.9127 0.116
NP_440216.1_9 Forward -121 -112 11.3078 0.269
NP_440216.1_9 Forward -17 -8 5.70292 0.29
NP_440172.1_1 Forward -194 -184 8.73149 0.0586
NP_440172.1_1 Reverse -185 -195 8.73149 0.0586
NP_440172.1_1 Reverse -243 -253 2.7333 0.268
NP_440172.1_1 Forward -30 -20 2.53664 0.277
NP_441064.1_7 Reverse -186 -205 19.7639 0.065
NP_442015.1_10 Reverse -167 -180 7.88576 0.0755
NP_442015.1_10 Reverse -181 -194 0.805932 0.218
NP_441226.1_7 Forward -193 -186 14.4934 0.0123
NP_441226.1_7 Reverse -186 -193 14.4934 0.0123
NP_441111.1_7 Forward -193 -185 18.7023 0.00294
NP_441111.1_7 Reverse -186 -194 18.7023 0.00294
NP_442379.1_10 Reverse -178 -195 -2.12444 0.224
NP_441766.1_2 Forward -194 -185 17.5026 0.00297
NP_441766.1_2 Reverse -185 -194 17.5026 0.00297
NP_442252.1_3 Forward -201 -183 8.47561 0.254
NP_440416.1_9 Reverse -178 -197 -6.49039 0.0901
NP_440416.1_9 Reverse -69 -88 -19.5684 0.276
NP_443052.1_8 Forward -204 -185 1.86774 0.0593
NP_443052.1_8 Forward -262 -243 -2.95047 0.0955
NP_443052.1_8 Reverse -175 -194 -9.73531 0.194
NP_442403.1_8 Reverse -215 -234 -1.37718 0.258
NP_442154.1_1 Reverse -68 -86 -16.8938 0.246
NP_440261.1_5 Reverse -186 -199 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTAGCAACCCGACCGTAAAATTCCTGCATACGGGAAACGATGAAAGCATACTGTTTGCAATCTTTACTGTCATCGAGGTAATAAACCAAAATAACCGGCAATTTGCGTTCAAAGGATTCTCTTAGGTTTAAGCGGGGCGGCACCAGGGAACCATTGCCGGCATATACAACAAAAATATTGCCATCGTAACGGTCATCTTCCAAAGCGGCGATCGCCGTACCGTGATCGGACAGGGAAAAGGGCAGAGTGCCCCAGATTCCCAGCAGTAACATAGCAAAAGCAAGGGAAACTATGAGAAAGCGGCGACAACGGGCCAGCCATGGCAAACACACAGACATAATCATCGTGGAAAAAACTCAGTCTAAAATAGGGCAAAGTCTTTCCCAATGTAAACTTTCCC

CDS

GTGTCTTCTAATCCCCATTCCACCCAATCTCGACCCCGACCGGGAGTGGCCCCTTCTCCTTTTGCCGACAGTTATTACGGTGTTTTGGAACTACACCCCGCCGCTTCCCCGGTGGCCATCCGTCGAGCCTACCGGGAATTAAGCAAGCGCTACCATCCAGACACTACCCTATTAACCCCAGACATTGCCACGGTCAAATTTCAGCGCTTGAATGAGGCTTATGCTGTATTGAGCAATCCTGATCGCCGTTCTGTGTACGACTTGCAAATTGGCTATTCCCGTTGGAATGTGATTCAGGTACCGCCGGATCCCCTCCAAGGGCAAAATTCGGCCGCATCAACAAGCTTGGGAAGAAATTCCGCCTATTTGGATGCTAGTGATCGCCCTTTGTCGGCGGGGGAGTTTTTTGCGCTGGCTCTGTTGGGTTTAACCCTGGGGGGCTGTTTGGCCTTGGCCCTGTTAATTGCCTGGCTGAGGGGGGATCCATTGGTAATTCCCAGCTTGTTACCATGGTTCATCAACTAA

Protein

MSSNPHSTQSRPRPGVAPSPFADSYYGVLELHPAASPVAIRRAYRELSKRYHPDTTLLTPDIATVKFQRLNEAYAVLSNPDRRSVYDLQIGYSRWNVIQVPPDPLQGQNSAASTSLGRNSAYLDASDRPLSAGEFFALALLGLTLGGCLALALLIAWLRGDPLVIPSLLPWFIN