Your browser is old and dusty. Try Google Chrome!

Details for sll1656

ORF sll1656
Accession NP_440150.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -354 -340 11.6026 0.051
NP_440795.1_7 Reverse -128 -135 9.77388 0.169
NP_441418.1_6 Reverse -36 -55 -21.0434 0.136
NP_440815.1_5 Reverse -254 -273 3.83436 0.286
NP_441453.1_7 Reverse -154 -161 14.1988 0.175
NP_441453.1_7 Reverse -121 -128 14.1988 0.175
NP_441453.1_7 Forward -392 -385 12.1338 0.295
NP_442151.1_6 Forward -57 -43 7.37441 0.2
NP_440561.1_1 Forward -375 -356 10.52 0.28
NP_440561.1_5 Forward -396 -377 11.1109 0.278
NP_441818.1_9 Reverse -350 -369 -10.227 0.292
NP_441818.1_9 Reverse -64 -83 -10.4236 0.293
NP_440226.1_1 Reverse -48 -67 3.93269 0.209
NP_440150.1_4 Forward -366 -347 22.3206 0.00949
NP_442655.1_1 Forward -141 -122 0.687771 0.24
NP_442752.1_4 Reverse -256 -263 7.90559 0.144
NP_442975.1_10 Forward -211 -197 1.86729 0.29
NP_440061.1_9 Forward -137 -123 5.99717 0.264
NP_441054.1_2 Forward -228 -209 13.4708 0.199
NP_442062.1_8 Forward -229 -219 7.94484 0.0848
NP_441859.1_3 Forward -58 -39 8.4551 0.139
NP_440304.1_4 Reverse -338 -348 5.48657 0.206
NP_440304.1_4 Reverse -269 -279 2.7333 0.299
NP_440304.1_10 Forward -75 -57 14.1788 0.215
NP_442242.1_4 Reverse -49 -56 9.57722 0.227
NP_442048.1_9 Reverse -4 -23 9.63589 0.276
NP_442602.1_3 Reverse -156 -175 -2.65548 0.261
NP_442110.1_7 Forward -355 -341 4.62115 0.197
NP_442110.1_7 Forward -399 -385 -0.197071 0.276
NP_441083.1_2 Forward -39 -22 15.0827 0.284
NP_441083.1_5 Reverse -180 -190 5.48657 0.116
NP_442827.1_8 Forward -273 -254 2.55527 0.157
NP_440209.1_1 Reverse -48 -56 2.08437 0.286
NP_440447.1_5 Reverse -120 -130 11.7798 0.291
NP_441713.1_5 Reverse -381 -400 19.2723 0.0702
NP_442570.1_3 Forward -351 -332 -3.83545 0.225
NP_442570.1_3 Forward -357 -338 -6.39206 0.257
NP_441792.1_2 Reverse -226 -239 16.8339 0.288
NP_441533.1_9 Forward -162 -143 17.8957 0.3
NP_440906.1_5 Reverse -49 -56 9.47889 0.116
NP_441130.1_10 Reverse -46 -60 6.19444 0.197
NP_442634.1_4 Forward -356 -342 -4.62196 0.211
NP_440842.1_10 Forward -344 -330 6.09611 0.251
NP_440842.1_10 Reverse -331 -345 3.93283 0.254
NP_440057.1_4 Forward -135 -116 13.8922 0.225
NP_441012.1_4 Reverse -342 -355 5.72248 0.291
NP_441634.1_9 Forward -398 -379 10.0284 0.262
NP_440376.1_1 Reverse -6 -15 1.47469 0.251
NP_440376.1_1 Reverse -158 -167 -0.393597 0.289
NP_441588.1_4 Reverse -182 -192 5.19158 0.282
