Your browser is old and dusty. Try Google Chrome!

Details for sll1640

ORF sll1640
Accession NP_440387.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -120 -106 7.47274 0.102
NP_441061.1_2 Reverse -113 -127 4.81781 0.143
NP_441061.1_2 Reverse -314 -328 -2.45868 0.293
NP_440795.1_7 Forward -120 -113 14.6904 0.0123
NP_440795.1_7 Reverse -113 -120 14.6904 0.0123
NP_441418.1_6 Reverse -112 -131 -12.5869 0.0672
NP_441418.1_6 Forward -121 -102 -20.4534 0.114
NP_441418.1_6 Forward -316 -297 -29.9915 0.249
NP_441418.1_6 Reverse -69 -88 -30.7781 0.296
NP_441605.1_6 Reverse -15 -34 7.07928 0.202
NP_442291.1_5 Reverse -111 -127 3.30346 0.112
NP_440897.1_6 Forward -354 -335 6.98015 0.0883
NP_441453.1_4 Reverse -112 -120 16.539 0.00633
NP_441453.1_4 Forward -121 -113 16.539 0.00633
NP_441453.1_4 Forward -316 -308 6.80426 0.121
NP_441623.1_1 Forward -85 -67 -1.06249 0.24
NP_442151.1_6 Reverse -112 -126 17.6008 0.00997
NP_442151.1_6 Reverse -307 -321 10.6193 0.119
NP_442151.1_6 Forward -316 -302 6.88276 0.217
NP_441818.1_1 Reverse -113 -124 17.1677 0.00948
NP_440226.1_1 Forward -316 -297 5.40766 0.157
NP_441630.1_3 Forward -129 -110 11.7992 0.0736
NP_440150.1_6 Reverse -342 -361 0.687771 0.296
NP_442173.1_1 Forward -120 -112 15.4574 0.00633
NP_442173.1_1 Reverse -113 -121 15.4574 0.00633
NP_442173.1_1 Reverse -308 -316 5.72262 0.203
NP_442752.1_4 Forward -316 -309 13.8055 0.0199
NP_442752.1_4 Forward -121 -114 13.8055 0.0199
NP_442752.1_4 Reverse -112 -119 13.8055 0.0199
NP_443027.1_4 Reverse -110 -120 13.943 0.0452
NP_443027.1_4 Forward -123 -113 7.35486 0.24
NP_441812.1_1 Forward -165 -151 13.4703 0.234
NP_441812.1_3 Forward -317 -303 10.9143 0.215
NP_442975.1_10 Reverse -108 -122 12.0937 0.0477
NP_442975.1_10 Forward -125 -111 5.1122 0.233
NP_442975.1_10 Reverse -303 -317 3.63724 0.252
NP_440784.1_7 Forward -120 -113 15.9687 0.0123
NP_440784.1_7 Reverse -113 -120 15.9687 0.0123
NP_440784.1_7 Forward -315 -308 6.23397 0.241
NP_440784.1_7 Reverse -308 -315 6.13563 0.241
NP_440110.1_8 Reverse -51 -70 -2.0655 0.258
NP_442062.1_8 Forward -121 -111 19.4496 0.000558
NP_442062.1_8 Reverse -112 -122 17.6796 0.00193
NP_442062.1_8 Forward -323 -313 4.99491 0.188
NP_440761.1_4 Reverse -309 -328 -13.1769 0.257
NP_440761.1_4 Forward -321 -302 -14.0619 0.257
NP_440304.1_4 Forward -123 -113 18.9579 0.00406
NP_440304.1_4 Reverse -110 -120 9.91146 0.051
NP_440304.1_4 Forward -267 -257 5.68323 0.196
NP_442242.1_4 Forward -120 -113 14.3954 0.0124
NP_442242.1_4 Reverse -113 -120 14.3954 0.0124
NP_442242.1_4 Reverse -308 -315 10.8555 0.127
NP_440908.1_5 Forward -119 -102 10.8552 0.236
NP_442602.1_3 Forward -381 -362 -3.44213 0.286
NP_441208.1_9 Forward -124 -110 5.70279 0.262
NP_441208.1_9 Reverse -260 -274 5.1128 0.278
NP_441594.1_6 Forward -130 -111 2.45773 0.251
NP_442110.1_7 Reverse -112 -126 11.6026 0.0595
NP_442110.1_7 Forward -316 -302 10.3243 0.0684
NP_441083.1_5 Reverse -112 -122 19.3512 0.000718
NP_441083.1_5 Forward -121 -111 11.3864 0.0159
NP_441083.1_5 Reverse -307 -317 9.7148 0.0231
NP_442827.1_8 Reverse -104 -123 11.2084 0.0546
NP_442827.1_8 Forward -129 -110 5.89851 0.113
NP_441738.1_2 Reverse -309 -316 15.28 0.0102
NP_441738.1_2 Forward -119 -112 15.28 0.0102
NP_441738.1_2 Reverse -114 -121 15.28 0.0102
NP_441738.1_4 Reverse -102 -121 5.11266 0.207
NP_441558.1_5 Reverse -305 -324 18.7807 0.0115
NP_441558.1_5 Forward -123 -104 6.39097 0.217
NP_441558.1_5 Forward -325 -306 5.211 0.257
NP_440209.1_1 Reverse -112 -120 18.1123 0.00295
NP_440209.1_1 Forward -121 -113 18.1123 0.00295
NP_440209.1_1 Reverse -307 -315 11.9175 0.0184
NP_440209.1_1 Forward -316 -308 8.57422 0.0425
NP_442889.1_8 Reverse -109 -123 9.93039 0.0933
NP_440178.1_7 Forward -122 -103 -1.08219 0.0244
NP_440178.1_7 Reverse -111 -130 -15.5368 0.162
NP_440178.1_7 Forward -217 -198 -22.715 0.272
NP_442570.1_3 Reverse -110 -129 -0.000545616 0.208
NP_442445.1_2 Reverse -316 -335 11.8975 0.288
NP_441716.1_1 Reverse -112 -126 3.63784 0.259
NP_442111.1_4 Forward -122 -108 18.0925 0.00833
NP_442111.1_4 Forward -317 -303 9.73436 0.0587
NP_442111.1_4 Reverse -111 -125 2.16287 0.286
NP_441624.1_7 Forward -228 -214 6.6861 0.275
NP_440906.1_5 Forward -120 -113 15.8704 0.0124
NP_440906.1_5 Reverse -113 -120 15.8704 0.0124
NP_440906.1_5 Forward -315 -308 6.23397 0.234
NP_440906.1_5 Reverse -308 -315 6.13563 0.241
NP_440747.1_10 Forward -124 -112 -1.92764 0.0192
NP_440747.1_10 Reverse -109 -121 -2.1243 0.0225
NP_440747.1_10 Forward -319 -307 -4.48425 0.101
NP_440747.1_10 Reverse -304 -316 -11.8591 0.161
NP_440747.1_10 Forward -219 -207 -11.9574 0.178
NP_441130.1_10 Reverse -110 -124 11.2093 0.107
NP_441130.1_10 Forward -123 -109 9.34103 0.126
NP_442973.1_5 Forward -130 -111 10.2259 0.287
NP_441486.1_1 Forward -124 -110 3.93283 0.0522
NP_441486.1_1 Reverse -109 -123 3.24451 0.0638
NP_441486.1_1 Forward -319 -305 -4.7203 0.205
NP_442634.1_4 Reverse -110 -124 -3.73699 0.164
NP_442634.1_4 Forward -123 -109 -4.7203 0.217
NP_441265.1_3 Reverse -301 -315 1.47456 0.204
NP_440403.1_4 Reverse -103 -122 5.30933 0.111
NP_440403.1_4 Forward -120 -101 -9.63698 0.279
NP_441014.1_8 Forward -85 -66 -9.44032 0.295
NP_441014.1_10 Forward -122 -103 1.08032 0.234
NP_442848.1_1 Reverse -106 -120 7.27608 0.0791
NP_442848.1_1 Forward -127 -113 -2.36035 0.263
NP_442848.1_5 Forward -330 -312 -3.81576 0.299
