Your browser is old and dusty. Try Google Chrome!

Details for sll1664

ORF sll1664
Accession NP_440141.1
Symbol
Category Other
Definition probable glycosyl transferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -324 -310 17.5025 0.0786
NP_441061.1_2 Reverse -124 -138 4.12949 0.155
NP_441061.1_2 Forward -131 -117 3.04785 0.168
NP_441061.1_2 Forward -323 -309 2.45787 0.176
NP_440795.1_7 Forward -323 -316 14.6904 0.0123
NP_440795.1_7 Reverse -316 -323 14.6904 0.0123
NP_441418.1_6 Forward -324 -305 -29.0082 0.215
NP_441418.1_6 Forward -256 -237 -29.2048 0.219
NP_441418.1_6 Reverse -238 -257 -29.8932 0.245
NP_441418.1_6 Reverse -315 -334 -30.4831 0.28
NP_442291.1_5 Reverse -314 -330 6.54838 0.0694
NP_442291.1_5 Reverse -122 -138 -2.10475 0.21
NP_441453.1_4 Reverse -315 -323 16.539 0.00633
NP_441453.1_4 Forward -324 -316 16.539 0.00633
NP_441453.1_4 Reverse -123 -131 6.80426 0.121
NP_441453.1_4 Forward -132 -124 6.11594 0.121
NP_441453.1_4 Reverse -162 -170 5.23096 0.157
NP_443041.1_7 Forward -20 -3 2.30045 0.264
NP_442151.1_6 Forward -132 -118 7.66941 0.192
NP_442151.1_6 Reverse -315 -329 6.29277 0.24
NP_442151.1_6 Reverse -70 -84 5.70279 0.266
NP_440561.1_4 Reverse -108 -127 17.2956 0.149
NP_441818.1_1 Reverse -316 -327 8.51463 0.288
NP_442169.1_1 Forward -343 -324 -0.590531 0.261
NP_441630.1_3 Forward -306 -287 1.47442 0.245
NP_440817.1_5 Forward -96 -77 19.5673 0.121
NP_442655.1_1 Forward -329 -310 1.0811 0.238
NP_442173.1_1 Forward -323 -315 15.4574 0.00633
NP_442173.1_1 Reverse -316 -324 15.4574 0.00633
NP_442173.1_1 Forward -131 -123 12.0158 0.0316
NP_442173.1_1 Reverse -124 -132 4.83764 0.241
NP_442752.1_4 Forward -324 -317 13.8055 0.0199
NP_442752.1_4 Reverse -315 -322 13.8055 0.0199
NP_442752.1_4 Reverse -123 -130 13.8055 0.0199
NP_443027.1_4 Reverse -313 -323 11.8781 0.0872
NP_442975.1_10 Forward -328 -314 2.5556 0.273
NP_441225.1_1 Forward -322 -303 -2.85214 0.17
NP_440784.1_7 Forward -323 -316 15.9687 0.0123
NP_440784.1_7 Reverse -316 -323 15.9687 0.0123
NP_440784.1_7 Reverse -124 -131 6.23397 0.241
NP_440784.1_7 Forward -131 -124 6.13563 0.241
NP_442909.1_7 Forward -131 -117 8.84875 0.161
NP_442909.1_7 Reverse -124 -138 7.27547 0.221
NP_440110.1_4 Forward -143 -124 1.47442 0.284
NP_442062.1_8 Forward -324 -314 19.4496 0.000558
NP_442062.1_8 Reverse -315 -325 17.6796 0.00193
NP_442062.1_8 Forward -313 -303 5.19158 0.181
NP_441859.1_2 Reverse -77 -96 19.7631 0.0867
NP_441859.1_3 Reverse -314 -333 3.63691 0.238
NP_440304.1_4 Forward -326 -316 9.91146 0.051
NP_440304.1_4 Reverse -287 -297 4.99491 0.239
NP_440304.1_4 Reverse -168 -178 2.04498 0.299
NP_440304.1_4 Reverse -313 -323 1.84832 0.299
NP_442242.1_4 Forward -323 -316 14.3954 0.0124
NP_442242.1_4 Reverse -316 -323 14.3954 0.0124
NP_440044.1_8 Reverse -71 -90 2.85105 0.143
NP_441035.1_3 Forward -65 -46 -0.885524 0.298
NP_439902.1_8 Reverse -61 -80 19.764 0.133
NP_441619.1_8 Forward -330 -316 7.17714 0.289
NP_441208.1_9 Forward -327 -313 12.4876 0.135
NP_441594.1_6 Forward -321 -302 0.786102 0.281
NP_442110.1_7 Forward -324 -310 3.04785 0.218
NP_442110.1_7 Reverse -309 -323 -0.590395 0.295
NP_440856.1_7 Forward -349 -330 0.884433 0.165
NP_441083.1_5 Reverse -315 -325 19.3512 0.000718
NP_441083.1_5 Forward -132 -122 17.7779 0.00336
NP_441083.1_5 Forward -324 -314 11.3864 0.0159
NP_441083.1_5 Reverse -123 -133 8.04317 0.046
NP_441083.1_5 Forward -358 -348 1.35667 0.209
NP_441434.1_7 Reverse -317 -331 2.2612 0.288
NP_441738.1_2 Forward -322 -315 15.28 0.0102
NP_441738.1_2 Reverse -317 -324 15.28 0.0102
NP_441738.1_2 Forward -130 -123 15.28 0.0102
NP_441738.1_2 Forward -296 -289 11.8385 0.0469
NP_441558.1_5 Forward -134 -115 9.63589 0.117
NP_440209.1_1 Reverse -315 -323 18.1123 0.00295
NP_440209.1_1 Forward -324 -316 18.1123 0.00295
NP_440209.1_1 Reverse -123 -131 8.57422 0.0425
NP_440209.1_1 Forward -132 -124 5.52596 0.0821
NP_440209.1_1 Forward -171 -163 2.08437 0.286
NP_440870.1_4 Reverse -64 -82 0.21581 0.275
NP_442889.1_8 Reverse -312 -326 5.30886 0.231
NP_440178.1_7 Forward -325 -306 -0.000545616 0.0204
NP_440178.1_7 Reverse -69 -88 -13.4719 0.136
NP_440178.1_7 Reverse -288 -307 -22.9117 0.282
NP_440331.1_5 Forward -273 -254 -17.5035 0.212
NP_441716.1_1 Reverse -123 -137 6.6861 0.191
NP_442111.1_4 Forward -325 -311 19.4691 0.00416
NP_442111.1_4 Forward -133 -119 11.111 0.0515
NP_440343.1_9 Forward -98 -79 12.3892 0.192
NP_440906.1_5 Forward -323 -316 15.8704 0.0124
NP_440906.1_5 Reverse -316 -323 15.8704 0.0124
NP_440906.1_5 Reverse -163 -170 8.20058 0.19
NP_440906.1_5 Reverse -124 -131 6.23397 0.234
NP_440906.1_5 Forward -131 -124 6.13563 0.241
NP_440747.1_10 Reverse -312 -324 17.0502 0.000794
NP_440747.1_10 Forward -327 -315 5.54551 0.0128
NP_440747.1_10 Forward -135 -123 -2.4193 0.0434
NP_440747.1_10 Reverse -120 -132 -4.58258 0.109
NP_440747.1_10 Forward -157 -145 -12.1541 0.227
NP_440747.1_10 Forward -301 -289 -12.3507 0.27
NP_441130.1_10 Reverse -313 -327 9.73436 0.12
NP_441486.1_1 Reverse -312 -326 5.70279 0.0351
NP_441486.1_1 Forward -327 -313 4.42448 0.0446
NP_441486.1_1 Forward -135 -121 -4.13031 0.189
NP_441486.1_1 Reverse -120 -134 -5.11362 0.222
NP_441880.2_10 Forward -323 -305 13.9821 0.111
NP_441880.2_10 Reverse -316 -334 9.55725 0.234
NP_442634.1_4 Forward -326 -312 -2.85201 0.156
NP_440403.1_10 Forward -333 -314 3.53937 0.273
NP_440403.1_10 Forward -256 -237 0.884433 0.293
NP_440842.1_3 Forward -387 -368 10.2259 0.257
NP_441014.1_8 Reverse -87 -106 -4.91709 0.259
NP_442848.1_1 Reverse -309 -323 -1.67204 0.263
NP_442848.1_9 Forward -330 -311 3.93269 0.213
NP_441012.1_4 Reverse -147 -160 15.3589 0.178
NP_441012.1_4 Forward -322 -309 9.16406 0.272
NP_443018.1_3 Forward -323 -316 14.8871 0.0123
NP_443018.1_3 Reverse -316 -323 14.8871 0.0123
NP_443018.1_3 Forward -131 -124 11.7405 0.0655
NP_443018.1_3 Reverse -124 -131 5.44732 0.193
NP_441634.1_8 Reverse -313 -327 -4.52363 0.295
NP_440376.1_1 Forward -324 -315 19.4693 0.000692
NP_440376.1_1 Reverse -315 -324 19.4693 0.000692
NP_440376.1_1 Reverse -123 -132 5.99792 0.111
NP_440376.1_1 Forward -132 -123 -0.196935 0.285