NP_441588.1_4 Reverse -95 -105 5.09324 0.297
NP_442687.1_7 Forward -137 -127 8.23984 0.11
NP_442687.1_7 Reverse -47 -57 4.20827 0.262
NP_442191.1_4 Reverse -67 -81 12.1566 0.225
NP_442485.1_3 Forward -360 -341 -4.42544 0.28
NP_440642.1_10 Forward -344 -330 1.76896 0.289
NP_441682.1_8 Forward -110 -91 11.9958 0.162
NP_440181.1_2 Reverse -380 -398 15.4571 0.155
NP_441029.1_2 Forward -152 -133 13.4708 0.296
NP_441029.1_3 Reverse -380 -399 2.65439 0.277
NP_440667.1_2 Reverse -1 -20 -8.85033 0.297
NP_441763.1_5 Forward -395 -376 -6.68705 0.274
NP_442658.1_1 Reverse -218 -228 8.53436 0.189
NP_442658.1_1 Reverse -338 -348 8.14104 0.199
NP_442782.1_2 Reverse -7 -21 0.196253 0.293
NP_439968.1_8 Forward -397 -381 12.7432 0.288
NP_441487.1_6 Forward -183 -164 -1.57384 0.285
NP_441256.1_1 Forward -79 -60 -4.03212 0.233
NP_442937.1_5 Forward -194 -175 9.43923 0.192
NP_441127.1_1 Reverse -177 -191 8.65272 0.288
NP_439905.1_1 Forward -15 -2 7.88576 0.241
NP_440984.1_7 Forward -270 -256 9.73436 0.127
NP_439990.1_5 Reverse -121 -134 8.67241 0.166
NP_442911.1_2 Forward -67 -48 -10.4236 0.279
NP_441591.1_10 Forward -141 -122 11.0125 0.185
NP_443055.1_6 Forward -282 -264 1.98502 0.222
NP_443055.1_6 Reverse -113 -131 0.215075 0.248
NP_443055.1_6 Reverse -325 -343 -0.866561 0.268
NP_442236.1_3 Forward -255 -236 11.3075 0.189
NP_440993.1_4 Reverse -379 -396 2.10379 0.3
NP_440827.1_3 Reverse -329 -348 12.5858 0.247
NP_442002.1_9 Reverse -186 -193 11.1505 0.185
NP_441000.1_6 Reverse -47 -61 -4.52363 0.245
NP_442771.1_1 Reverse -46 -64 -10.9939 0.294
NP_440147.1_4 Reverse -98 -111 3.36254 0.188
NP_441550.1_8 Forward -191 -181 9.22267 0.103
NP_441916.1_10 Forward -182 -163 2.75272 0.241
NP_441041.1_4 Reverse -1 -20 6.58763 0.042
NP_441041.1_4 Reverse -340 -359 -11.6036 0.25
NP_441041.1_4 Reverse -127 -146 -13.2752 0.285
NP_441041.1_4 Reverse -180 -199 -13.4719 0.288
NP_441725.1_5 Forward -348 -338 7.15819 0.103
NP_441725.1_5 Reverse -148 -158 -0.806614 0.271
NP_440674.1_3 Forward -263 -244 6.09597 0.225
NP_440289.1_2 Reverse -329 -342 -0.472371 0.198
NP_441334.1_7 Forward -141 -122 -14.5535 0.267
NP_440479.1_8 Forward -357 -338 21.2204 0.113
NP_440437.1_1 Reverse -250 -269 3.44104 0.121
NP_442049.1_6 Forward -165 -146 11.0125 0.215
NP_440498.1_1 Forward -298 -280 -1.94747 0.235
NP_442982.1_5 Reverse -329 -348 8.65258 0.12
NP_443030.1_4 Reverse -333 -352 1.86774 0.209