NP_442848.1_9 Forward -127 -108 16.5191 0.0923
NP_443018.1_3 Forward -120 -113 14.8871 0.0123
NP_443018.1_3 Reverse -113 -120 14.8871 0.0123
NP_443018.1_3 Forward -315 -308 12.6255 0.0471
NP_443018.1_3 Reverse -308 -315 5.25066 0.214
NP_441316.1_7 Forward -123 -108 -2.18338 0.246
NP_441634.1_8 Forward -123 -109 4.03116 0.138
NP_441634.1_8 Reverse -343 -357 2.75286 0.163
NP_440376.1_1 Forward -121 -112 19.4693 0.000692
NP_440376.1_1 Reverse -112 -121 19.4693 0.000692
NP_440376.1_1 Forward -323 -314 2.458 0.221
NP_440376.1_1 Forward -316 -307 0.0980582 0.285
NP_440376.1_1 Reverse -307 -316 -0.196935 0.285
NP_441588.1_4 Reverse -309 -319 18.1713 0.0143
NP_442687.1_7 Forward -122 -112 18.5646 0.0028
NP_442687.1_7 Reverse -111 -121 15.8113 0.0125
NP_440066.1_5 Forward -66 -47 9.93006 0.251
NP_442958.1_3 Reverse -101 -120 2.85105 0.267
NP_440642.1_10 Reverse -260 -274 6.88214 0.225
NP_441029.1_3 Forward -126 -107 0.196116 0.28
NP_441950.1_7 Forward -307 -288 -9.24366 0.293
NP_442296.1_9 Reverse -308 -327 -3.24547 0.249
NP_442658.1_1 Reverse -110 -120 18.7607 0.00222
NP_442658.1_1 Forward -123 -113 14.8275 0.0188
NP_440141.1_8 Reverse -210 -229 7.07928 0.249
NP_441855.2_4 Reverse -286 -305 9.90869 0.27
NP_442782.1_2 Forward -316 -302 5.80112 0.236
NP_442782.1_2 Reverse -314 -328 3.73617 0.263
NP_441414.1_9 Forward -121 -102 15.2408 0.0114
NP_440720.1_6 Reverse -325 -343 15.7521 0.281
NP_442937.1_5 Reverse -107 -126 12.3892 0.111
NP_442937.1_5 Forward -370 -351 7.07928 0.263
NP_441958.1_5 Forward -122 -112 20.5312 0.000966
NP_441958.1_5 Reverse -111 -121 12.2714 0.00183
NP_441958.1_5 Reverse -306 -316 1.55333 0.095
NP_441958.1_5 Forward -324 -314 -0.708283 0.221
NP_441958.1_5 Forward -317 -307 -6.31315 0.28
NP_440203.1_5 Forward -225 -215 14.5325 0.0886
NP_440984.1_7 Forward -359 -345 4.52282 0.299
NP_439990.1_5 Forward -321 -308 6.90245 0.22
NP_442690.1_1 Reverse -15 -34 -16.9135 0.294
NP_442911.1_2 Reverse -102 -121 16.6174 0.00881
NP_442911.1_2 Forward -131 -112 -4.72043 0.14
NP_442911.1_2 Reverse -297 -316 -5.40875 0.158
NP_441580.1_6 Reverse -101 -120 3.24438 0.117
NP_440153.1_5 Forward -120 -106 9.43936 0.125
NP_440153.1_5 Reverse -113 -127 2.5562 0.221
NP_443055.1_6 Forward -78 -60 -0.0799167 0.252
NP_443055.1_6 Reverse -293 -311 -2.34152 0.294
NP_440993.1_2 Forward -126 -110 11.3666 0.0821
NP_440993.1_2 Reverse -107 -123 3.20513 0.262
NP_440993.1_3 Reverse -297 -316 4.42355 0.163
NP_440993.1_4 Forward -228 -211 8.88863 0.216
NP_440827.1_3 Forward -233 -214 12.2908 0.259
NP_440602.1_8 Reverse -112 -126 9.5377 0.298
NP_440138.1_6 Forward -120 -101 5.11187 0.23
NP_441099.1_5 Forward -131 -112 -1.08219 0.102
NP_441099.1_5 Reverse -102 -121 -1.18052 0.105
NP_441099.1_5 Forward -226 -207 -10.0303 0.24
NP_442002.1_1 Reverse -103 -121 -6.86402 0.249
NP_442002.1_9 Forward -122 -115 14.1004 0.074
NP_442002.1_9 Reverse -68 -75 11.3472 0.185
NP_442002.1_9 Reverse -111 -118 10.7572 0.185
NP_442440.1_7 Reverse -108 -127 10.6192 0.215
NP_441646.1_1 Reverse -105 -124 6.58763 0.173
NP_442438.1_10 Forward -126 -112 7.17775 0.0987
NP_442438.1_10 Reverse -107 -121 3.24451 0.165
NP_441000.1_5 Reverse -287 -306 4.32522 0.286
NP_441000.1_6 Forward -122 -108 -3.04867 0.221
NP_441000.1_6 Reverse -111 -125 -5.01529 0.257
NP_441000.1_6 Forward -91 -77 -5.70361 0.29
NP_442771.1_1 Forward -123 -105 -0.7675 0.119
NP_442771.1_1 Reverse -110 -128 -7.06068 0.169
NP_440147.1_4 Forward -123 -110 12.114 0.0326
NP_440147.1_4 Reverse -110 -123 3.65753 0.183
NP_441295.1_4 Forward -227 -208 1.57275 0.29
NP_441550.1_8 Forward -123 -113 15.4175 0.0132
NP_441550.1_8 Reverse -110 -120 10.501 0.066
NP_441550.1_8 Forward -318 -308 5.38779 0.252
NP_441916.1_7 Forward -121 -111 18.4663 0.00144
NP_441916.1_7 Reverse -112 -122 16.893 0.00407
NP_441916.1_10 Forward -273 -254 11.3075 0.136
NP_441041.1_4 Forward -322 -303 -1.7705 0.103
NP_441041.1_4 Forward -121 -102 -8.85033 0.208
NP_441041.1_4 Reverse -112 -131 -10.6203 0.235
NP_441041.1_7 Forward -124 -112 13.2483 0.049
NP_441041.1_7 Reverse -109 -121 10.1386 0.102
NP_442396.1_5 Forward -361 -348 7.88576 0.173
NP_442004.1_6 Reverse -112 -126 2.16287 0.273
NP_440703.1_9 Forward -127 -114 12.3101 0.192
NP_441725.1_4 Reverse -107 -121 2.35894 0.287
NP_441725.1_5 Reverse -113 -123 21.0229 0.00533
NP_441725.1_5 Forward -120 -110 9.02648 0.0553
NP_441725.1_5 Forward -315 -305 -0.511621 0.26
NP_439966.1_7 Reverse -110 -120 17.4824 0.00636
NP_439966.1_7 Reverse -305 -315 13.2542 0.0297
NP_439966.1_7 Forward -123 -113 9.12434 0.119
NP_439966.1_9 Reverse -110 -119 10.7178 0.0863
NP_440736.1_3 Forward -325 -306 1.67108 0.282
NP_442941.1_3 Reverse -113 -123 11.3864 0.0116
NP_442941.1_3 Forward -120 -110 2.53664 0.14
NP_442941.1_3 Reverse -308 -318 1.25834 0.15
NP_442941.1_3 Forward -315 -305 0.766681 0.171
NP_440289.1_2 Forward -124 -111 15.9489 0.00946
NP_440289.1_2 Reverse -109 -122 12.999 0.0132
NP_441076.1_1 Forward -343 -324 9.03774 0.295
NP_440260.1_8 Reverse -109 -127 -6.27403 0.289
NP_442281.1_1 Forward -126 -112 20.2551 0.00194
NP_442281.1_1 Reverse -107 -121 9.73373 0.0675
NP_442281.1_1 Reverse -309 -323 4.91554 0.176
NP_442281.1_1 Forward -321 -307 4.03056 0.21
NP_440177.1_9 Reverse -104 -123 13.7658 0.226
NP_442256.1_2 Reverse -110 -128 -8.04399 0.217
NP_440437.1_1 Forward -127 -108 6.88262 0.072