NP_441588.1_4 Forward -130 -120 15.9097 0.0369
NP_441588.1_4 Reverse -317 -327 9.22315 0.14
NP_443065.1_6 Reverse -311 -330 6.78429 0.206
NP_442687.1_7 Forward -325 -315 18.5646 0.0028
NP_442687.1_7 Reverse -314 -324 15.8113 0.0125
NP_442687.1_7 Forward -172 -162 4.79825 0.234
NP_442191.1_4 Forward -323 -309 16.6166 0.034
NP_442485.1_3 Forward -258 -239 11.7992 0.105
NP_442485.1_3 Forward -335 -316 -0.39387 0.252
NP_442485.1_3 Reverse -304 -323 -3.73712 0.277
NP_441846.1_10 Forward -342 -323 -23.305 0.282
NP_442770.1_4 Reverse -311 -330 4.52268 0.27
NP_441682.1_2 Forward -348 -329 1.17943 0.251
NP_441422.1_7 Forward -326 -309 -2.22277 0.21
NP_442658.1_1 Reverse -313 -323 17.0891 0.00615
NP_442658.1_1 Forward -326 -316 14.8275 0.0188
NP_440141.1_8 Forward -340 -321 18.0924 0.115
NP_440141.1_8 Forward -339 -320 8.25926 0.23
NP_442782.1_2 Forward -324 -310 10.4227 0.173
NP_442782.1_2 Forward -171 -157 1.08123 0.282
NP_440656.1_8 Forward -335 -316 -6.29373 0.243
NP_441414.1_9 Reverse -123 -142 4.22769 0.0552
NP_441414.1_9 Forward -324 -305 -1.27885 0.0996
NP_441414.1_9 Reverse -151 -170 -9.24366 0.256
NP_441414.1_9 Forward -132 -113 -10.1286 0.277
NP_440184.1_5 Forward -324 -305 6.29264 0.224
NP_441487.1_9 Reverse -314 -333 13.8641 0.0454
NP_441256.1_8 Forward -246 -227 5.11266 0.272
NP_442937.1_5 Reverse -118 -137 17.3057 0.0323
NP_442937.1_5 Forward -329 -310 7.96426 0.237
NP_442321.1_4 Reverse -14 -33 1.57275 0.255
NP_441958.1_5 Forward -325 -315 20.5312 0.000966
NP_441958.1_5 Reverse -314 -324 12.2714 0.00183
NP_441958.1_5 Reverse -122 -132 0.865012 0.12
NP_441127.1_1 Forward -88 -74 12.291 0.215
NP_441127.1_1 Reverse -244 -258 8.16106 0.3
NP_439905.1_1 Reverse -290 -303 7.98409 0.239
NP_439905.1_1 Reverse -323 -336 7.78743 0.244
NP_440984.1_7 Forward -329 -315 5.01447 0.276
NP_442911.1_2 Reverse -305 -324 5.30933 0.0341
NP_441580.1_6 Reverse -304 -323 -5.60541 0.235
NP_440153.1_5 Reverse -71 -85 10.226 0.0989
NP_440153.1_5 Forward -323 -309 3.04785 0.219
NP_440153.1_8 Reverse -309 -322 -3.12731 0.285
NP_440153.1_8 Reverse -145 -158 -3.4223 0.295
NP_442536.1_8 Forward -163 -144 10.5209 0.296
NP_443055.1_6 Forward -332 -314 10.6381 0.122
NP_443055.1_6 Forward -240 -222 -2.14486 0.29
NP_443055.1_6 Reverse -315 -333 -2.73484 0.299
NP_440827.1_3 Reverse -140 -159 13.5691 0.222
NP_441099.1_5 Reverse -305 -324 1.47442 0.0647
NP_441099.1_5 Forward -142 -123 -7.27704 0.172
NP_442002.1_9 Forward -325 -318 14.1004 0.074
NP_442002.1_9 Reverse -288 -295 13.0188 0.185
NP_442002.1_9 Reverse -314 -321 10.7572 0.185
NP_441294.1_7 Reverse -141 -155 12.0343 0.117
NP_441294.1_7 Forward -328 -314 10.4985 0.185
NP_441646.1_1 Forward -319 -300 2.85105 0.211
NP_441646.1_1 Reverse -116 -135 1.86774 0.227
NP_441646.1_1 Reverse -308 -327 -0.000545616 0.257
NP_442438.1_10 Reverse -310 -324 12.0943 0.0412
NP_441000.1_6 Forward -325 -311 6.78443 0.0933
NP_441000.1_6 Reverse -314 -328 3.53951 0.111
NP_442771.1_1 Forward -326 -308 -5.38906 0.166
NP_440147.1_4 Forward -326 -313 19.5871 0.00276
NP_440147.1_4 Reverse -313 -326 10.344 0.0355
NP_440147.1_4 Forward -258 -245 2.37923 0.208
NP_440147.1_4 Reverse -74 -87 1.49425 0.226
NP_440147.1_4 Reverse -121 -134 0.215946 0.261
NP_440147.1_4 Reverse -98 -111 -0.37404 0.282
NP_441550.1_8 Forward -326 -316 17.6791 0.00754
NP_441550.1_8 Reverse -121 -131 13.3526 0.0252
NP_441550.1_8 Reverse -313 -323 8.82935 0.112
NP_441550.1_8 Forward -134 -124 7.74772 0.149
NP_441916.1_7 Forward -324 -314 18.4663 0.00144
NP_441916.1_7 Reverse -315 -325 16.893 0.00407
NP_441916.1_7 Forward -58 -48 5.09324 0.146
NP_440206.1_9 Reverse -297 -316 7.47261 0.292
NP_440465.1_10 Forward -88 -69 3.04771 0.253
NP_441041.1_4 Forward -324 -305 20.5506 0.00693
NP_441041.1_4 Reverse -105 -124 -13.2752 0.285
NP_441041.1_7 Forward -327 -315 21.314 0.00104
NP_441041.1_7 Reverse -312 -324 14.6087 0.0342
NP_441547.1_2 Forward -165 -147 5.23069 0.228
NP_441725.1_4 Reverse -310 -324 12.6836 0.0693
NP_441725.1_5 Reverse -316 -326 11.7798 0.0247
NP_441725.1_5 Forward -323 -313 2.04498 0.115
NP_441725.1_5 Reverse -124 -134 -0.41329 0.251
NP_439966.1_7 Reverse -313 -323 17.9741 0.00631
NP_439966.1_7 Forward -134 -124 15.5158 0.0152
NP_439966.1_9 Reverse -313 -322 0.884706 0.253
NP_440736.1_3 Reverse -313 -332 -0.295539 0.282
NP_442941.1_3 Forward -323 -313 10.7964 0.0116
NP_442941.1_3 Reverse -316 -326 2.53664 0.14
NP_442941.1_3 Forward -131 -121 1.25834 0.15
NP_442941.1_3 Reverse -124 -134 0.766681 0.171
NP_440289.1_2 Reverse -312 -325 13.9823 0.0123
NP_440289.1_2 Forward -327 -314 7.19745 0.0579
NP_440983.1_5 Forward -132 -113 -9.14533 0.3
NP_440983.1_9 Reverse -306 -325 0.491109 0.292
NP_442281.1_1 Forward -329 -315 22.025 0.00192
NP_442281.1_1 Reverse -310 -324 18.0918 0.00503
NP_442281.1_1 Forward -137 -123 7.96378 0.089
NP_442281.1_1 Reverse -242 -256 5.1122 0.169
NP_440177.1_9 Reverse -115 -134 11.6025 0.259
NP_440437.1_1 Reverse -309 -328 1.0811 0.158
NP_440437.1_1 Reverse -64 -83 -3.04881 0.232
NP_442012.1_1 Reverse -309 -328 1.86774 0.21
NP_442049.1_6 Reverse -115 -134 3.34271 0.275
NP_441556.1_10 Reverse -310 -324 12.2659 0.195
NP_440498.1_1 Reverse -306 -324 -2.53746 0.242
NP_443030.1_3 Forward -330 -312 10.5406 0.183
NP_441644.1_6 Reverse -315 -325 15.7125 0.0048
NP_441644.1_6 Forward -132 -122 14.4342 0.0126
NP_441644.1_6 Forward -324 -314 10.1076 0.0628
NP_441644.1_6 Reverse -123 -133 4.01116 0.253
NP_441644.1_6 Reverse -145 -155 3.42118 0.282
NP_443049.1_6 Reverse -122 -132 14.4711 0.114
NP_440867.1_3 Reverse -249 -268 11.5042 0.244
NP_442215.1_2 Reverse -313 -329 0.255197 0.154
NP_442215.1_2 Forward -348 -332 -3.18639 0.211
NP_442177.1_5 Reverse -114 -128 11.111 0.22
NP_442029.1_6 Forward -165 -146 10.9142 0.17
NP_440253.1_2 Forward -324 -306 -3.22577 0.287
NP_440929.1_8 Forward -324 -315 19.2726 0.000701
NP_440929.1_8 Reverse -315 -324 19.2726 0.000701
NP_440929.1_8 Forward -132 -123 7.07956 0.0713
NP_442933.1_10 Forward -324 -315 17.601 0.00325
NP_442933.1_10 Reverse -315 -324 17.601 0.00325
NP_441751.2_8 Reverse -316 -330 5.80112 0.0408
NP_441751.2_8 Reverse -124 -138 -1.8687 0.132