NP_441644.1_6 Reverse -180 -190 3.12618 0.297
NP_442215.1_2 Forward -138 -122 14.8082 0.0195
NP_442215.1_2 Forward -267 -251 9.10498 0.0601
NP_442215.1_2 Reverse -145 -161 2.61514 0.112
NP_442215.1_2 Reverse -337 -353 -3.18639 0.211
NP_442215.1_2 Forward -351 -335 -4.85801 0.24
NP_442215.1_2 Forward -282 -266 -5.25134 0.248
NP_442029.1_1 Reverse -118 -137 -15.0452 0.272
NP_442554.1_8 Reverse -181 -191 2.04498 0.285
NP_441762.1_7 Reverse -387 -399 -3.89426 0.14
NP_442142.1_4 Forward -400 -387 4.83694 0.209
NP_443009.1_5 Reverse -339 -350 7.53132 0.126
NP_443009.1_5 Forward -230 -219 6.64635 0.154
NP_443009.1_5 Reverse -255 -266 6.1547 0.173
NP_441865.1_3 Forward -229 -211 12.9988 0.261
NP_440357.1_6 Reverse -381 -400 3.53937 0.296
NP_440183.1_9 Forward -272 -253 -12.9802 0.26
NP_440183.1_9 Reverse -174 -193 -15.8318 0.273
NP_441198.1_8 Forward -231 -221 11.5134 0.202
NP_441198.1_8 Reverse -338 -348 10.9275 0.232
NP_440379.1_5 Forward -358 -339 -10.9153 0.285
NP_441015.1_10 Forward -114 -95 -5.21209 0.219
NP_441826.1_2 Reverse -250 -264 1.08123 0.164
NP_441826.1_2 Reverse -42 -56 -0.492064 0.213
NP_442490.1_10 Reverse -255 -273 9.95058 0.234
NP_442719.1_2 Reverse -159 -177 -10.5029 0.276
NP_441056.1_4 Forward -273 -254 12.9791 0.277
NP_442361.1_3 Reverse -384 -397 11.9173 0.222
NP_442808.1_1 Reverse -218 -228 1.84789 0.281
NP_442775.1_6 Forward -354 -335 11.5042 0.277
NP_442542.1_9 Forward -76 -62 4.62054 0.292
NP_440038.1_6 Reverse -263 -282 17.5024 0.136
NP_440601.1_7 Reverse -173 -187 21.4357 0.147
NP_441114.1_3 Forward -347 -338 7.57121 0.231
NP_440558.1_2 Reverse -236 -255 -4.6221 0.247
NP_440558.1_2 Reverse -336 -355 -5.70374 0.264
NP_440558.1_2 Reverse -369 -388 -5.99873 0.269
NP_441878.1_6 Reverse -126 -136 -7.0998 0.204
NP_441878.1_6 Forward -157 -147 -7.19813 0.21
NP_441878.1_6 Reverse -339 -349 -7.49312 0.231
NP_441445.1_1 Forward -118 -99 1.76941 0.247
NP_441590.1_4 Forward -21 -2 1.57197 0.3
NP_441433.1_8 Reverse -174 -193 -3.63879 0.283
NP_440101.1_3 Reverse -2 -21 5.50599 0.195
NP_440101.1_3 Forward -270 -251 5.50599 0.195
NP_441458.1_8 Forward -209 -190 5.36764 0.265
NP_441574.1_1 Reverse -130 -149 -3.44213 0.238
NP_442347.1_2 Reverse -257 -266 7.27622 0.127
NP_440151.1_2 Reverse -345 -363 13.3914 0.286
NP_441633.1_3 Forward -59 -46 -4.50394 0.199
NP_442764.1_3 Reverse -339 -349 15.418 0.295
NP_442590.1_10 Forward -271 -252 9.53756 0.196