NP_440437.1_1 Reverse -301 -320 -0.688862 0.185
NP_442012.1_1 Reverse -106 -125 -1.27885 0.282
NP_441087.1_6 Reverse -286 -304 -1.45654 0.265
NP_442288.1_5 Forward -312 -298 15.9292 0.165
NP_442982.1_5 Reverse -297 -316 -0.787193 0.262
NP_442982.1_5 Forward -333 -314 -1.08219 0.263
NP_441644.1_6 Reverse -112 -122 15.7125 0.0048
NP_441644.1_6 Forward -121 -111 10.1076 0.0628
NP_441644.1_6 Reverse -314 -324 7.74772 0.117
NP_441644.1_6 Reverse -307 -317 5.78111 0.176
NP_441644.1_6 Forward -316 -306 5.68278 0.18
NP_441644.1_6 Forward -86 -76 3.51951 0.277
NP_443049.1_6 Forward -317 -307 16.5205 0.102
NP_442215.1_2 Reverse -110 -126 24.1496 0.0019
NP_442215.1_2 Forward -230 -214 -0.236458 0.164
NP_442215.1_2 Forward -318 -302 -3.18639 0.211
NP_442215.1_2 Reverse -311 -327 -5.25134 0.248
NP_442215.1_2 Forward -331 -315 -5.84132 0.26
NP_442029.1_6 Forward -321 -302 8.94757 0.199
NP_442247.1_5 Reverse -294 -308 15.6329 0.234
NP_440253.1_2 Forward -121 -103 4.05072 0.107
NP_440929.1_8 Forward -121 -112 19.2726 0.000701
NP_440929.1_8 Reverse -112 -121 19.2726 0.000701
NP_442933.1_10 Forward -121 -112 17.601 0.00325
NP_442933.1_10 Reverse -112 -121 17.601 0.00325
NP_442933.1_10 Reverse -307 -316 6.48957 0.119
NP_441751.2_8 Reverse -113 -127 5.89945 0.0407
NP_441751.2_8 Reverse -257 -271 -4.22864 0.166
NP_441751.2_8 Reverse -308 -322 -4.32697 0.17
NP_442554.1_8 Forward -120 -110 16.008 0.0065
NP_442554.1_8 Reverse -113 -123 14.828 0.0108
NP_442554.1_8 Reverse -308 -318 5.48657 0.146
NP_442554.1_8 Reverse -214 -224 2.04498 0.285
NP_441762.1_7 Forward -122 -110 20.9835 0.00342
NP_441762.1_7 Reverse -111 -123 2.20226 0.0676
NP_442142.1_4 Forward -124 -111 16.4399 0.0264
NP_442142.1_4 Reverse -304 -317 8.96682 0.106
NP_442142.1_4 Forward -319 -306 4.24695 0.227
NP_442142.1_4 Forward -326 -313 4.05029 0.234
NP_442292.1_1 Forward -120 -111 9.63616 0.0183
NP_442292.1_1 Reverse -113 -122 9.53783 0.0183
NP_442292.1_1 Reverse -308 -317 8.65285 0.0335
NP_442292.1_5 Reverse -108 -127 1.47442 0.257
NP_440919.1_7 Forward -334 -316 4.58327 0.29
NP_442476.1_6 Forward -120 -106 9.83269 0.0801
NP_443009.1_5 Forward -122 -111 20.6093 0.001
NP_443009.1_5 Reverse -111 -122 9.10461 0.0965
NP_443009.1_5 Forward -324 -313 3.8931 0.274
NP_441715.1_4 Forward -120 -110 9.32148 0.097
NP_441715.1_4 Reverse -113 -123 7.25653 0.108
NP_440015.1_9 Reverse -112 -130 7.09898 0.112
NP_441088.1_7 Forward -361 -342 17.699 0.205
NP_441448.1_1 Forward -312 -293 5.99764 0.259
NP_440183.1_1 Reverse -66 -85 4.62101 0.298
NP_440183.1_9 Forward -220 -201 -14.2585 0.263
NP_440183.1_9 Forward -84 -65 -20.1584 0.282
NP_441198.1_5 Reverse -309 -322 14.2767 0.206
NP_441198.1_8 Forward -123 -113 13.076 0.108
NP_440379.1_5 Forward -231 -212 0.884433 0.164
NP_440464.1_10 Reverse -349 -359 13.6766 0.169
NP_440464.1_10 Reverse -266 -276 12.4352 0.225
NP_440464.1_10 Reverse -308 -318 11.8623 0.275
NP_441468.1_1 Forward -120 -113 15.8704 0.0124
NP_441468.1_1 Reverse -113 -120 15.8704 0.0124
NP_441468.1_1 Forward -315 -308 6.13563 0.209
NP_441468.1_1 Reverse -308 -315 6.0373 0.223
NP_441020.2_6 Forward -123 -106 17.4434 0.0191
NP_441020.2_6 Reverse -110 -127 10.9536 0.131
NP_441020.2_6 Forward -357 -340 7.11867 0.241
NP_441673.1_1 Forward -121 -112 20.8459 0.000698
NP_441673.1_1 Reverse -112 -121 20.8459 0.000698
NP_441673.1_1 Forward -316 -307 1.37636 0.114
NP_441673.1_1 Reverse -307 -316 1.1797 0.163
NP_441826.1_2 Forward -127 -113 24.0907 0.00143
NP_441826.1_2 Reverse -106 -120 9.93102 0.0532
NP_441826.1_2 Forward -322 -308 6.78443 0.09
NP_441826.1_2 Forward -329 -315 1.57289 0.147
NP_441826.1_2 Reverse -314 -328 -3.73699 0.286
NP_441826.1_2 Reverse -301 -315 -4.62196 0.298
NP_441826.1_5 Forward -215 -196 1.67108 0.289
NP_441764.1_8 Forward -341 -331 13.6076 0.284
NP_442868.1_6 Forward -123 -113 9.22315 0.0527
NP_442868.1_6 Reverse -110 -120 8.53483 0.0555
NP_442868.1_6 Forward -318 -308 0.0783647 0.248
NP_442719.1_2 Reverse -256 -274 -8.83133 0.257
NP_442719.1_2 Reverse -286 -304 -9.91296 0.268
NP_441056.1_1 Reverse -112 -131 0.392778 0.156
NP_441612.1_2 Forward -272 -262 6.4194 0.291
NP_442361.1_3 Forward -322 -309 8.57408 0.285
NP_442808.1_1 Reverse -111 -121 18.4657 0.00201
NP_442808.1_1 Forward -122 -112 8.73102 0.0481
NP_442808.1_1 Reverse -306 -316 7.84605 0.0668
NP_442775.1_6 Reverse -107 -126 13.6675 0.27
NP_442775.1_6 Forward -321 -302 12.6841 0.277
NP_442542.1_2 Reverse -110 -123 20.8655 0.00569
NP_442050.1_5 Forward -123 -113 15.8108 0.0091
NP_442050.1_5 Reverse -305 -315 13.0576 0.0461
NP_442050.1_5 Reverse -110 -120 8.23937 0.234
NP_442342.1_9 Reverse -110 -126 12.3499 0.107
NP_442342.1_9 Reverse -211 -227 3.40179 0.26
NP_441114.1_3 Forward -226 -217 7.57121 0.231
NP_440558.1_2 Reverse -341 -360 -2.65548 0.229
NP_441878.1_6 Forward -122 -112 20.2362 0.0046
NP_441878.1_6 Reverse -111 -121 10.4031 0.0176
NP_441878.1_6 Reverse -313 -323 -7.59145 0.245
NP_441036.1_8 Reverse -111 -121 17.7779 0.000554
NP_441036.1_8 Forward -122 -112 8.4365 0.174
NP_441557.1_5 Forward -121 -112 19.9609 0.000699
NP_441557.1_5 Reverse -112 -121 19.9609 0.000699
NP_441557.1_5 Forward -316 -307 1.08137 0.0794
NP_441557.1_5 Reverse -307 -316 0.589713 0.134
NP_441557.1_8 Reverse -264 -274 11.7793 0.239
NP_441445.1_8 Forward -226 -207 -11.0136 0.277
NP_442066.2_4 Reverse -112 -131 8.25926 0.0828