NP_441751.2_8 Forward -323 -309 -3.04867 0.134
NP_442554.1_8 Reverse -316 -326 14.238 0.0144
NP_442554.1_8 Forward -323 -313 14.1397 0.0144
NP_442554.1_8 Forward -131 -121 5.48657 0.146
NP_442554.1_8 Reverse -124 -134 4.0116 0.2
NP_441762.1_7 Forward -325 -313 11.5437 0.0142
NP_441762.1_7 Reverse -314 -326 9.47875 0.0142
NP_441762.1_7 Reverse -246 -258 -6.05754 0.268
NP_442142.1_4 Reverse -148 -161 15.555 0.0264
NP_442142.1_4 Forward -327 -314 13.195 0.0381
NP_442142.1_4 Forward -135 -122 9.5568 0.0929
NP_442142.1_4 Reverse -312 -325 8.47516 0.113
NP_442292.1_1 Forward -323 -314 9.63616 0.0183
NP_442292.1_1 Reverse -316 -325 9.53783 0.0183
NP_442292.1_1 Forward -131 -122 8.65285 0.0335
NP_442292.1_1 Reverse -124 -133 -0.0986038 0.239
NP_442292.1_5 Forward -335 -316 0.884433 0.257
NP_442292.1_5 Forward -302 -283 -0.885524 0.257
NP_440919.1_8 Forward -354 -335 13.3725 0.203
NP_442476.1_6 Forward -323 -309 8.84938 0.0978
NP_440895.1_6 Reverse -117 -130 9.06573 0.229
NP_442381.1_8 Reverse -312 -331 -5.60541 0.148
NP_442381.1_8 Forward -327 -308 -15.0452 0.292
NP_443009.1_5 Forward -325 -314 20.6093 0.001
NP_443009.1_5 Reverse -314 -325 9.10461 0.0965
NP_441715.1_4 Forward -323 -313 18.8596 0.00741
NP_441448.1_1 Forward -351 -332 19.6656 0.0911
NP_440183.1_1 Forward -170 -151 6.29264 0.278
NP_441198.1_8 Forward -326 -316 12.5877 0.12
NP_441468.1_1 Forward -323 -316 15.8704 0.0124
NP_441468.1_1 Reverse -316 -323 15.8704 0.0124
NP_441468.1_1 Reverse -124 -131 6.13563 0.209
NP_441468.1_1 Forward -131 -124 6.0373 0.223
NP_441020.2_6 Forward -326 -309 15.8701 0.0349
NP_441015.1_10 Forward -336 -317 -11.2103 0.292
NP_441673.1_1 Forward -324 -315 20.8459 0.000698
NP_441673.1_1 Reverse -315 -324 20.8459 0.000698
NP_441673.1_1 Reverse -123 -132 1.37636 0.114
NP_441673.1_1 Forward -132 -123 1.1797 0.163
NP_441731.1_3 Forward -162 -143 -5.9004 0.29
NP_441956.1_9 Reverse -308 -327 15.2408 0.166
NP_441826.1_2 Forward -330 -316 3.14618 0.115
NP_441826.1_2 Reverse -309 -323 3.04785 0.115
NP_441826.1_2 Forward -138 -124 1.17956 0.161
NP_441826.1_2 Reverse -145 -159 0.589577 0.18
NP_441826.1_2 Forward -262 -248 -2.65535 0.273
NP_441826.1_5 Forward -100 -81 3.34271 0.271
NP_441330.1_1 Forward -329 -310 -12.3902 0.183
NP_442490.1_9 Forward -324 -305 -9.047 0.299
NP_442868.1_6 Reverse -313 -323 10.3048 0.038
NP_442868.1_6 Forward -326 -316 9.12481 0.0539
NP_442868.1_6 Reverse -121 -131 0.0783647 0.248
NP_442868.1_6 Forward -134 -124 -0.216628 0.273
NP_442719.1_2 Reverse -223 -241 0.903388 0.162
NP_441056.1_1 Forward -324 -305 3.73603 0.131
NP_442808.1_1 Reverse -314 -324 18.4657 0.00201
NP_442808.1_1 Forward -133 -123 9.616 0.0481
NP_442808.1_1 Forward -325 -315 8.73102 0.0481
NP_442808.1_1 Forward -226 -216 3.8145 0.222
NP_442808.1_1 Forward -127 -117 3.61784 0.234
NP_441101.1_10 Reverse -311 -330 -5.21209 0.281
NP_440031.1_10 Forward -165 -146 2.55606 0.26
NP_440031.1_10 Reverse -112 -131 -0.295539 0.282
NP_440145.1_3 Reverse -305 -324 12.1925 0.0316
NP_440145.1_3 Forward -334 -315 0.687771 0.134
NP_442542.1_2 Reverse -313 -326 8.27909 0.158
NP_442050.1_5 Forward -134 -124 13.3526 0.0369
NP_442050.1_5 Forward -326 -316 6.96107 0.27
NP_442050.1_5 Reverse -313 -323 6.96107 0.27
NP_441114.1_3 Reverse -344 -353 7.07956 0.251
NP_440558.1_2 Reverse -306 -325 -0.295539 0.2
NP_440111.2_4 Reverse -140 -159 13.3725 0.175
NP_442789.1_4 Forward -258 -239 -2.85214 0.242
NP_442792.1_6 Forward -249 -230 7.86593 0.23
NP_441878.1_6 Forward -325 -315 20.2362 0.0046
NP_441878.1_6 Reverse -314 -324 10.4031 0.0176
NP_441878.1_6 Forward -332 -322 -7.39479 0.222
NP_441878.1_6 Reverse -288 -298 -7.68978 0.255
NP_441878.1_6 Reverse -169 -179 -7.68978 0.255
NP_441878.1_6 Reverse -303 -313 -7.88644 0.278
NP_441036.1_8 Reverse -314 -324 17.7779 0.000554
NP_441036.1_8 Forward -325 -315 8.4365 0.174
NP_441557.1_5 Forward -324 -315 19.9609 0.000699
NP_441557.1_5 Reverse -315 -324 19.9609 0.000699
NP_441557.1_5 Reverse -123 -132 1.08137 0.0794
NP_441557.1_5 Forward -132 -123 0.589713 0.134
NP_441445.1_1 Forward -333 -314 -0.000545616 0.283
NP_441433.1_8 Forward -345 -326 -1.47551 0.258
NP_441224.1_2 Forward -99 -81 13.0972 0.228
NP_442241.1_9 Reverse -137 -156 9.3409 0.286
NP_441458.1_10 Forward -163 -144 4.52268 0.23
NP_442183.1_1 Reverse -123 -137 10.4227 0.0845
NP_442183.1_1 Reverse -315 -329 9.5377 0.0966
NP_442183.1_1 Forward -324 -310 8.06273 0.124
NP_442183.1_9 Forward -157 -147 9.02648 0.296
NP_442166.1_7 Forward -323 -309 9.83269 0.19
NP_441655.1_10 Forward -336 -318 20.5703 0.017
NP_441655.1_10 Forward -243 -225 2.57575 0.285
NP_440356.1_10 Reverse -327 -345 12.0155 0.253
NP_441574.1_1 Reverse -111 -130 3.73603 0.142
NP_442170.1_5 Reverse -123 -142 -3.04881 0.267
NP_442347.1_2 Forward -323 -314 11.1111 0.056
NP_442347.1_2 Forward -131 -122 10.3245 0.058
NP_442347.1_2 Reverse -316 -325 3.34298 0.284
NP_442645.1_2 Reverse -307 -326 6.09597 0.0183
NP_442645.1_2 Forward -332 -313 -14.3569 0.173
NP_442645.1_2 Forward -140 -121 -18.9784 0.282
NP_442645.1_2 Reverse -214 -233 -20.0601 0.288
NP_441037.1_4 Forward -326 -316 17.3558 0.0127
NP_441037.1_4 Reverse -313 -323 6.92787 0.237
NP_440690.1_1 Forward -91 -72 7.57094 0.249
NP_442317.1_6 Reverse -310 -329 6.39097 0.238
NP_441633.1_3 Reverse -313 -326 15.1623 0.0109
NP_441633.1_3 Forward -326 -313 1.39592 0.109
NP_441633.1_3 Forward -300 -287 -7.25721 0.3
NP_440136.1_2 Forward -323 -316 15.9687 0.0123
NP_440136.1_2 Reverse -316 -323 15.9687 0.0123
NP_440136.1_2 Reverse -124 -131 6.23397 0.171
NP_440136.1_2 Forward -131 -124 6.13563 0.193
NP_442590.1_10 Forward -58 -39 3.14605 0.295
NP_442998.1_10 Forward -322 -315 15.5754 0.0102
NP_442998.1_10 Reverse -317 -324 15.5754 0.0102
NP_442998.1_10 Forward -130 -123 15.5754 0.0102
NP_440731.1_2 Reverse -303 -322 3.34271 0.295
NP_440299.1_1 Reverse -311 -324 18.1116 0.00453
NP_440299.1_1 Reverse -119 -132 4.64028 0.205
NP_441799.1_1 Forward -328 -314 17.1085 0.0121
NP_441799.1_1 Forward -136 -122 4.91554 0.232
NP_441007.1_10 Forward -329 -316 0.707601 0.219
NP_442334.1_2 Forward -334 -317 5.74204 0.128
NP_442201.1_10 Forward -335 -316 -13.5702 0.274