NP_440899.1_1 Forward -399 -380 7.62671 0.254
NP_440640.1_6 Reverse -58 -77 6.98095 0.177
NP_440640.1_6 Reverse -379 -398 2.3594 0.241
NP_441559.1_8 Forward -353 -339 -3.44199 0.203
NP_441559.1_8 Reverse -88 -102 -5.40861 0.261
NP_441559.1_8 Forward -162 -148 -7.37523 0.291
NP_440915.1_6 Forward -352 -338 -2.36035 0.268
NP_440717.1_2 Reverse -67 -86 -11.5053 0.293
NP_442069.1_7 Reverse -238 -257 9.14342 0.3
NP_442452.1_3 Forward -245 -226 6.19431 0.222
NP_442866.1_1 Forward -270 -251 -3.73712 0.221
NP_442866.1_1 Forward -399 -380 -5.70374 0.244
NP_440748.1_5 Reverse -375 -394 6.29264 0.188
NP_441494.1_6 Reverse -266 -279 7.88576 0.246
NP_442386.1_9 Reverse -219 -228 5.89917 0.233
NP_440570.1_5 Reverse -149 -168 9.73422 0.159
NP_440570.1_5 Forward -166 -147 4.03102 0.231
NP_440586.1_8 Forward -396 -389 7.51192 0.239
NP_442251.1_6 Forward -56 -49 10.4622 0.12
NP_442251.1_9 Reverse -30 -49 10.6192 0.206
NP_440027.1_3 Reverse -250 -268 3.75497 0.267
NP_440027.1_8 Forward -358 -339 7.57013 0.261
NP_439996.1_9 Reverse -216 -235 12.4867 0.19
NP_442294.1_3 Reverse -24 -38 14.3553 0.246
NP_441595.1_2 Reverse -275 -288 12.5712 0.277
NP_440439.1_1 Forward -268 -255 2.77255 0.128
NP_440819.1_5 Forward -93 -85 7.8859 0.266
NP_440316.1_10 Reverse -331 -341 8.82982 0.239
NP_440316.1_10 Reverse -126 -136 6.56821 0.257
NP_439977.1_5 Forward -355 -336 -0.295539 0.222
NP_441572.1_7 Reverse -42 -61 -0.0988766 0.177
NP_441572.1_7 Forward -240 -221 -3.14714 0.207
NP_441604.1_4 Reverse -119 -138 -5.50708 0.272
NP_441018.1_7 Reverse -31 -50 9.63589 0.22
NP_441018.1_7 Forward -269 -250 8.16093 0.255
NP_440163.1_9 Reverse -254 -273 13.6675 0.281
NP_440282.1_3 Reverse -334 -353 -5.31042 0.298
NP_442123.1_2 Forward -54 -36 23.0286 0.0343
NP_441060.1_3 Reverse -174 -193 12.1925 0.184
NP_441060.1_4 Forward -132 -114 2.96908 0.252
NP_441898.1_1 Forward -118 -99 14.9458 0.225
NP_440297.1_9 Forward -348 -338 7.05986 0.15
NP_440297.1_9 Reverse -148 -158 6.37155 0.193
NP_442280.1_10 Forward -199 -181 5.64923 0.283
NP_440894.1_10 Forward -270 -251 5.50599 0.229
NP_440937.1_5 Forward -355 -336 10.0292 0.275
NP_440937.1_5 Forward -400 -381 9.14423 0.275
NP_443036.1_9 Reverse -171 -190 15.6341 0.187
NP_440999.1_9 Forward -140 -126 1.57289 0.162
NP_440999.1_9 Forward -80 -66 -2.65535 0.273
NP_440999.1_9 Forward -359 -345 -3.34366 0.291
NP_440999.1_9 Forward -26 -12 -3.54032 0.296
NP_440888.1_2 Reverse -256 -270 9.24208 0.134