NP_442066.2_9 Reverse -108 -121 10.5407 0.154
NP_441433.1_8 Reverse -314 -333 0.491109 0.239
NP_441433.1_8 Reverse -315 -334 -2.55715 0.27
NP_441308.1_8 Reverse -110 -120 9.22315 0.226
NP_440101.1_10 Forward -322 -303 4.32602 0.216
NP_442183.1_1 Forward -121 -107 21.1407 0.00376
NP_442183.1_1 Reverse -112 -126 10.9143 0.078
NP_442183.1_1 Forward -316 -302 4.71948 0.25
NP_442397.1_9 Reverse -307 -326 1.47442 0.283
NP_442397.1_9 Forward -329 -310 1.0811 0.295
NP_441819.1_5 Forward -37 -18 10.074 0.261
NP_440861.1_2 Reverse -155 -174 10.6805 0.27
NP_441467.1_5 Forward -342 -332 18.8596 0.173
NP_442347.1_2 Reverse -308 -317 12.2911 0.056
NP_442347.1_2 Forward -120 -111 11.1111 0.056
NP_442347.1_2 Reverse -113 -122 3.34298 0.284
NP_442645.1_2 Forward -129 -110 -16.6185 0.237
NP_442888.1_6 Forward -138 -119 7.07928 0.216
NP_442888.1_6 Reverse -303 -322 5.70265 0.228
NP_441037.1_4 Reverse -110 -120 16.2838 0.0168
NP_441037.1_4 Forward -123 -113 9.65667 0.21
NP_442594.1_8 Forward -306 -287 11.7992 0.166
NP_442594.1_8 Forward -305 -286 2.0644 0.295
NP_442508.1_8 Forward -318 -301 10.2653 0.272
NP_440151.1_5 Reverse -107 -126 7.37428 0.222
NP_441633.1_3 Reverse -110 -123 5.62415 0.0481
NP_441633.1_3 Forward -123 -110 3.95252 0.0699
NP_440136.1_2 Forward -120 -113 15.9687 0.0123
NP_440136.1_2 Reverse -113 -120 15.9687 0.0123
NP_440136.1_2 Forward -315 -308 6.23397 0.171
NP_440136.1_2 Reverse -308 -315 6.13563 0.193
NP_442590.1_10 Reverse -307 -326 18.1907 0.113
NP_442590.1_10 Reverse -112 -131 16.3224 0.113
NP_442590.1_10 Reverse -106 -125 3.24438 0.294
NP_441728.2_2 Reverse -362 -381 12.2908 0.218
NP_442998.1_5 Reverse -325 -335 11.7798 0.176
NP_442998.1_10 Reverse -309 -316 15.5754 0.0102
NP_442998.1_10 Forward -119 -112 15.5754 0.0102
NP_442998.1_10 Reverse -114 -121 15.5754 0.0102
NP_440899.1_1 Reverse -66 -85 12.1159 0.148
NP_440299.1_1 Reverse -108 -121 20.0782 0.0014
NP_440299.1_1 Forward -125 -112 10.8351 0.0529
NP_441799.1_1 Forward -125 -111 6.98048 0.155
NP_441007.1_10 Reverse -107 -120 1.59258 0.203
NP_441007.1_10 Forward -126 -113 1.00259 0.209
NP_442201.1_10 Reverse -101 -120 -2.45882 0.141
NP_442201.1_10 Forward -132 -113 -13.1769 0.27
NP_442333.2_5 Forward -132 -113 5.211 0.146
NP_440256.1_1 Forward -326 -307 11.6025 0.0141
NP_440256.1_1 Forward -124 -105 -0.787193 0.0961
NP_440256.1_1 Forward -319 -300 -4.81876 0.166
NP_441229.1_3 Reverse -195 -207 17.2469 0.248
NP_441229.1_10 Reverse -42 -61 3.04771 0.288
NP_441559.1_8 Reverse -46 -60 -5.90027 0.271
NP_441559.1_8 Reverse -107 -121 -6.29359 0.276
NP_441559.1_8 Forward -116 -102 -6.49025 0.279
NP_440915.1_6 Reverse -108 -122 22.714 0.00202
NP_440915.1_6 Forward -125 -111 6.3911 0.0826
NP_440915.1_6 Reverse -341 -355 5.21113 0.0924
NP_440915.1_6 Forward -320 -306 3.14618 0.107
NP_442785.1_7 Reverse -100 -114 10.0294 0.231
NP_440749.1_1 Reverse -112 -131 2.0644 0.257
NP_442866.1_1 Reverse -107 -126 11.2092 0.0767
NP_441464.1_8 Reverse -345 -359 6.29277 0.241
NP_440695.1_6 Forward -35 -21 14.1927 0.217
NP_440695.1_6 Forward -338 -324 13.514 0.236
NP_441939.1_4 Reverse -325 -344 17.7133 0.137
NP_441199.1_6 Reverse -108 -127 -0.885524 0.283
NP_442993.1_1 Reverse -112 -128 -7.0213 0.146
NP_442386.1_9 Reverse -111 -120 15.7322 0.0144
NP_442386.1_9 Forward -122 -113 6.39082 0.219
NP_442386.1_9 Reverse -313 -322 6.09583 0.23
NP_442386.1_9 Forward -330 -321 5.40752 0.253
NP_442386.1_9 Reverse -212 -221 5.0142 0.27
NP_440570.1_5 Reverse -371 -390 1.27776 0.243
NP_441340.1_5 Forward -120 -113 15.6737 0.0124
NP_441340.1_5 Reverse -113 -120 15.6737 0.0124
NP_441340.1_5 Forward -315 -308 6.23397 0.132
NP_441340.1_5 Reverse -308 -315 5.84064 0.208
NP_442186.1_9 Forward -274 -255 4.32602 0.281
NP_442484.1_2 Forward -227 -208 0.491109 0.247
NP_442484.1_2 Forward -327 -308 -0.295539 0.26
NP_440168.1_9 Reverse -101 -120 -5.21209 0.296
NP_440168.1_9 Forward -229 -210 -5.50708 0.296
NP_442240.1_1 Reverse -285 -304 8.16011 0.239
NP_442240.1_2 Forward -120 -101 -4.13045 0.0842
NP_441160.1_1 Forward -67 -48 -1.7705 0.236
NP_441027.1_1 Reverse -275 -289 10.9137 0.277
NP_440586.1_8 Forward -315 -308 14.69 0.026
NP_440586.1_8 Forward -120 -113 13.2151 0.026
NP_440586.1_8 Reverse -113 -120 13.2151 0.026
NP_442251.1_6 Forward -120 -113 15.2804 0.0124
NP_442251.1_6 Reverse -113 -120 15.2804 0.0124
NP_442251.1_6 Reverse -308 -315 12.0355 0.0627
NP_440684.1_9 Forward -127 -113 6.58777 0.298
NP_441262.1_3 Reverse -112 -119 14.7888 0.0223
NP_441262.1_3 Forward -316 -309 14.7888 0.0223
NP_441262.1_3 Forward -121 -114 14.7888 0.0223
NP_440027.1_3 Reverse -102 -120 6.50823 0.225
NP_440027.1_3 Forward -128 -110 4.73828 0.253
NP_443051.1_1 Forward -122 -113 18.0926 0.00402
NP_443051.1_1 Reverse -111 -120 10.4228 0.00754
NP_443051.1_1 Forward -317 -308 0.884706 0.125
NP_443051.1_1 Reverse -306 -315 0.29472 0.195
NP_439937.1_9 Forward -61 -44 -8.02495 0.173
NP_439937.1_9 Forward -122 -105 -8.51661 0.176
NP_439937.1_9 Reverse -260 -277 -11.5649 0.257
NP_439937.1_9 Reverse -343 -360 -11.6632 0.261
NP_441595.1_5 Forward -128 -110 6.70565 0.222
NP_440439.1_1 Reverse -109 -122 11.524 0.033
NP_440439.1_1 Forward -124 -111 0.215946 0.199
NP_440372.1_2 Forward -120 -113 16.3621 0.0124
NP_440372.1_2 Reverse -113 -120 16.3621 0.0124
NP_440372.1_2 Forward -315 -308 6.82395 0.0854
NP_440372.1_2 Reverse -308 -315 6.52896 0.188