NP_440256.1_1 Forward -327 -308 0.491109 0.0829
NP_440087.1_1 Forward -333 -314 1.67108 0.167
NP_441559.1_8 Reverse -310 -324 12.291 0.0574
NP_441559.1_8 Forward -319 -305 -4.91696 0.241
NP_441559.1_8 Reverse -7 -21 -5.21195 0.254
NP_441270.1_5 Forward -164 -145 13.4822 0.214
NP_440915.1_6 Reverse -311 -325 20.2558 0.00701
NP_440915.1_6 Reverse -119 -133 1.86788 0.131
NP_440915.1_6 Forward -158 -144 -1.18038 0.224
NP_440915.1_6 Forward -328 -314 -3.24533 0.292
NP_442866.1_1 Forward -258 -239 -8.06369 0.275
NP_440748.1_5 Forward -260 -241 1.57275 0.231
NP_441464.1_8 Reverse -315 -329 14.6509 0.115
NP_440695.1_5 Forward -324 -305 14.3558 0.132
NP_441939.1_3 Forward -323 -304 13.1758 0.0913
NP_441199.1_6 Reverse -311 -330 4.71934 0.159
NP_441199.1_6 Forward -136 -117 -1.27885 0.289
NP_442993.1_1 Reverse -315 -331 2.32015 0.0502
NP_440677.1_6 Reverse -120 -139 11.0125 0.251
NP_442386.1_9 Reverse -314 -323 15.7322 0.0144
NP_442386.1_9 Forward -133 -124 11.9957 0.0754
NP_442386.1_9 Reverse -237 -246 7.07914 0.219
NP_442386.1_9 Forward -325 -316 6.39082 0.219
NP_442386.1_9 Forward -233 -224 5.9975 0.23
NP_442386.1_9 Forward -226 -217 5.40752 0.253
NP_442386.1_9 Reverse -150 -159 5.0142 0.27
NP_441340.1_5 Forward -323 -316 15.6737 0.0124
NP_441340.1_5 Reverse -316 -323 15.6737 0.0124
NP_441340.1_5 Reverse -124 -131 13.5105 0.0314
NP_441340.1_5 Forward -131 -124 5.84064 0.208
NP_440168.1_4 Forward -136 -117 -5.60541 0.255
NP_442506.1_2 Forward -342 -323 2.65439 0.278
NP_442240.1_2 Forward -323 -304 -2.0655 0.0609
NP_442240.1_2 Forward -163 -144 -18.7818 0.295
NP_440586.1_1 Reverse -107 -126 9.3409 0.182
NP_440586.1_8 Forward -323 -316 13.2151 0.026
NP_440586.1_8 Reverse -316 -323 13.2151 0.026
NP_440586.1_8 Forward -131 -124 9.47853 0.146
NP_440586.1_8 Reverse -124 -131 5.74197 0.283
NP_440586.1_8 Forward -78 -71 5.64364 0.297
NP_442251.1_6 Forward -323 -316 15.2804 0.0124
NP_442251.1_6 Reverse -316 -323 15.2804 0.0124
NP_442959.1_5 Forward -20 -1 4.71934 0.3
NP_440684.1_9 Forward -330 -316 19.8624 0.0219
NP_440684.1_9 Reverse -117 -131 8.84938 0.223
NP_441262.1_3 Reverse -315 -322 14.7888 0.0223
NP_441262.1_3 Reverse -123 -130 14.7888 0.0223
NP_441262.1_3 Forward -324 -317 14.7888 0.0223
NP_440027.1_3 Reverse -305 -323 6.01657 0.23
NP_440027.1_8 Forward -135 -116 4.42355 0.287
NP_440027.1_8 Forward -129 -110 4.12856 0.292
NP_443051.1_1 Forward -325 -316 18.0926 0.00402
NP_443051.1_1 Reverse -314 -323 10.4228 0.00754
NP_443051.1_1 Reverse -122 -131 7.47288 0.0571
NP_439937.1_9 Reverse -321 -338 -12.5482 0.273
NP_441657.1_5 Reverse -332 -351 0.687771 0.205
NP_441595.1_5 Forward -331 -313 6.70565 0.222
NP_441740.2_8 Reverse -316 -330 18.3875 0.24
NP_440439.1_1 Reverse -312 -325 19.3905 0.0105
NP_440439.1_1 Forward -259 -246 -2.04567 0.293
NP_440372.1_2 Forward -323 -316 16.3621 0.0124
NP_440372.1_2 Reverse -316 -323 16.3621 0.0124
NP_440372.1_2 Reverse -124 -131 13.8055 0.0214
NP_440372.1_2 Forward -131 -124 6.52896 0.188
NP_440316.1_10 Reverse -116 -126 8.1415 0.24
NP_441803.1_2 Reverse -44 -63 5.40766 0.17
NP_441803.1_2 Reverse -310 -329 0.687771 0.247
NP_441803.1_2 Forward -137 -118 -1.37718 0.298
NP_439977.1_5 Reverse -309 -328 5.30933 0.15
NP_440139.1_1 Forward -330 -311 3.53858 0.202
NP_440267.1_2 Forward -329 -315 9.73373 0.156
NP_442384.1_10 Forward -324 -311 19.1938 0.00338
NP_442384.1_10 Reverse -247 -260 5.72248 0.121
NP_442384.1_10 Forward -132 -119 5.62415 0.124
NP_442384.1_10 Reverse -304 -317 4.8375 0.145
NP_442384.1_10 Reverse -315 -328 1.69091 0.249
NP_440693.1_8 Reverse -205 -224 20.1573 0.193
NP_442114.1_4 Forward -324 -313 9.20345 0.17
NP_442121.1_4 Forward -340 -321 -4.6221 0.27
NP_441018.1_7 Forward -164 -145 6.98095 0.278
NP_442790.1_4 Reverse -114 -133 -4.13045 0.13
NP_442790.1_4 Forward -333 -314 -14.4552 0.277
NP_442262.1_10 Forward -323 -316 14.1988 0.0123
NP_442262.1_10 Reverse -316 -323 14.1988 0.0123
NP_442262.1_10 Forward -131 -124 13.2155 0.0213
NP_441689.1_5 Forward -134 -124 5.97777 0.197
NP_440163.1_10 Forward -262 -252 10.5998 0.201
NP_440344.1_10 Forward -331 -314 -3.20608 0.0802
NP_440075.1_5 Forward -351 -332 12.6833 0.288
NP_440282.1_10 Forward -341 -322 -7.27704 0.251
NP_440531.1_6 Forward -373 -354 -0.590531 0.216
NP_440531.1_6 Forward -117 -98 -3.93378 0.273
NP_442065.1_5 Reverse -324 -343 -2.36049 0.197
NP_440297.1_9 Reverse -316 -326 9.61647 0.0917
NP_440297.1_9 Reverse -239 -249 6.66654 0.178
NP_440297.1_9 Forward -323 -313 -0.118297 0.282
NP_440350.1_5 Reverse -376 -395 -1.27885 0.199
NP_442187.1_3 Reverse -122 -132 15.6147 0.105
NP_439926.1_3 Reverse -84 -103 20.8456 0.0438
NP_440298.1_2 Forward -349 -330 8.45592 0.225
NP_441592.1_4 Forward -324 -305 -2.16383 0.261
NP_441896.1_3 Reverse -306 -325 1.86774 0.209
NP_442067.1_4 Reverse -140 -159 1.96607 0.299
NP_440999.1_9 Reverse -311 -325 17.6992 0.0167
NP_440888.1_2 Forward -324 -310 15.1419 0.0122
NP_440888.1_2 Reverse -145 -159 8.94708 0.142
NP_440888.1_2 Forward -132 -118 7.66879 0.186
NP_440888.1_4 Forward -291 -277 14.4866 0.287
NP_440792.1_1 Forward -387 -368 16.1257 0.0338
NP_440792.1_5 Reverse -316 -335 7.57094 0.237
NP_442147.1_7 Forward -333 -314 12.5858 0.233
NP_440491.1_1 Forward -135 -116 8.57379 0.236
NP_440052.1_5 Reverse -304 -323 4.62101 0.123
NP_440237.1_5 Reverse -72 -86 11.4053 0.256
NP_442033.1_10 Forward -326 -307 -9.83364 0.222
NP_442033.1_10 Reverse -78 -97 -14.2585 0.298
NP_441543.1_2 Forward -323 -314 18.486 0.00236
NP_441543.1_2 Reverse -316 -325 9.34117 0.0818
NP_441543.1_2 Forward -131 -122 7.07956 0.131
NP_442845.1_2 Reverse -117 -131 17.6992 0.0608
NP_442845.1_2 Forward -166 -152 10.521 0.148
NP_442845.1_2 Reverse -303 -317 3.63784 0.282
NP_441178.1_6 Reverse -75 -94 5.2102 0.268
NP_441469.1_8 Reverse -314 -323 16.126 0.00797
NP_441469.1_8 Forward -325 -316 13.3727 0.073
NP_443064.1_6 Reverse -315 -325 13.8273 0.0796
NP_442578.1_7 Forward -323 -316 14.5921 0.026
NP_442578.1_7 Reverse -316 -323 14.5921 0.026
NP_442578.1_7 Reverse -50 -57 9.97054 0.112
NP_442578.1_7 Reverse -124 -131 6.0373 0.18
NP_441462.1_2 Reverse -315 -325 20.1379 0.000967