NP_440888.1_2 Reverse -339 -353 5.40719 0.28
NP_439969.1_3 Reverse -306 -325 -0.4922 0.271
NP_442033.1_10 Reverse -36 -55 -6.98204 0.186
NP_440575.1_8 Forward -91 -72 -5.60541 0.272
NP_441469.1_8 Reverse -219 -228 12.5861 0.102
NP_441469.1_8 Reverse -339 -348 9.4395 0.227
NP_441469.1_8 Reverse -126 -135 7.17789 0.227
NP_441548.1_4 Reverse -62 -81 17.4032 0.123
NP_443064.1_6 Forward -265 -255 16.1543 0.0796
NP_442337.1_8 Forward -275 -256 4.32602 0.21
NP_442337.1_8 Reverse -302 -321 3.34271 0.216
NP_443062.1_1 Reverse -220 -238 4.93815 0.244
NP_443062.1_1 Reverse -180 -198 4.93815 0.244
NP_442204.1_5 Reverse -246 -265 0.982764 0.249
NP_441351.1_8 Reverse -263 -282 2.75272 0.24
NP_440516.1_8 Forward -189 -180 7.07956 0.0867
NP_442428.1_8 Forward -398 -379 -0.787193 0.274
NP_441353.1_7 Forward -25 -7 16.2429 0.242
NP_442120.1_10 Forward -354 -335 -15.5368 0.294
NP_441884.1_9 Reverse -253 -272 -13.7669 0.138
NP_442577.1_1 Reverse -350 -369 -3.24547 0.292
NP_441004.1_1 Reverse -334 -353 -5.01543 0.175
NP_441004.1_1 Reverse -1 -20 -15.2418 0.273
NP_441004.1_1 Reverse -379 -398 -18.0934 0.297
NP_441004.1_2 Reverse -329 -348 3.24438 0.208
NP_441004.1_4 Forward -191 -181 8.63316 0.269
NP_442366.1_3 Forward -356 -338 -1.06249 0.204
NP_440296.1_6 Reverse -18 -36 11.079 0.295
NP_442694.1_4 Forward -219 -210 12.0944 0.268
NP_442206.1_7 Forward -350 -331 8.55425 0.295
NP_442206.1_10 Reverse -379 -394 2.92983 0.196
NP_440328.1_4 Reverse -90 -109 3.6377 0.174
NP_443054.1_2 Reverse -254 -268 0.589577 0.258
NP_443054.1_2 Reverse -344 -358 0.491246 0.262
NP_440864.1_9 Forward -353 -334 -6.58872 0.259
NP_441851.1_10 Reverse -339 -349 4.20827 0.282
NP_441349.1_10 Forward -65 -46 -8.35868 0.274
NP_442843.1_1 Reverse -341 -360 -11.3086 0.288
NP_439960.1_10 Reverse -381 -399 -1.55415 0.242
NP_442450.1_5 Reverse -254 -264 13.8447 0.115
NP_440588.1_2 Reverse -118 -137 -5.99873 0.266
NP_439950.1_1 Reverse -77 -86 15.1427 0.156
NP_440954.1_4 Forward -381 -362 -3.54046 0.28
NP_440943.1_4 Reverse -179 -191 15.9686 0.149
NP_442006.1_2 Forward -130 -113 1.12048 0.124
NP_441078.1_4 Forward -15 -6 3.44131 0.14
NP_442729.1_7 Forward -383 -365 6.50899 0.286
NP_442729.1_8 Forward -269 -256 9.75405 0.125
NP_441432.1_8 Reverse -12 -21 8.25953 0.0755
NP_441432.1_8 Forward -349 -340 2.65466 0.292
NP_441945.1_10 Reverse -378 -397 8.94757 0.273
NP_442400.1_3 Reverse -149 -168 10.6192 0.158