NP_441789.1_7 Reverse -195 -214 -5.01617 0.293
NP_440316.1_10 Forward -223 -213 6.8632 0.251
NP_441803.1_2 Reverse -302 -321 12.0942 0.0647
NP_441803.1_2 Reverse -107 -126 4.71934 0.175
NP_441803.1_10 Forward -355 -341 12.9793 0.295
NP_439977.1_5 Reverse -106 -125 15.0441 0.0531
NP_440139.1_1 Forward -127 -108 9.53674 0.097
NP_441572.1_7 Forward -127 -108 -0.0988766 0.177
NP_441572.1_7 Reverse -301 -320 -5.99873 0.278
NP_440267.1_2 Forward -126 -112 6.48882 0.228
NP_442384.1_10 Reverse -112 -125 10.639 0.0428
NP_442384.1_10 Forward -121 -108 9.95071 0.047
NP_442384.1_10 Reverse -314 -327 1.78924 0.247
NP_442384.1_10 Reverse -204 -217 1.69091 0.249
NP_442339.1_1 Forward -35 -16 21.6314 0.0537
NP_442114.1_4 Forward -121 -110 12.1534 0.107
NP_440364.1_6 Reverse -313 -326 15.1616 0.275
NP_441604.1_4 Forward -330 -311 -6.98204 0.293
NP_441877.1_3 Reverse -52 -70 14.1788 0.213
NP_441018.1_7 Reverse -108 -127 9.43923 0.223
NP_442790.1_4 Reverse -103 -122 -6.49039 0.144
NP_442790.1_4 Forward -325 -306 -13.8652 0.268
NP_442262.1_10 Forward -120 -113 14.1988 0.0123
NP_442262.1_10 Reverse -113 -120 14.1988 0.0123
NP_442262.1_10 Forward -315 -308 12.9205 0.0422
NP_441689.1_5 Forward -123 -113 8.63269 0.132
NP_441689.1_5 Reverse -305 -315 8.23937 0.142
NP_440344.1_10 Forward -128 -111 0.825489 0.0336
NP_440344.1_10 Reverse -300 -317 -5.27103 0.105
NP_440344.1_10 Reverse -105 -122 -8.22096 0.124
NP_440531.1_6 Forward -129 -110 -0.983855 0.226
NP_441965.1_3 Reverse -102 -121 -0.885524 0.273
NP_441640.1_8 Forward -321 -302 8.45592 0.103
NP_442065.1_5 Forward -120 -101 6.88262 0.0949
NP_440297.1_9 Reverse -113 -123 19.0562 0.0359
NP_440297.1_9 Reverse -314 -324 3.91327 0.253
NP_440297.1_9 Forward -227 -217 3.81494 0.26
NP_440297.1_9 Reverse -214 -224 0.176696 0.282
NP_440297.1_9 Forward -120 -110 -0.216628 0.282
NP_442187.1_3 Forward -317 -307 17.2863 0.0619
NP_442280.1_1 Reverse -112 -131 4.12936 0.259
NP_440894.1_4 Reverse -302 -321 14.8474 0.0896
NP_440894.1_4 Forward -227 -208 1.76941 0.275
NP_440894.1_10 Reverse -107 -126 11.2092 0.148
NP_440894.1_10 Forward -126 -107 5.70265 0.228
NP_440894.1_10 Reverse -302 -321 2.94938 0.279
NP_442067.1_4 Forward -224 -205 8.06259 0.194
NP_440999.1_2 Forward -352 -333 11.7008 0.211
NP_440999.1_9 Reverse -108 -122 12.586 0.0386
NP_440888.1_2 Forward -121 -107 18.6818 0.00204
NP_440888.1_2 Forward -354 -340 12.5853 0.0424
NP_440888.1_2 Reverse -112 -126 11.9953 0.0539
NP_439969.1_3 Reverse -107 -126 0.392778 0.266
NP_439969.1_7 Forward -274 -256 12.8022 0.253
NP_442948.1_2 Forward -317 -298 4.32602 0.264
NP_442033.1_10 Reverse -343 -362 -11.9969 0.261
NP_442033.1_10 Reverse -110 -129 -12.8819 0.277
NP_442033.1_10 Forward -123 -104 -14.4552 0.298
NP_440575.1_8 Reverse -277 -296 0.982764 0.185
NP_441543.1_2 Forward -120 -111 18.486 0.00236
NP_441543.1_2 Reverse -113 -122 9.34117 0.0818
NP_441543.1_2 Reverse -308 -317 7.07956 0.131
NP_441543.1_2 Forward -315 -306 4.52295 0.234
NP_442845.1_2 Forward -127 -113 6.78443 0.202
NP_442845.1_2 Forward -322 -308 5.80112 0.224
NP_442845.1_2 Reverse -314 -328 5.40779 0.233
NP_442845.1_2 Reverse -112 -126 4.52282 0.258
NP_441551.1_5 Reverse -209 -225 5.76105 0.297
NP_441918.1_7 Forward -122 -103 -2.65548 0.297
NP_441469.1_8 Reverse -111 -120 16.126 0.00797
NP_441469.1_8 Forward -122 -113 13.3727 0.073
NP_443064.1_3 Forward -229 -210 5.89931 0.289
NP_443064.1_6 Reverse -112 -122 13.8273 0.0796
NP_443064.1_6 Reverse -307 -317 8.59164 0.278
NP_443064.1_6 Forward -355 -345 8.49468 0.287
NP_442578.1_7 Forward -315 -308 14.6904 0.026
NP_442578.1_7 Forward -120 -113 14.5921 0.026
NP_442578.1_7 Reverse -113 -120 14.5921 0.026
NP_440710.1_1 Reverse -104 -122 -1.65248 0.185
NP_440220.1_4 Reverse -357 -376 -3.93454 0.298
NP_441462.1_2 Reverse -112 -122 20.1379 0.000967
NP_441462.1_2 Forward -121 -111 11.5831 0.00406
NP_441462.1_2 Forward -316 -306 8.63316 0.0339
NP_441621.1_7 Forward -123 -109 4.62115 0.0934
NP_441621.1_7 Reverse -110 -124 -3.44199 0.188
NP_441929.1_3 Reverse -25 -44 0.884433 0.298
NP_443062.1_1 Forward -121 -103 14.6889 0.0444
NP_443062.1_6 Forward -129 -110 1.76941 0.268
NP_442204.1_1 Reverse -303 -314 7.33516 0.135
NP_442204.1_1 Forward -327 -316 1.14031 0.28
NP_442204.1_1 Forward -125 -114 0.451995 0.281
NP_442204.1_5 Forward -131 -112 1.47442 0.235
NP_442204.1_5 Reverse -102 -121 -0.000545616 0.274
NP_440544.1_5 Reverse -334 -341 14.5681 0.264
NP_440516.1_8 Forward -121 -112 16.9127 0.00442
NP_440516.1_8 Reverse -112 -121 16.9127 0.00442
NP_440516.1_8 Forward -316 -307 10.5211 0.00816
NP_442428.1_4 Reverse -111 -130 3.14605 0.246
NP_442428.1_5 Forward -120 -113 15.8704 0.0124
NP_442428.1_5 Reverse -113 -120 15.8704 0.0124
NP_442428.1_5 Forward -315 -308 6.13563 0.209
NP_442428.1_5 Reverse -308 -315 6.0373 0.212
NP_442859.1_2 Forward -120 -101 2.94938 0.262
NP_442120.1_10 Forward -265 -246 -7.27704 0.217
NP_440673.1_2 Reverse -102 -121 7.85324 0.288
NP_440673.1_3 Forward -119 -112 12.4288 0.0426
NP_440673.1_3 Reverse -309 -316 12.4288 0.0426
NP_440673.1_3 Reverse -114 -121 12.4288 0.0426
NP_440673.1_7 Forward -132 -113 19.3707 0.0449
NP_440865.1_9 Forward -127 -108 0.58944 0.136
NP_441052.1_2 Reverse -307 -317 10.6981 0.0285
NP_441052.1_2 Forward -121 -111 10.5014 0.0285
NP_441052.1_2 Reverse -112 -122 10.4031 0.0285