NP_441462.1_2 Forward -324 -314 11.5831 0.00406
NP_441462.1_2 Reverse -123 -133 7.55152 0.0543
NP_441621.1_7 Forward -326 -312 4.52282 0.0934
NP_441621.1_7 Forward -258 -244 -3.24533 0.188
NP_443062.1_1 Forward -324 -306 16.444 0.031
NP_443062.1_1 Forward -132 -114 6.79079 0.192
NP_443062.1_1 Forward -171 -153 5.23067 0.235
NP_440349.1_3 Forward -323 -304 14.7483 0.208
NP_442204.1_1 Reverse -311 -322 11.5634 0.0565
NP_442204.1_1 Forward -158 -147 3.10693 0.266
NP_440255.1_8 Forward -139 -120 15.4978 0.28
NP_442537.1_3 Forward -349 -330 19.0757 0.231
NP_440516.1_6 Reverse -322 -336 6.88214 0.287
NP_440516.1_8 Reverse -123 -132 18.9776 0.00442
NP_440516.1_8 Forward -324 -315 16.9127 0.00442
NP_440516.1_8 Reverse -315 -324 16.9127 0.00442
NP_440516.1_8 Forward -132 -123 5.01461 0.118
NP_441033.1_2 Forward -334 -315 -8.85033 0.293
NP_442846.1_3 Reverse -62 -81 19.0757 0.0285
NP_442428.1_5 Forward -323 -316 15.8704 0.0124
NP_442428.1_5 Reverse -316 -323 15.8704 0.0124
NP_442428.1_5 Reverse -124 -131 6.13563 0.209
NP_442428.1_5 Forward -131 -124 6.0373 0.212
NP_442859.1_2 Forward -323 -304 6.68596 0.199
NP_441867.1_2 Forward -341 -322 -5.70374 0.189
NP_441867.1_2 Forward -248 -229 -17.6018 0.291
NP_440673.1_3 Forward -322 -315 12.4288 0.0426
NP_440673.1_3 Forward -130 -123 12.4288 0.0426
NP_440673.1_3 Reverse -317 -324 12.4288 0.0426
NP_440673.1_7 Forward -130 -111 2.75272 0.221
NP_440865.1_9 Forward -330 -311 11.9958 0.0497
NP_441052.1_2 Forward -132 -122 10.6981 0.0285
NP_441052.1_2 Forward -324 -314 10.5014 0.0285
NP_441052.1_2 Reverse -315 -325 10.4031 0.0285
NP_441052.1_2 Reverse -123 -133 0.668351 0.256
NP_442219.1_8 Reverse -339 -358 10.0031 0.218
NP_442219.1_9 Reverse -124 -133 8.65285 0.0681
NP_442219.1_9 Forward -323 -314 8.35786 0.0681
NP_442219.1_9 Reverse -316 -325 8.25953 0.0681
NP_442219.1_9 Forward -131 -122 7.96454 0.0696
NP_442219.1_9 Reverse -71 -80 1.86802 0.295
NP_440436.1_1 Forward -257 -239 18.407 0.0642
NP_440436.1_4 Forward -323 -314 18.1905 0.00233
NP_440436.1_4 Reverse -316 -325 15.9289 0.00508
NP_440436.1_4 Forward -131 -122 7.57079 0.124
NP_441884.1_8 Forward -325 -306 2.45773 0.127
NP_441884.1_8 Forward -172 -153 -6.98204 0.241
NP_441884.1_8 Forward -257 -238 -7.67036 0.254
NP_441884.1_9 Reverse -319 -338 -14.2585 0.138
NP_441884.1_9 Reverse -286 -305 -15.3402 0.138
NP_440314.1_9 Reverse -316 -335 10.5209 0.0289
NP_440314.1_9 Forward -131 -112 -4.22878 0.203
NP_442907.1_9 Forward -231 -212 -5.40875 0.284
NP_441719.1_4 Forward -323 -316 16.3621 0.0124
NP_441719.1_4 Reverse -316 -323 16.3621 0.0124
NP_441719.1_4 Reverse -124 -131 6.82395 0.0855
NP_441719.1_4 Forward -131 -124 6.52896 0.188
NP_441733.1_10 Forward -327 -314 9.55739 0.113
NP_441733.1_10 Reverse -312 -325 5.91914 0.203
NP_441004.1_1 Forward -330 -311 -10.6203 0.224
NP_441004.1_1 Reverse -117 -136 -14.8485 0.271
NP_441004.1_2 Forward -342 -323 2.26107 0.215
NP_442366.1_3 Reverse -314 -332 5.82068 0.0829
NP_442366.1_3 Reverse -122 -140 1.39578 0.151
NP_442366.1_3 Reverse -179 -197 -0.472507 0.191
NP_442366.1_3 Forward -325 -307 -4.01242 0.262
NP_442366.1_5 Reverse -120 -130 15.4175 0.0374
NP_442366.1_5 Forward -327 -317 14.8275 0.0375
NP_442873.1_3 Reverse -305 -324 8.4551 0.201
NP_442873.1_9 Reverse -63 -82 4.81688 0.284
NP_443029.1_8 Forward -116 -97 13.6675 0.293
NP_442206.1_1 Reverse -322 -341 -10.9153 0.219
NP_442206.1_10 Forward -324 -309 0.0782283 0.274
NP_440328.1_4 Reverse -309 -328 1.86774 0.213
NP_443054.1_2 Reverse -313 -327 16.5192 0.0547
NP_442308.1_4 Reverse -309 -328 3.24438 0.267
NP_442308.1_4 Reverse -244 -263 -0.590531 0.295
NP_441851.1_10 Forward -325 -315 17.4829 0.0027
NP_441851.1_10 Reverse -314 -324 16.008 0.00552
NP_442208.1_5 Reverse -108 -127 -2.36049 0.252
NP_442622.1_8 Reverse -315 -333 -19.2537 0.296
NP_442011.1_1 Reverse -314 -333 -1.08219 0.268
NP_442856.1_7 Reverse -306 -325 -0.000545616 0.203
NP_441668.1_4 Forward -334 -315 6.09597 0.163
NP_441668.1_4 Reverse -113 -132 1.67108 0.212
NP_441668.1_4 Reverse -39 -58 -1.96717 0.285
NP_442515.1_1 Reverse -314 -328 -3.147 0.287
NP_442515.1_1 Forward -325 -311 -4.62196 0.298
NP_440940.1_7 Reverse -305 -323 4.34495 0.256
NP_441349.1_10 Forward -334 -315 6.78429 0.0342
NP_440432.1_9 Reverse -316 -331 0.373221 0.159
NP_442843.1_1 Forward -246 -227 -4.81876 0.239
NP_442843.1_1 Forward -339 -320 -8.85033 0.264
NP_440396.1_1 Reverse -325 -344 -5.21209 0.272
NP_440726.1_2 Reverse -240 -259 5.40766 0.224
NP_442450.1_5 Forward -326 -316 17.3846 0.0267
NP_442168.1_5 Reverse -141 -160 -1.37718 0.264
NP_440588.1_2 Reverse -306 -325 -0.885524 0.154
NP_440588.1_2 Forward -156 -137 -3.3438 0.185
NP_440588.1_2 Forward -333 -314 -6.58872 0.285
NP_440195.1_4 Forward -125 -106 4.81767 0.292
NP_442006.1_2 Forward -340 -323 -0.354483 0.13
NP_442006.1_2 Forward -103 -86 -5.76269 0.146
NP_442006.1_3 Reverse -117 -135 -7.45401 0.298
NP_442243.1_1 Forward -160 -142 5.62325 0.18
NP_442243.1_1 Reverse -309 -327 3.36165 0.204
NP_441570.1_1 Reverse -123 -141 -7.84733 0.0968
NP_441570.1_1 Forward -324 -306 -8.33898 0.109
NP_440078.1_10 Forward -324 -305 15.4374 0.123
NP_441078.1_4 Forward -324 -315 19.6659 0.0007
NP_441078.1_4 Reverse -315 -324 19.6659 0.0007
NP_441078.1_4 Reverse -123 -132 0.196389 0.205
NP_441078.1_4 Forward -132 -123 -0.000272808 0.205
NP_440539.1_9 Reverse -332 -351 -4.91709 0.286
NP_440707.1_6 Forward -306 -287 11.11 0.274
NP_442443.1_1 Forward -339 -320 4.32602 0.158
NP_442443.1_1 Forward -246 -227 2.26107 0.192
NP_442443.1_1 Forward -117 -98 -4.13045 0.268
NP_442443.1_1 Forward -93 -74 -4.72043 0.276
NP_440526.1_3 Reverse -316 -327 10.9729 0.0646
NP_441432.1_8 Reverse -122 -131 14.0611 0.0258
NP_441432.1_8 Reverse -116 -125 10.0295 0.0681
NP_441432.1_8 Forward -325 -316 8.35786 0.0755
NP_441432.1_8 Reverse -314 -323 8.25953 0.0755
NP_441432.1_8 Reverse -201 -210 2.55633 0.298
NP_443024.1_2 Reverse -322 -335 15.3583 0.228
NP_442320.1_8 Reverse -309 -323 -0.983719 0.0817
NP_442320.1_8 Reverse -117 -131 -3.44199 0.122
NP_442320.1_8 Forward -330 -316 -4.13031 0.148
NP_442344.1_7 Reverse -316 -335 2.65439 0.0638