NP_440757.1_7 Reverse -166 -184 0.117479 0.269
NP_440941.1_7 Reverse -307 -321 17.8686 0.218
NP_441040.1_2 Reverse -172 -191 -15.5368 0.286
NP_439956.1_7 Reverse -214 -233 1.96607 0.276
NP_440708.1_6 Forward -262 -243 -8.65367 0.258
NP_441800.1_10 Forward -229 -210 1.67108 0.255
NP_442346.1_5 Reverse -47 -57 7.05986 0.183
NP_440352.1_5 Forward -134 -115 14.6998 0.139
NP_440352.1_5 Forward -103 -84 9.83295 0.289
NP_440025.1_3 Reverse -162 -176 9.83628 0.29
NP_440486.1_6 Forward -115 -96 7.27595 0.274
NP_440459.1_2 Forward -138 -121 9.87194 0.215
NP_441943.1_6 Forward -176 -162 18.8791 0.271
NP_441943.1_8 Reverse -330 -349 -3.44213 0.183
NP_442311.1_8 Forward -166 -147 17.994 0.0685
NP_442603.1_7 Forward -189 -175 6.29216 0.249
NP_441948.1_4 Forward -64 -46 -0.865831 0.139
NP_440671.1_4 Reverse -340 -354 5.01447 0.297
NP_442140.1_3 Forward -188 -178 4.10993 0.261
NP_441671.1_10 Forward -270 -251 2.16274 0.257
NP_440567.1_4 Forward -337 -318 1.57275 0.261
NP_441239.1_9 Forward -267 -255 5.05386 0.231
NP_441239.1_9 Forward -351 -339 4.5622 0.251
NP_441239.1_9 Forward -356 -344 4.26721 0.256
NP_441239.1_9 Reverse -178 -190 4.26721 0.256
NP_441951.1_9 Forward -273 -254 6.19431 0.254
NP_440665.1_1 Reverse -379 -398 4.916 0.141
NP_442193.1_1 Forward -336 -318 8.96727 0.26
NP_442270.1_9 Reverse -335 -354 -8.752 0.226
NP_440949.1_7 Reverse -257 -276 8.55343 0.28
NP_442052.1_8 Reverse -258 -268 12.4681 0.268
NP_440546.1_4 Forward -189 -179 9.75513 0.121
NP_440546.1_4 Reverse -332 -342 6.45857 0.296
NP_440546.1_6 Forward -184 -165 8.45592 0.256
NP_442349.1_6 Reverse -253 -272 1.47442 0.214
NP_441509.1_2 Reverse -149 -167 16.9321 0.124
NP_440462.1_4 Forward -395 -381 21.0424 0.0856
NP_442340.1_3 Forward -137 -118 -9.047 0.269
NP_442479.1_8 Reverse -64 -83 17.994 0.0473
NP_442479.1_9 Forward -291 -272 0.982764 0.191
NP_442402.1_4 Reverse -365 -384 -3.34455 0.214
NP_442402.1_4 Forward -203 -184 -10.031 0.296
NP_442402.1_9 Reverse -352 -371 12.1925 0.23
NP_440653.1_10 Forward -360 -341 4.12936 0.252
NP_440696.1_3 Forward -269 -251 -2.24246 0.274
NP_442039.1_3 Reverse -103 -122 16.7157 0.211
NP_441811.1_8 Reverse -305 -319 11.406 0.218
NP_441811.1_8 Reverse -234 -248 6.6861 0.265
NP_442679.1_1 Reverse -185 -204 1.17943 0.185
NP_440160.1_2 Reverse -339 -358 -8.55534 0.286
NP_440160.1_7 Forward -365 -346 12.0942 0.237
NP_440505.1_3 Forward -159 -149 7.05986 0.165