NP_442219.1_9 Forward -120 -111 8.35786 0.0681
NP_442219.1_9 Reverse -113 -122 8.25953 0.0681
NP_442219.1_9 Reverse -308 -317 7.96454 0.0696
NP_440436.1_4 Forward -120 -111 18.1905 0.00233
NP_440436.1_4 Reverse -113 -122 15.9289 0.00508
NP_440436.1_4 Reverse -308 -317 7.57079 0.124
NP_441884.1_8 Forward -122 -103 4.62101 0.0831
NP_441884.1_9 Forward -124 -105 -15.6352 0.138
NP_441884.1_9 Reverse -109 -128 -23.2067 0.284
NP_442864.1_3 Forward -322 -303 13.1758 0.166
NP_440314.1_9 Forward -120 -101 -7.76869 0.243
NP_442577.1_9 Forward -333 -319 11.7003 0.253
NP_441719.1_4 Forward -120 -113 16.3621 0.0124
NP_441719.1_4 Reverse -113 -120 16.3621 0.0124
NP_441719.1_4 Forward -315 -308 13.5105 0.026
NP_441719.1_4 Reverse -308 -315 6.52896 0.188
NP_441733.1_9 Forward -226 -212 17.6992 0.259
NP_441733.1_10 Reverse -109 -122 15.4572 0.06
NP_441733.1_10 Forward -124 -111 9.65572 0.112
NP_441004.1_1 Forward -322 -303 -7.17871 0.197
NP_441004.1_1 Forward -127 -108 -7.57203 0.199
NP_442813.1_4 Forward -331 -312 -5.60541 0.299
NP_442366.1_3 Reverse -111 -129 7.29564 0.0754
NP_442366.1_5 Forward -319 -309 14.8275 0.0375
NP_442366.1_5 Forward -158 -148 10.4026 0.271
NP_441115.1_4 Reverse -111 -129 15.653 0.0361
NP_442206.1_10 Forward -121 -106 -0.118434 0.284
NP_442854.1_6 Forward -121 -102 0.786102 0.288
NP_440328.1_4 Forward -322 -303 -1.27885 0.299
NP_443054.1_2 Forward -123 -109 14.1593 0.0722
NP_443054.1_2 Reverse -110 -124 1.37622 0.247
NP_443054.1_2 Forward -325 -311 1.17956 0.251
NP_441851.1_10 Forward -122 -112 17.4829 0.0027
NP_441851.1_10 Reverse -111 -121 16.008 0.00552
NP_441851.1_10 Forward -317 -307 4.40493 0.271
NP_442622.1_8 Forward -78 -60 -18.9587 0.293
NP_441668.1_4 Forward -304 -285 17.5024 0.0435
NP_442515.1_1 Forward -122 -108 6.88276 0.097
NP_442515.1_1 Reverse -111 -125 -4.13031 0.298
NP_440593.1_3 Reverse -60 -79 -2.75381 0.228
NP_440593.1_3 Forward -126 -107 -3.54046 0.236
NP_440940.1_7 Reverse -102 -120 13.9813 0.0796
NP_441409.1_6 Reverse -301 -320 -5.80207 0.113
NP_440432.1_9 Forward -120 -105 6.17475 0.0477
NP_440432.1_9 Reverse -113 -128 -1.88839 0.167
NP_442843.1_1 Forward -309 -290 -10.227 0.277
NP_442843.1_1 Reverse -321 -340 -11.2103 0.286
NP_442843.1_1 Forward -120 -101 -11.2103 0.286
NP_439960.1_8 Forward -121 -102 13.3725 0.264
NP_439960.1_10 Forward -229 -211 -3.42244 0.273
NP_441477.1_5 Reverse -341 -360 7.66927 0.277
NP_441124.1_5 Reverse -325 -335 13.8676 0.215
NP_442450.1_5 Forward -123 -113 19.1546 0.0103
NP_442450.1_5 Reverse -305 -315 7.64985 0.13
NP_440588.1_2 Reverse -298 -317 -6.29373 0.276
NP_440588.1_2 Forward -332 -313 -6.78538 0.292
NP_440588.1_2 Reverse -343 -362 -7.08038 0.299
NP_440195.1_4 Forward -328 -309 12.2908 0.13
NP_441003.1_9 Reverse -103 -122 9.0459 0.223
NP_443047.1_7 Forward -371 -352 7.96426 0.218
NP_441570.1_1 Forward -121 -103 -5.68405 0.0761
NP_441570.1_1 Reverse -112 -130 -8.04399 0.101
NP_441570.1_1 Forward -316 -298 -17.4838 0.278
NP_440078.1_10 Forward -121 -102 2.55606 0.269
NP_441078.1_4 Forward -121 -112 19.6659 0.0007
NP_441078.1_4 Reverse -112 -121 19.6659 0.0007
NP_441078.1_4 Forward -316 -307 0.196389 0.205
NP_441078.1_4 Reverse -307 -316 -0.000272808 0.205
NP_441078.1_4 Reverse -314 -323 -1.6719 0.266
NP_442729.1_8 Reverse -108 -121 17.9155 0.0343
NP_442729.1_8 Forward -125 -112 8.77074 0.125
NP_441663.1_6 Reverse -6 -25 15.6341 0.213
NP_440526.1_3 Reverse -113 -124 10.8746 0.0646
NP_440526.1_3 Forward -120 -109 2.51647 0.267
NP_440526.1_3 Reverse -308 -319 0.64819 0.273
NP_441432.1_8 Forward -122 -113 8.35786 0.0755
NP_441432.1_8 Reverse -111 -120 8.25953 0.0755
NP_441432.1_8 Forward -317 -308 7.27622 0.101
NP_441432.1_9 Forward -40 -27 8.01662 0.295
NP_442320.1_8 Reverse -106 -120 14.5526 0.0132
NP_442320.1_8 Forward -127 -113 4.42448 0.0504
NP_442320.1_8 Forward -322 -308 -5.40861 0.225
NP_441732.1_2 Forward -125 -109 -6.33298 0.0495
NP_441732.1_2 Reverse -303 -319 -8.20127 0.124
NP_442343.1_1 Reverse -304 -323 14.9458 0.271
NP_440313.1_5 Reverse -286 -304 13.6864 0.214
NP_440497.1_2 Forward -126 -107 3.44104 0.295
NP_442003.1_4 Forward -77 -58 15.5357 0.195
NP_440760.1_1 Forward -121 -102 -2.65548 0.0332
NP_440760.1_1 Reverse -112 -131 -20.1584 0.221
NP_440199.1_10 Forward -124 -114 7.74818 0.231
NP_440199.1_10 Forward -319 -309 7.25653 0.231
NP_442510.1_9 Reverse -108 -122 17.7975 0.172
NP_442727.1_1 Reverse -118 -132 13.0776 0.256
NP_440280.1_2 Forward -89 -70 10.3242 0.256
NP_442489.1_7 Forward -121 -112 20.1576 0.000695
NP_442489.1_7 Reverse -112 -121 20.1576 0.000695
NP_442489.1_7 Reverse -307 -316 7.47288 0.0613
NP_442489.1_7 Forward -316 -307 0.688044 0.152
NP_442489.1_7 Reverse -314 -323 -1.47524 0.203
NP_442489.1_7 Forward -323 -314 -1.96689 0.28
NP_442079.1_7 Forward -120 -101 7.7676 0.13
NP_440559.1_1 Reverse -113 -122 17.306 0.00658
NP_440559.1_1 Forward -120 -111 8.75118 0.0586
NP_440559.1_1 Reverse -308 -317 7.76787 0.0918
NP_441659.2_8 Reverse -112 -122 19.3512 0.000966
NP_441659.2_8 Forward -121 -111 11.9764 0.0147
NP_441659.2_8 Forward -316 -306 1.84832 0.224
NP_441659.2_8 Forward -354 -344 0.275027 0.27
NP_442913.1_10 Reverse -198 -217 -2.45882 0.186
NP_441040.1_2 Reverse -337 -356 13.4708 0.0799
NP_439956.1_7 Reverse -208 -227 2.65439 0.273
NP_441800.1_10 Reverse -218 -237 1.27776 0.267
NP_442346.1_2 Reverse -101 -120 3.53937 0.293