NP_442344.1_7 Forward -323 -304 -6.1954 0.17
NP_441732.1_2 Reverse -311 -327 -16.1661 0.165
NP_440760.1_1 Forward -324 -305 8.35759 0.0115
NP_440760.1_1 Forward -132 -113 2.3594 0.0228
NP_440760.1_1 Reverse -315 -334 -20.4534 0.222
NP_442797.1_7 Reverse -330 -348 -1.65248 0.299
NP_442353.1_4 Reverse -350 -369 0.392004 0.272
NP_441072.1_2 Forward -335 -316 13.8641 0.159
NP_441072.1_2 Reverse -151 -170 5.50599 0.296
NP_442400.1_1 Reverse -312 -331 -2.75381 0.243
NP_442489.1_7 Forward -324 -315 20.1576 0.000695
NP_442489.1_7 Reverse -315 -324 20.1576 0.000695
NP_442489.1_7 Forward -132 -123 0.688044 0.152
NP_442489.1_7 Reverse -123 -132 0.688044 0.152
NP_442489.1_7 Reverse -289 -298 -2.06522 0.288
NP_440559.1_1 Reverse -316 -325 17.306 0.00658
NP_440559.1_1 Forward -323 -314 8.75118 0.0586
NP_440559.1_1 Forward -131 -122 7.76787 0.0918
NP_440559.1_1 Reverse -124 -133 6.48957 0.134
NP_441659.2_8 Reverse -315 -325 19.3512 0.000966
NP_441659.2_8 Forward -324 -314 11.9764 0.0147
NP_441659.2_8 Reverse -145 -155 7.74818 0.0566
NP_441659.2_8 Forward -132 -122 5.48657 0.106
NP_442749.1_5 Reverse -280 -297 12.2728 0.166
NP_440860.1_8 Reverse -245 -264 21.0423 0.0387
NP_442913.1_9 Reverse -117 -136 6.19431 0.296
NP_442913.1_10 Forward -333 -314 -2.36049 0.184
NP_442913.1_10 Forward -307 -288 -4.03212 0.225
NP_441040.1_2 Forward -162 -143 -5.31042 0.177
NP_441040.1_2 Reverse -295 -314 -15.3402 0.286
NP_442849.1_1 Reverse -200 -214 9.5377 0.241
NP_440708.1_6 Forward -322 -303 -10.0303 0.277
NP_442776.1_1 Reverse -304 -323 11.4058 0.157
NP_440779.1_5 Reverse -315 -332 -14.8091 0.274
NP_442346.1_5 Forward -325 -315 17.9746 0.00128
NP_442346.1_5 Reverse -314 -324 9.02648 0.118
NP_442346.1_5 Forward -172 -162 8.53483 0.133
NP_440352.1_5 Forward -344 -325 10.8063 0.27
NP_440545.1_3 Forward -328 -311 11.6419 0.0247
NP_441856.1_8 Reverse -93 -112 11.1109 0.274
NP_440831.1_3 Forward -340 -321 5.61052 0.28
NP_440831.1_3 Reverse -306 -325 5.51345 0.28
NP_441629.1_1 Reverse -281 -300 11.0125 0.154
NP_440486.1_6 Forward -314 -295 9.0459 0.235
NP_440459.1_2 Forward -169 -152 9.08529 0.239
NP_441653.1_2 Reverse -304 -323 4.59259 0.255
NP_440010.1_3 Reverse -105 -124 -6.78538 0.256
NP_440010.1_4 Forward -136 -117 1.47364 0.236
NP_440010.1_7 Forward -240 -221 14.1591 0.293
NP_440010.1_10 Forward -355 -336 3.93269 0.249
NP_440847.1_3 Reverse -231 -245 13.4703 0.217
NP_440847.1_3 Reverse -323 -337 11.1104 0.274
NP_442603.1_7 Reverse -123 -137 8.65209 0.168
NP_441888.1_7 Reverse -310 -324 13.6676 0.0743
NP_441948.1_4 Forward -331 -313 -0.865831 0.139
NP_441047.1_1 Reverse -78 -97 -0.4922 0.283
NP_441833.1_4 Forward -323 -316 15.9687 0.0124
NP_441833.1_4 Reverse -316 -323 15.9687 0.0124
NP_441833.1_4 Forward -131 -124 6.52896 0.0924
NP_441833.1_4 Reverse -124 -131 6.23397 0.163
NP_441112.1_5 Forward -99 -80 8.25926 0.232
NP_442162.1_9 Forward -323 -316 16.2637 0.0124
NP_442162.1_9 Reverse -316 -323 16.2637 0.0124
NP_442162.1_9 Forward -131 -124 12.9205 0.0282
NP_442162.1_9 Reverse -124 -131 12.9205 0.0282
NP_440671.1_4 Forward -138 -124 14.8476 0.0546
NP_440671.1_4 Reverse -309 -323 11.7993 0.125
NP_440671.1_4 Forward -160 -146 7.27608 0.222
NP_440671.1_4 Forward -330 -316 6.3911 0.248
NP_440772.1_8 Forward -330 -311 13.5691 0.253
NP_441915.1_2 Forward -180 -161 15.9291 0.292
NP_442140.1_3 Forward -323 -313 14.238 0.0486
NP_442140.1_3 Reverse -316 -326 13.5497 0.0542
NP_442140.1_3 Forward -131 -121 10.2065 0.0902
NP_442140.1_3 Reverse -248 -258 4.60159 0.242
NP_442021.1_3 Reverse -117 -136 -4.32711 0.251
NP_440875.1_9 Forward -322 -312 17.327 0.0126
NP_440875.1_9 Reverse -249 -259 11.0001 0.187
NP_441813.1_5 Reverse -313 -323 19.4496 0.00647
NP_441813.1_5 Forward -134 -124 12.7631 0.0192
NP_441813.1_5 Forward -326 -316 8.82982 0.0367
NP_440590.1_4 Forward -323 -310 13.4906 0.013
NP_440590.1_4 Forward -131 -118 7.98409 0.0491
NP_440590.1_4 Reverse -316 -329 -6.07724 0.299
NP_440567.1_1 Reverse -316 -330 3.73617 0.137
NP_440567.1_1 Forward -131 -117 2.2612 0.179
NP_440567.1_1 Forward -323 -309 1.67122 0.196
NP_442497.1_10 Reverse -316 -325 19.8626 0.00532
NP_442497.1_10 Forward -323 -314 10.4228 0.0087
NP_442497.1_10 Forward -131 -122 0.589713 0.153
NP_440821.1_4 Forward -326 -316 10.9931 0.0146
NP_440821.1_4 Reverse -313 -323 10.2065 0.0163
NP_440821.1_4 Forward -134 -124 6.07655 0.1
NP_440821.1_4 Reverse -121 -131 -0.314959 0.251
NP_441239.1_9 Reverse -313 -325 17.7386 0.0146
NP_441239.1_9 Forward -326 -314 13.3137 0.037
NP_441239.1_9 Reverse -245 -257 5.64384 0.213
NP_441892.1_1 Forward -333 -316 4.26707 0.113
NP_440604.1_6 Forward -313 -294 1.96607 0.147
NP_442193.1_8 Forward -135 -116 12.4867 0.234
NP_442270.1_9 Reverse -112 -131 -8.06369 0.216
NP_441617.1_6 Reverse -372 -391 -1.08219 0.256
NP_442138.1_9 Reverse -302 -321 8.06178 0.281
NP_442138.1_10 Reverse -315 -334 -7.57203 0.29
NP_440391.1_5 Reverse -321 -340 6.4893 0.279
NP_442052.1_8 Forward -326 -316 12.7631 0.253
NP_440546.1_4 Reverse -315 -325 12.8578 0.0572
NP_440546.1_4 Reverse -123 -133 12.1791 0.0679
NP_440546.1_4 Forward -324 -314 11.8882 0.0679
NP_440546.1_4 Forward -160 -150 7.52511 0.235
NP_440546.1_4 Forward -171 -161 7.23423 0.252
NP_440546.1_6 Reverse -305 -324 12.3892 0.245
NP_440462.1_6 Reverse -313 -323 17.2863 0.00752
NP_440462.1_6 Forward -134 -124 3.81494 0.228
NP_440462.1_6 Forward -326 -316 1.455 0.294
NP_442611.1_1 Forward -324 -305 6.39097 0.165
NP_440868.1_4 Reverse -311 -323 10.5604 0.0364
NP_440868.1_4 Forward -136 -124 4.8572 0.109
NP_440868.1_4 Forward -328 -316 -0.74767 0.282
NP_441474.1_1 Reverse -237 -256 1.57197 0.247
NP_441672.1_10 Forward -322 -303 12.0942 0.291
NP_442402.1_4 Reverse -328 -347 8.4551 0.113
NP_442402.1_10 Reverse -326 -336 13.5492 0.2
NP_442460.1_7 Reverse -111 -130 8.25926 0.145
NP_440696.1_3 Forward -324 -306 -0.472507 0.243
NP_440579.1_10 Forward -229 -215 18.4851 0.283
NP_440843.1_3 Forward -27 -8 8.35759 0.29
NP_442039.1_4 Forward -323 -316 15.1821 0.0124
NP_442039.1_4 Reverse -316 -323 15.1821 0.0124
NP_442039.1_4 Reverse -124 -131 11.6422 0.0747
NP_442039.1_7 Forward -245 -235 12.9597 0.213