NP_442360.1_5 Reverse -333 -343 13.1564 0.289
NP_441203.1_1 Reverse -148 -167 -20.4534 0.297
NP_441408.2_7 Forward -24 -5 3.93269 0.191
NP_440914.1_1 Reverse -240 -250 10.7621 0.122
NP_440914.1_1 Reverse -180 -190 7.73678 0.224
NP_440914.1_1 Reverse -100 -110 6.3705 0.283
NP_442533.1_6 Reverse -256 -265 4.0313 0.194
NP_442533.1_6 Forward -15 -6 3.93297 0.197
NP_442533.1_6 Reverse -13 -22 2.26134 0.266
NP_442533.1_6 Reverse -127 -136 1.67135 0.293
NP_442232.1_3 Forward -389 -370 -14.3569 0.288
NP_442322.1_4 Reverse -370 -387 -8.02495 0.286
NP_442322.1_4 Reverse -145 -162 -8.22161 0.286
NP_441482.1_7 Forward -162 -148 -9.44018 0.202
NP_440116.1_4 Reverse -354 -373 15.1424 0.251
NP_440116.1_8 Forward -56 -37 -6.1954 0.204
NP_440007.1_9 Forward -160 -146 11.3077 0.163
NP_441680.1_4 Reverse -251 -270 -2.95047 0.276
NP_441961.1_4 Forward -282 -263 2.26107 0.299
NP_441170.1_4 Forward -391 -373 6.90232 0.194
NP_441170.1_4 Forward -274 -256 6.11567 0.213
NP_442890.1_2 Forward -357 -338 7.66927 0.271
NP_439903.1_6 Forward -25 -6 7.07848 0.164
NP_441286.1_1 Forward -58 -46 -7.04085 0.3
NP_441930.1_2 Reverse -339 -349 13.0581 0.248
NP_440886.1_7 Forward -137 -127 6.66608 0.115
NP_440886.1_7 Forward -398 -388 3.61784 0.272
NP_440886.1_7 Forward -16 -6 3.51951 0.279
NP_442072.1_9 Reverse -5 -23 -7.06068 0.0789
NP_441808.1_8 Reverse -58 -77 10.4225 0.236
NP_441021.1_1 Forward -354 -335 -7.76869 0.189
NP_441463.1_3 Forward -146 -127 -2.95047 0.164
NP_441463.1_3 Forward -392 -373 -10.227 0.291
NP_442238.1_3 Forward -354 -335 11.3075 0.144
NP_441962.1_4 Reverse -266 -285 -15.0452 0.297
NP_441431.1_2 Reverse -177 -191 11.9953 0.128
NP_441431.1_3 Forward -121 -102 3.34271 0.268
NP_442647.1_7 Reverse -380 -393 6.50913 0.257
NP_441836.1_2 Forward -192 -173 -5.11376 0.272
NP_441993.1_1 Reverse -346 -365 4.67549 0.215
NP_441993.1_1 Forward -280 -261 3.11618 0.241
NP_442323.1_7 Forward -354 -335 2.45694 0.265
NP_442867.1_8 Reverse -380 -399 7.86593 0.242
NP_442867.1_8 Forward -137 -118 4.71934 0.277
NP_441801.1_4 Reverse -151 -161 11.0914 0.231
NP_440801.1_8 Reverse -179 -198 -1.27885 0.276
NP_442509.1_9 Reverse -256 -266 6.76441 0.254
NP_441489.1_3 Forward -41 -27 8.60589 0.234
NP_440524.1_2 Forward -353 -334 -3.63879 0.27
NP_442587.1_9 Reverse -76 -89 13.1956 0.193
NP_442862.1_3 Reverse -82 -99 7.80699 0.253
NP_442341.1_3 Reverse -148 -167 8.06259 0.202
NP_442341.1_7 Reverse -5 -19 8.45605 0.0881