NP_442346.1_5 Forward -122 -112 17.9746 0.00128
NP_442346.1_5 Reverse -111 -121 9.02648 0.118
NP_440352.1_5 Reverse -316 -335 16.1598 0.104
NP_440545.1_3 Forward -125 -108 -0.0594896 0.147
NP_440545.1_3 Reverse -108 -125 -0.354483 0.152
NP_440545.1_3 Forward -320 -303 -6.64766 0.285
NP_441126.1_6 Forward -344 -330 16.6024 0.248
NP_440459.1_2 Reverse -305 -322 17.6401 0.0817
NP_440459.1_2 Reverse -110 -127 10.6586 0.193
NP_440459.1_2 Forward -325 -308 10.6586 0.193
NP_440459.1_2 Forward -130 -113 10.2653 0.204
NP_440459.1_2 Forward -136 -119 7.61033 0.285
NP_441943.1_8 Forward -224 -205 -13.3736 0.265
NP_442603.1_7 Reverse -112 -126 11.9953 0.107
NP_442603.1_7 Forward -121 -107 8.84875 0.162
NP_441585.1_5 Forward -66 -47 0.490334 0.291
NP_441888.1_7 Reverse -107 -121 12.6843 0.0743
NP_440449.1_6 Reverse -104 -122 5.33794 0.279
NP_440449.1_6 Forward -129 -111 4.36531 0.297
NP_441948.1_4 Forward -128 -110 -1.94747 0.156
NP_441833.1_4 Forward -120 -113 15.9687 0.0124
NP_441833.1_4 Reverse -113 -120 15.9687 0.0124
NP_441833.1_4 Reverse -308 -315 6.52896 0.0924
NP_441833.1_4 Forward -315 -308 6.23397 0.163
NP_441895.1_10 Forward -308 -289 -27.6315 0.282
NP_441112.1_5 Forward -164 -145 12.5858 0.144
NP_442699.1_8 Forward -297 -278 -11.7019 0.238
NP_442162.1_9 Forward -120 -113 16.2637 0.0124
NP_442162.1_9 Reverse -113 -120 16.2637 0.0124
NP_442162.1_9 Forward -315 -308 6.62729 0.142
NP_442162.1_9 Reverse -308 -315 6.52896 0.178
NP_440671.1_4 Forward -127 -113 17.6008 0.0197
NP_440671.1_4 Forward -329 -315 7.86607 0.207
NP_440671.1_4 Reverse -301 -315 6.19444 0.257
NP_440671.1_4 Forward -322 -308 5.50613 0.281
NP_442073.1_6 Reverse -298 -317 -3.3438 0.291
NP_442140.1_3 Forward -120 -110 17.4829 0.0159
NP_442140.1_3 Reverse -113 -123 5.68323 0.198
NP_440875.1_9 Forward -119 -109 9.44274 0.233
NP_440875.1_9 Forward -225 -215 8.5667 0.233
NP_441813.1_5 Forward -123 -113 16.1063 0.01
NP_441813.1_5 Reverse -110 -120 10.0098 0.0208
NP_441813.1_5 Reverse -305 -315 6.27322 0.0971
NP_440590.1_4 Forward -120 -107 13.0973 0.013
NP_440590.1_4 Reverse -308 -321 9.55739 0.0347
NP_440590.1_4 Reverse -113 -126 4.05085 0.0642
NP_440567.1_1 Reverse -113 -127 11.996 0.0258
NP_440567.1_1 Reverse -308 -322 8.45605 0.0577
NP_440567.1_1 Forward -120 -106 7.07942 0.0779
NP_440567.1_1 Forward -315 -301 6.19444 0.0871
NP_442497.1_10 Reverse -113 -122 19.8626 0.00532
NP_442497.1_10 Forward -120 -111 10.4228 0.0087
NP_442497.1_10 Reverse -308 -317 0.589713 0.153
NP_442497.1_10 Forward -315 -306 -1.18024 0.256
NP_440821.1_4 Forward -123 -113 19.8429 0.00399
NP_440821.1_4 Reverse -110 -120 18.7612 0.00422
NP_440821.1_4 Forward -318 -308 -0.314959 0.251
NP_441239.1_9 Reverse -110 -122 19.6068 0.00769
NP_441239.1_9 Forward -123 -111 14.297 0.0288
NP_441239.1_9 Reverse -312 -324 8.6921 0.125
NP_441239.1_9 Forward -224 -212 4.26721 0.256
NP_441951.1_4 Forward -127 -108 13.4708 0.168
NP_441951.1_4 Forward -322 -303 0.491109 0.297
NP_440156.1_4 Forward -336 -326 13.5492 0.176
NP_440400.1_1 Reverse -103 -122 -1.18128 0.285
NP_441892.1_1 Forward -130 -113 15.4768 0.03
NP_441892.1_1 Forward -325 -308 -2.3211 0.22
NP_441892.1_1 Reverse -103 -120 -5.46769 0.281
NP_440604.1_6 Forward -121 -102 -5.50708 0.278
NP_442044.1_9 Reverse -112 -131 4.03102 0.231
NP_442270.1_9 Forward -327 -308 -9.047 0.226
NP_441017.1_6 Forward -125 -111 14.0603 0.157
NP_442772.1_4 Reverse -154 -173 -4.22878 0.249
NP_441541.1_1 Reverse -13 -31 -1.14392 0.237
NP_441541.1_1 Forward -284 -266 -3.53122 0.264
NP_440833.1_6 Reverse -361 -375 12.0937 0.205
NP_440833.1_6 Reverse -25 -39 9.34041 0.264
NP_440949.1_7 Reverse -104 -123 10.3234 0.239
NP_440354.1_7 Reverse -106 -124 5.82068 0.297
NP_440546.1_4 Reverse -112 -122 12.8578 0.0572
NP_440546.1_4 Forward -121 -111 11.8882 0.0679
NP_440546.1_4 Forward -316 -306 6.65249 0.288
NP_441230.1_5 Forward -233 -214 1.37609 0.241
NP_440675.1_1 Reverse -253 -272 5.50599 0.218
NP_440675.1_1 Reverse -109 -128 4.32602 0.238
NP_440462.1_6 Reverse -110 -120 17.9746 0.00578
NP_440462.1_6 Forward -123 -113 7.84651 0.0699
NP_440462.1_6 Reverse -305 -315 6.27322 0.121
NP_440868.1_4 Reverse -303 -315 5.84051 0.0879
NP_440868.1_4 Reverse -108 -120 2.89058 0.145
NP_440868.1_4 Forward -72 -60 1.51394 0.181
NP_442479.1_2 Forward -61 -42 12.1925 0.19
NP_440402.1_1 Reverse -289 -308 22.0256 0.00987
NP_442402.1_4 Reverse -299 -318 -3.04956 0.211
NP_441848.1_7 Reverse -293 -312 -1.08295 0.245
NP_441084.1_6 Forward -325 -311 12.3498 0.164
NP_441084.1_6 Forward -123 -109 11.865 0.185
NP_440653.1_10 Reverse -308 -327 4.12936 0.252
NP_440696.1_3 Forward -121 -103 -0.7675 0.249
NP_442039.1_4 Forward -120 -113 15.1821 0.0124
NP_442039.1_4 Reverse -113 -120 15.1821 0.0124
NP_440008.1_9 Forward -127 -108 11.4058 0.202
NP_441926.1_3 Reverse -112 -128 6.35172 0.17
NP_441926.1_3 Reverse -256 -272 5.46674 0.17
NP_440825.1_6 Forward -304 -285 15.7324 0.218
NP_440825.1_7 Reverse -308 -318 13.0072 0.152
NP_442837.1_3 Forward -120 -113 15.7721 0.0124
NP_442837.1_3 Reverse -113 -120 15.7721 0.0124
NP_442837.1_3 Reverse -308 -315 12.1338 0.0702
NP_442837.1_3 Forward -315 -308 6.0373 0.25
NP_439994.1_3 Reverse -111 -130 10.8773 0.202
NP_442053.1_1 Forward -121 -112 18.3876 0.0007
NP_442053.1_1 Reverse -112 -121 18.3876 0.0007
NP_442053.1_1 Reverse -307 -316 14.1594 0.0136