NP_442039.1_7 Forward -338 -328 10.8948 0.257
NP_441926.1_3 Reverse -315 -331 7.82668 0.17
NP_441926.1_3 Reverse -123 -139 3.89344 0.206
NP_440825.1_7 Reverse -316 -326 11.8361 0.2
NP_440825.1_7 Forward -131 -121 10.9578 0.278
NP_442837.1_3 Forward -323 -316 15.7721 0.0124
NP_442837.1_3 Reverse -316 -323 15.7721 0.0124
NP_442837.1_3 Forward -131 -124 6.0373 0.25
NP_442837.1_3 Reverse -124 -131 6.0373 0.25
NP_442053.1_1 Forward -324 -315 18.3876 0.0007
NP_442053.1_1 Reverse -315 -324 18.3876 0.0007
NP_442053.1_1 Forward -132 -123 14.4544 0.0114
NP_442053.1_1 Reverse -123 -132 7.86621 0.0863
NP_440505.1_3 Reverse -313 -323 15.9097 0.00857
NP_440505.1_3 Reverse -121 -131 7.64985 0.151
NP_440505.1_3 Forward -281 -271 4.69992 0.272
NP_440505.1_3 Forward -156 -146 4.69992 0.272
NP_442360.1_5 Forward -339 -329 13.5497 0.278
NP_441252.1_6 Forward -234 -227 14.3954 0.168
NP_441203.1_1 Forward -159 -140 -20.4534 0.297
NP_440914.1_1 Forward -132 -122 13.1043 0.0386
NP_440914.1_1 Reverse -123 -133 12.1284 0.0654
NP_440914.1_1 Forward -324 -314 8.6151 0.186
NP_440914.1_1 Reverse -315 -325 8.51751 0.186
NP_441011.1_8 Forward -323 -314 16.9127 0.00602
NP_441011.1_8 Reverse -316 -325 14.356 0.0249
NP_441011.1_8 Forward -170 -161 5.40793 0.263
NP_442533.1_1 Forward -349 -330 -1.18052 0.14
NP_442533.1_6 Forward -324 -315 17.2076 0.00137
NP_442533.1_6 Reverse -315 -324 17.2076 0.00137
NP_442533.1_6 Forward -132 -123 4.42462 0.179
NP_442533.1_6 Forward -256 -247 3.14632 0.224
NP_442533.1_6 Reverse -151 -160 1.96635 0.28
NP_442533.1_6 Forward -154 -145 1.76968 0.289
NP_442541.1_10 Reverse -322 -336 5.01387 0.248
NP_442322.1_4 Forward -228 -211 -9.00826 0.286
NP_442229.1_1 Reverse -313 -327 10.717 0.18
NP_443016.1_1 Reverse -232 -251 -6.68705 0.263
NP_441482.1_7 Reverse -309 -323 18.2892 0.00478
NP_441482.1_7 Forward -330 -316 -10.5218 0.209
NP_441482.1_7 Forward -160 -146 -10.6202 0.211
NP_441482.1_7 Reverse -117 -131 -10.6202 0.211
NP_441482.1_7 Reverse -43 -57 -10.9151 0.222
NP_439944.1_9 Reverse -316 -326 8.82982 0.101
NP_441028.1_6 Reverse -326 -336 8.04271 0.217
NP_441028.1_6 Reverse -327 -337 4.10949 0.278
NP_440116.1_8 Reverse -316 -335 -8.55534 0.254
NP_441527.1_4 Reverse -196 -215 -10.8388 0.275
NP_441527.1_4 Forward -391 -372 -13.1306 0.298
NP_440115.1_6 Reverse -312 -322 7.64985 0.146
NP_442492.1_2 Reverse -123 -142 -0.197208 0.251
NP_441602.1_3 Forward -319 -300 0.294447 0.217
NP_441602.1_3 Forward -261 -242 -4.22878 0.261
NP_442890.1_1 Reverse -306 -325 13.2741 0.24
NP_441106.1_1 Reverse -314 -323 18.191 0.0028
NP_441106.1_1 Forward -325 -316 9.73449 0.0311
NP_441106.1_1 Reverse -161 -170 4.71961 0.21
NP_439903.1_6 Forward -135 -116 7.07848 0.164
NP_001035870.1_3 Reverse -112 -131 -4.13045 0.278
NP_440797.1_2 Forward -143 -124 11.7906 0.292
NP_441286.1_1 Reverse -122 -134 10.9537 0.0145
NP_441286.1_1 Reverse -314 -326 5.93884 0.0258
NP_441286.1_1 Forward -325 -313 -3.40261 0.145
NP_441286.1_1 Forward -299 -287 -5.27089 0.194
NP_441286.1_1 Forward -180 -168 -6.05754 0.245
NP_441286.1_1 Forward -133 -121 -6.15587 0.251
NP_440670.1_8 Forward -324 -315 18.3876 0.000699
NP_440670.1_8 Reverse -315 -324 18.3876 0.000699
NP_440670.1_8 Reverse -123 -132 8.75118 0.0606
NP_440670.1_8 Forward -132 -123 6.19458 0.124
NP_441886.1_2 Forward -342 -323 8.55425 0.213
NP_441930.1_2 Forward -332 -322 16.4996 0.19
NP_440886.1_7 Reverse -314 -324 17.7774 0.0011
NP_440886.1_7 Forward -325 -315 8.04271 0.0805
NP_440886.1_7 Forward -133 -123 6.66608 0.115
NP_440886.1_7 Reverse -321 -331 4.50281 0.232
NP_442072.1_4 Reverse -181 -200 14.7864 0.278
NP_442072.1_9 Forward -325 -307 -5.48739 0.065
NP_442072.1_9 Forward -332 -314 -22.9903 0.271
NP_441753.1_10 Forward -340 -321 1.17943 0.274
NP_442125.1_2 Forward -46 -27 5.30933 0.27
NP_441808.1_7 Forward -93 -74 19.8623 0.115
NP_441808.1_8 Reverse -303 -322 6.09597 0.294
NP_440907.2_8 Reverse -316 -326 16.2041 0.0161
NP_440907.2_8 Forward -323 -313 7.94438 0.117
NP_440907.2_8 Forward -131 -121 5.87944 0.184
NP_442264.1_2 Forward -266 -249 4.75873 0.293
NP_442264.1_4 Forward -312 -298 15.8309 0.25
NP_441021.1_1 Forward -131 -112 -10.4236 0.238
NP_441021.1_8 Forward -329 -311 0.904127 0.291
NP_440841.1_4 Forward -134 -115 -9.14533 0.254
NP_441463.1_3 Forward -142 -123 -8.16202 0.266
NP_441463.1_3 Forward -302 -283 -8.752 0.273
NP_441626.1_2 Forward -323 -316 15.7721 0.0124
NP_441626.1_2 Reverse -316 -323 15.7721 0.0124
NP_441626.1_2 Reverse -124 -131 12.2322 0.0511
NP_441626.1_2 Forward -131 -124 5.93897 0.231
NP_442365.1_5 Reverse -316 -335 12.6841 0.13
NP_442365.1_7 Forward -136 -117 -3.04881 0.21
NP_442794.1_1 Reverse -311 -323 10.4621 0.0721
NP_442794.1_1 Reverse -119 -131 9.38042 0.0795
NP_442794.1_1 Forward -136 -124 8.9871 0.0865
NP_442794.1_1 Forward -24 -12 4.46387 0.261
NP_441401.1_5 Forward -128 -109 17.9043 0.23
NP_442615.1_1 Forward -333 -315 5.23069 0.0398
NP_442615.1_1 Reverse -114 -132 -2.3408 0.143
NP_440387.1_1 Forward -324 -308 12.9399 0.01
NP_440387.1_1 Forward -132 -116 3.59845 0.0551
NP_440387.1_1 Reverse -315 -331 0.746852 0.12
NP_440387.1_1 Reverse -123 -139 -5.05468 0.212
NP_441431.1_2 Reverse -312 -326 20.8451 0.00685
NP_441431.1_3 Reverse -117 -136 4.12936 0.263
NP_441488.1_8 Reverse -118 -132 18.5835 0.056
NP_441993.1_1 Forward -330 -311 11.4975 0.113
NP_441993.1_1 Reverse -117 -136 9.74328 0.135
NP_441993.1_1 Forward -324 -305 6.33227 0.181
NP_442224.1_1 Reverse -143 -162 0.196116 0.233
NP_440114.1_10 Reverse -315 -329 17.1092 0.0122
NP_441510.2_6 Reverse -305 -324 15.9282 0.132
NP_441510.2_9 Reverse -130 -149 6.29264 0.234
NP_441272.1_7 Reverse -117 -127 12.8614 0.291
NP_440766.1_4 Reverse -311 -325 6.48943 0.101
NP_440766.1_4 Forward -260 -246 1.96621 0.205
NP_439988.1_3 Forward -317 -303 8.35772 0.259
NP_441237.1_9 Reverse -316 -326 17.188 0.00445
NP_441979.1_5 Forward -119 -100 -18.1918 0.284
NP_442743.1_4 Forward -323 -304 -8.35868 0.291
NP_442867.1_8 Reverse -323 -342 4.71934 0.277
NP_440457.1_1 Reverse -311 -323 7.61046 0.101
NP_440457.1_1 Forward -158 -146 5.05386 0.149
NP_440457.1_1 Forward -328 -316 1.12062 0.245