NP_442341.1_7 Forward -190 -176 8.16106 0.0926
NP_442341.1_7 Forward -266 -252 4.81781 0.177
NP_442341.1_9 Reverse -145 -159 5.80051 0.255
NP_443059.1_10 Reverse -380 -399 -0.0996487 0.275
NP_441842.1_1 Reverse -242 -255 10.4418 0.3
NP_441842.1_10 Reverse -173 -187 8.25939 0.23
NP_440091.1_1 Forward -61 -49 12.527 0.0361
NP_441307.1_4 Forward -396 -377 7.96426 0.177
NP_440679.1_5 Forward -246 -227 6.09597 0.292
NP_440679.1_10 Reverse -381 -400 -13.9635 0.226
NP_442451.1_2 Reverse -105 -124 -3.54046 0.195
NP_439962.1_4 Reverse -172 -191 -5.99873 0.28
NP_439962.1_4 Reverse -380 -399 -8.94866 0.298
NP_440149.1_8 Forward -280 -261 -5.31042 0.223
NP_440149.1_8 Reverse -340 -359 -5.99873 0.238
NP_440172.1_1 Reverse -13 -23 4.69992 0.171
NP_442371.1_1 Forward -126 -116 12.1726 0.258
NP_442015.1_10 Forward -353 -340 -0.275709 0.259
NP_441226.1_7 Forward -188 -181 9.47853 0.147
NP_440305.1_1 Reverse -191 -205 12.903 0.285
NP_443052.1_9 Reverse -335 -354 -4.52377 0.258
NP_442154.1_1 Forward -396 -378 -19.2537 0.294
NP_442046.1_8 Reverse -379 -398 10.8159 0.293
NP_440988.1_10 Reverse -377 -391 4.02751 0.275
NP_440988.1_10 Forward -84 -70 3.54345 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGCCGCCATCATTGGGGTGGGCATTAACTGGACTAACCCAGTACCAGCCACTGGCATTGCCCTAGGGCCCTTTTGTGAAGCGGAATCAATCCAGAGTATCAACAGTCTGACGGATTTAGCTGAAATTACCCTGGCGGGGCTCACCCTTGGTTGGCATCGTTACCAAAGAGAAGGCATTGCAGGCATTTTGGTAGATTATCTCCAATTATTTGCCCATCGGGGCCGGGAAATTAGCCTAACCCAGGGAGTTGGCATAATTGAATCCGTCACCGCCCAGGGAGAATTGGTGGTGCTGATTGGTCAACGACGGGAAATAATCCTCCCCGGCACCGTCAGTCTGGACTACGATCACGCCGGATAACGGCTAAAATACTTACAAGTCAACGCCTATGCCCCCACC

CDS

ATGAACCGACGCAACACCGAATTGGCCAATCCCATTCCCCAGGCCGCCTTGCGGGCCTCCGTAGACTTGACCACCTGGGGCAATATCGGCTTTTGGGTGCAGATTGTTTTGGGAGCCTTTTCCGTAGTCACGTTTTTGTTTGCTGGTTTTAGTCTAAGTGGCCCCAACCGCACTACAGGTATTGAAGCGGGCATCCTTTCAGCCTTTATTTCCATTGTCCTGTTGGGGTTTGGCATTTTCTTTTCCACTCGCTACCGTCGCTTAGGGCGTAACCTCAAGGACTCGGAGGCCACTAAGCATCCCCGCCGGGCCGATATTCTCAAACTGATTCGTATTGGCTTAATCATCAACTTAGTGGGCATGGGTACCGCCATCATTGGGGGAGCGGCCATGAGTGGCATTGTGTTGGGGAAAGCCCTCAGTGTACCACCGGGAACCTTTGCCTCCGCCGCTGACCCCAACCGCTTTGTTCAGTCTACGGATCTCCTCGCTATTCAGGCCAACATCAACACCATCATTGCCCACTTCACTGGTTTGTTGTCGTCCCTGTGGTTGCTAGACCGTCTGAACAAGTAA

Protein

MNRRNTELANPIPQAALRASVDLTTWGNIGFWVQIVLGAFSVVTFLFAGFSLSGPNRTTGIEAGILSAFISIVLLGFGIFFSTRYRRLGRNLKDSEATKHPRRADILKLIRIGLIINLVGMGTAIIGGAAMSGIVLGKALSVPPGTFASAADPNRFVQSTDLLAIQANINTIIAHFTGLLSSLWLLDRLNK