NP_440457.1_1 Reverse -119 -131 0.530633 0.25
NP_440798.1_6 Reverse -316 -329 3.85419 0.147
NP_440801.1_8 Reverse -314 -333 6.58763 0.166
NP_440801.1_8 Forward -133 -114 -1.96717 0.284
NP_441984.1_1 Reverse -117 -135 5.62401 0.288
NP_441984.1_6 Forward -108 -96 13.9036 0.262
NP_441436.1_2 Reverse -199 -218 -4.22878 0.28
NP_441436.1_8 Reverse -75 -94 7.27595 0.293
NP_440473.1_9 Forward -335 -316 11.1109 0.0406
NP_442509.1_9 Reverse -315 -325 17.3841 0.00128
NP_442509.1_9 Forward -324 -314 16.2041 0.00739
NP_442509.1_9 Forward -298 -288 11.3859 0.134
NP_441253.1_8 Forward -329 -315 18.3985 0.119
NP_441253.1_8 Reverse -299 -313 9.99138 0.288
NP_440554.1_4 Forward -323 -313 16.4996 0.0189
NP_441885.1_5 Forward -324 -314 11.4848 0.00668
NP_441885.1_5 Reverse -315 -325 11.3864 0.00668
NP_441885.1_5 Reverse -123 -133 9.51814 0.0206
NP_441885.1_5 Forward -132 -122 1.25834 0.11
NP_440478.1_4 Reverse -119 -138 11.7008 0.244
NP_442341.1_6 Forward -137 -118 16.6165 0.29
NP_442341.1_7 Forward -325 -311 8.65272 0.0858
NP_442341.1_7 Forward -133 -119 7.57108 0.102
NP_442341.1_7 Reverse -314 -328 7.07942 0.111
NP_442341.1_7 Reverse -321 -335 3.04785 0.237
NP_442341.1_9 Reverse -313 -327 18.6818 0.0162
NP_442341.1_9 Reverse -121 -135 11.012 0.133
NP_441756.1_5 Reverse -311 -330 1.27776 0.217
NP_441756.1_5 Forward -316 -297 -2.85214 0.283
NP_441173.1_9 Reverse -235 -243 13.1954 0.184
NP_441173.1_9 Reverse -327 -335 11.3271 0.226
NP_440423.1_6 Forward -332 -313 7.27595 0.0431
NP_443000.1_7 Reverse -313 -323 11.5831 0.0344
NP_443000.1_7 Forward -326 -316 2.04498 0.226
NP_443000.1_7 Reverse -121 -131 0.57002 0.294
NP_440275.1_3 Reverse -313 -323 15.418 0.0178
NP_440275.1_3 Forward -326 -316 9.91146 0.046
NP_440275.1_3 Reverse -121 -131 5.48657 0.145
NP_442932.1_9 Forward -244 -225 12.5858 0.175
NP_442932.1_9 Forward -337 -318 11.6025 0.18
NP_442932.1_9 Forward -91 -72 11.1109 0.18
NP_440091.1_1 Forward -328 -316 1.41561 0.197
NP_443060.1_5 Reverse -137 -156 6.29183 0.24
NP_442451.1_2 Reverse -307 -326 3.93269 0.128
NP_442451.1_2 Forward -306 -287 -6.78538 0.232
NP_440175.1_7 Reverse -106 -124 10.5342 0.253
NP_440149.1_8 Forward -324 -305 -0.688862 0.151
NP_441105.1_3 Reverse -112 -131 6.98095 0.0565
NP_441105.1_3 Forward -184 -165 -2.26216 0.159
NP_441105.1_3 Forward -165 -146 -4.72043 0.204
NP_441105.1_3 Reverse -298 -317 -7.86702 0.261
NP_440216.1_1 Forward -324 -310 7.57108 0.00935
NP_440216.1_1 Reverse -315 -329 6.3911 0.0156
NP_440216.1_1 Reverse -304 -318 -11.9968 0.236
NP_440216.1_9 Forward -25 -16 11.4061 0.267
NP_440172.1_1 Reverse -315 -325 16.303 0.00854
NP_440172.1_1 Forward -324 -314 8.73149 0.0586
NP_440172.1_1 Reverse -123 -133 6.27322 0.107
NP_440172.1_1 Forward -132 -122 2.24165 0.279
NP_442371.1_1 Forward -336 -326 14.8275 0.183
NP_440167.1_3 Forward -334 -315 9.3409 0.258
NP_442015.1_3 Reverse -237 -256 11.11 0.29
NP_442015.1_10 Reverse -311 -324 21.4554 0.00329
NP_442015.1_10 Forward -328 -315 2.47756 0.191
NP_442015.1_10 Forward -136 -123 -0.472371 0.268
NP_441226.1_7 Forward -323 -316 14.4934 0.0123
NP_441226.1_7 Reverse -316 -323 14.4934 0.0123
NP_441226.1_7 Reverse -124 -131 12.7234 0.0312
NP_441226.1_7 Forward -131 -124 11.5435 0.0757
NP_441226.1_7 Reverse -239 -246 8.29857 0.205
NP_441111.1_7 Forward -323 -315 18.7023 0.00294
NP_441111.1_7 Reverse -316 -324 18.7023 0.00294
NP_441111.1_7 Forward -131 -123 8.86921 0.0589
NP_442379.1_10 Reverse -155 -172 -1.73112 0.223
NP_441766.1_2 Forward -324 -315 17.5026 0.00297
NP_441766.1_2 Reverse -315 -324 17.5026 0.00297
NP_441766.1_2 Forward -132 -123 14.7494 0.00772
NP_442417.1_5 Forward -324 -310 9.43936 0.132
NP_440416.1_1 Forward -324 -305 -11.7019 0.272
NP_440416.1_1 Reverse -315 -334 -12.6852 0.272
NP_440416.1_9 Reverse -308 -327 -3.83545 0.0751
NP_440416.1_9 Reverse -297 -316 -17.2085 0.234
NP_440416.1_9 Forward -161 -142 -18.8801 0.266
NP_443052.1_8 Forward -334 -315 4.42435 0.0441
NP_443052.1_9 Reverse -78 -97 -4.32711 0.257
NP_443052.1_9 Reverse -75 -94 -5.50708 0.271
NP_442403.1_8 Reverse -125 -144 -3.04881 0.296
NP_440591.1_9 Forward -331 -313 11.8189 0.0935
NP_440591.1_9 Forward -325 -307 5.91901 0.232
NP_440591.1_9 Reverse -122 -140 4.24738 0.285
NP_442154.1_1 Reverse -207 -225 -13.6489 0.217
NP_440261.1_5 Forward -323 -310 -2.63565 0.0924
NP_440261.1_5 Reverse -316 -329 -10.2071 0.201
NP_440988.1_10 Forward -134 -120 7.7064 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGACTTGCAAAAAGCCTACGAAGAAACTCCTGAATGGCTCTTGCAGATGAGCATTGTGGCCACCCTGGGGGAAATGGGCGATCGCCGGGGCTTCGACCTGCTGAAAATCGCCCTTGATTCTGAGAATAGCTTGATTAGAACGGCGGCCATCAGTGCGTTGGGAGAATTGGGCAACCCGGAAGCCCTACCTCTGCTTGCCTCCTTAGTACAAGACGAAGACTGGCAAGTGCGCTATCGTTTAGCCCTGGCGGTGGGTCATCTAGAACATCCCGATCGCCAAAGCCTACTGCAACAGTTGGCTCAGGATCAGGTGGAACAGGTGGCCAACACAGCTCAGGAATTATTGACCGCCTAGGCTAAGTTAAGCTGGAAGGTCCCTTGAAAATGCCTGGGTTTATTT

CDS

ATGTTTTTCAGTGTTGTCATTCCCACCTATAATCGTCTGCCGATCCTGGAAAAATGCCTACGGGCCCTGGAACAACAAACCTTTGACGAAACCTTAATTTCAGGCTACGAAATTGTGGTGGTGGATGACGGCTCCACCGATGGCACCCTAGCCTGGCTAGATGGACATTGCCAGGGATTTCCCCATGTCCGAACCTGGGAACAGGACCACCAGGGGCCCGCTGCCGCCCGGAATCTTGGGGTTAAGGAAGCCGCCGGGGACACCATCATTTTTATTGACAGTGATTTGGTGGTGACGGACATTTTTCTCCAAGCCCATGCCGAAGGTTTACAACGGGGCCAAAAACAATACAATTCAGACCGGGTTTTTACCTATGGGGCCGTGGTCAATACCTGTAACTTTGACTCTCCCCAATCGGAACCCTACAAACTCACTGATTATTCCGCCGCCTTCTTTGCCACTGGCAACGTGGCGATCGCCAAGCAATGGTTACTAGAAGCAGGCTTATTTGACACTGGCTTTCAACTGTATGGCTGGGAAGATTTGGAATTGGGAGTCAGACTGAAAAATTTAGGTCTAAAACTCGTTAAATGCCCCCGGGCAGTGGGCTATCATTGGCATCCTCCCTTCAGTTTGCAACAAATCCCCAAATTAATCGACCAGGAAATACAACGGGGGCGTATGGGGGTTTTATTTTACCAAAAACATCCCACCTGGGAAGTGCGGCTGATGATTCAAATGACTCGGCTCCATTGGTTTCTATGGGGATTACTCTCCTTAGGGGGACGCTTGAATGAAAAAACAATGGCCCCACTCCTCCAATGGCTCATTGACCATGATCGCCCCCAACTAGCCCTAGAAATTGCCCGAATTTTCCTCAATTGGTATAACGTTCAAGGGGTATATGCCGCCTTTGCAGAAAGTCAAAGCTCCCATTAA

Protein

MFFSVVIPTYNRLPILEKCLRALEQQTFDETLISGYEIVVVDDGSTDGTLAWLDGHCQGFPHVRTWEQDHQGPAAARNLGVKEAAGDTIIFIDSDLVVTDIFLQAHAEGLQRGQKQYNSDRVFTYGAVVNTCNFDSPQSEPYKLTDYSAAFFATGNVAIAKQWLLEAGLFDTGFQLYGWEDLELGVRLKNLGLKLVKCPRAVGYHWHPPFSLQQIPKLIDQEIQRGRMGVLFYQKHPTWEVRLMIQMTRLHWFLWGLLSLGGRLNEKTMAPLLQWLIDHDRPQLALEIARIFLNWYNVQGVYAAFAESQSSH