NP_442053.1_1 Reverse -346 -355 8.84951 0.072
NP_442053.1_1 Forward -316 -307 7.86621 0.0863
NP_440505.1_3 Reverse -110 -120 14.1397 0.0235
NP_440505.1_3 Forward -123 -113 7.55152 0.151
NP_441102.1_1 Forward -315 -296 2.75272 0.299
NP_441102.1_2 Forward -44 -25 13.4708 0.159
NP_441203.1_1 Reverse -113 -132 -10.7186 0.137
NP_441203.1_1 Forward -315 -296 -12.4886 0.143
NP_442532.1_7 Forward -121 -107 15.6342 0.0587
NP_441408.2_7 Forward -136 -117 0.884433 0.215
NP_440914.1_1 Reverse -314 -324 11.2501 0.103
NP_440914.1_1 Forward -121 -111 8.6151 0.186
NP_440914.1_1 Reverse -112 -122 8.51751 0.186
NP_440914.1_1 Forward -227 -217 8.12715 0.207
NP_441011.1_8 Forward -120 -111 16.9127 0.00602
NP_441011.1_8 Reverse -113 -122 14.356 0.0249
NP_441011.1_8 Forward -315 -306 5.40793 0.263
NP_442101.1_10 Reverse -104 -123 -8.16202 0.23
NP_442533.1_6 Forward -121 -112 17.2076 0.00137
NP_442533.1_6 Reverse -112 -121 17.2076 0.00137
NP_442533.1_6 Reverse -314 -323 4.71961 0.177
NP_442533.1_6 Reverse -345 -354 3.14632 0.224
NP_442533.1_6 Reverse -119 -128 2.16301 0.27
NP_442541.1_10 Forward -222 -208 1.5723 0.283
NP_442232.1_3 Forward -129 -110 -15.4385 0.291
NP_442322.1_4 Forward -230 -213 -4.78005 0.262
NP_442229.1_1 Reverse -110 -124 10.2254 0.184
NP_443016.1_1 Reverse -71 -90 1.96607 0.167
NP_441482.1_7 Reverse -106 -120 6.78443 0.026
NP_441482.1_7 Forward -127 -113 0.786239 0.0554
NP_441482.1_7 Reverse -301 -315 -11.1118 0.237
NP_441482.1_7 Forward -329 -315 -11.7018 0.281
NP_439944.1_9 Reverse -113 -123 17.3846 0.00516
NP_439944.1_9 Forward -120 -110 10.4031 0.0887
NP_441697.1_5 Forward -47 -28 -11.2207 0.294
NP_441028.1_6 Reverse -266 -276 5.78111 0.243
NP_441028.1_6 Reverse -282 -292 5.38779 0.255
NP_440116.1_5 Forward -319 -302 7.512 0.155
NP_440116.1_8 Reverse -308 -327 1.57275 0.0919
NP_440007.1_9 Forward -326 -312 7.47274 0.208
NP_440007.1_9 Forward -125 -111 4.71948 0.267
NP_440007.1_9 Reverse -235 -249 2.75286 0.277
NP_439965.1_1 Reverse -298 -317 -6.29373 0.213
NP_439965.1_1 Forward -299 -280 -9.34199 0.286
NP_443045.1_5 Reverse -214 -227 17.362 0.119
NP_441602.1_3 Reverse -107 -126 5.01433 0.145
NP_441170.1_3 Forward -83 -64 21.1406 0.0183
NP_441170.1_4 Forward -366 -348 5.52568 0.225
NP_441972.1_5 Forward -120 -101 -2.55715 0.186
NP_441106.1_1 Reverse -111 -120 18.191 0.0028
NP_441106.1_1 Forward -122 -113 9.73449 0.0311
NP_439903.1_6 Reverse -109 -128 2.06362 0.233
NP_439903.1_6 Reverse -304 -323 -0.29631 0.28
NP_441286.1_1 Reverse -111 -123 14.3953 0.00424
NP_441286.1_1 Forward -122 -110 5.34885 0.0259
NP_441286.1_1 Forward -317 -305 3.97222 0.0397
NP_442674.1_3 Forward -129 -110 8.55343 0.194
NP_440670.1_8 Forward -121 -112 18.3876 0.000699
NP_440670.1_8 Reverse -112 -121 18.3876 0.000699
NP_440670.1_8 Forward -323 -314 5.01461 0.175
NP_441705.1_3 Forward -288 -269 -2.26216 0.281
NP_441705.1_7 Forward -124 -105 13.7658 0.264
NP_441930.1_2 Reverse -218 -228 13.2547 0.248
NP_440886.1_7 Reverse -111 -121 17.7774 0.0011
NP_440886.1_7 Forward -122 -112 8.04271 0.0805
NP_440886.1_7 Forward -69 -59 5.28945 0.188
NP_440886.1_7 Reverse -313 -323 4.20782 0.249
NP_442614.1_2 Reverse -112 -126 6.98109 0.276
NP_440460.1_10 Forward -122 -103 14.9458 0.269
NP_442072.1_9 Forward -122 -104 4.34571 0.0229
NP_442072.1_9 Reverse -111 -129 -3.02911 0.0326
NP_442072.1_9 Reverse -306 -324 -22.4986 0.241
NP_442072.1_9 Forward -324 -306 -22.7936 0.259
NP_440907.2_8 Forward -120 -110 17.4824 0.00685
NP_440907.2_8 Reverse -113 -123 9.81266 0.103
NP_441021.1_1 Reverse -113 -132 -2.45882 0.139
NP_441021.1_1 Reverse -308 -327 -3.14714 0.153
NP_441021.1_1 Forward -120 -101 -10.1286 0.229
NP_441021.1_8 Forward -126 -108 4.05072 0.225
NP_440326.1_5 Reverse -254 -267 13.884 0.229
NP_441463.1_3 Reverse -102 -121 -9.24366 0.278
NP_441463.1_5 Forward -214 -200 18.0925 0.188
NP_441463.1_6 Forward -123 -109 6.41593 0.273
NP_442842.1_4 Reverse -113 -132 1.27776 0.29
NP_441626.1_2 Forward -120 -113 15.7721 0.0124
NP_441626.1_2 Reverse -113 -120 15.7721 0.0124
NP_441626.1_2 Forward -315 -308 6.13563 0.177
NP_441626.1_2 Reverse -308 -315 5.93897 0.231
NP_442365.1_7 Forward -125 -106 -4.22878 0.238
NP_442794.1_1 Forward -320 -308 2.69391 0.286
NP_442794.1_1 Reverse -303 -315 2.20226 0.299
NP_442615.1_1 Forward -325 -307 -7.55234 0.296
NP_441962.1_4 Forward -126 -107 8.16093 0.0666
NP_440387.1_1 Forward -121 -105 24.1496 0.00118
NP_440387.1_1 Reverse -112 -128 -0.236458 0.137
NP_440387.1_3 Forward -352 -338 16.2242 0.228
NP_440387.1_4 Forward -71 -53 22.5369 0.105
NP_440387.1_5 Forward -231 -212 18.7269 0.123
NP_440387.1_9 Forward -301 -282 18.7807 0.29
NP_441431.1_2 Forward -89 -75 11.7003 0.135
NP_441431.1_2 Forward -131 -117 5.99717 0.281
NP_441488.1_8 Forward -321 -307 11.7003 0.146
NP_441193.1_1 Forward -62 -43 10.52 0.271
NP_441993.1_1 Reverse -112 -131 13.8365 0.0786
NP_441993.1_1 Forward -127 -108 11.6924 0.111
NP_441993.1_1 Reverse -314 -333 3.99329 0.227
NP_441993.1_1 Forward -322 -303 0.777198 0.292
NP_441174.1_4 Forward -292 -282 16.9913 0.184
NP_440114.1_10 Reverse -112 -126 9.5377 0.169
NP_440114.1_10 Forward -323 -309 7.66941 0.229
NP_442090.1_10 Forward -221 -208 10.2457 0.288
NP_441858.1_2 Reverse -101 -120 9.55037 0.293
NP_440287.1_6 Forward -325 -306 9.63589 0.144
NP_440766.1_4 Forward -125 -111 18.0925 0.0255
NP_440766.1_4 Reverse -108 -122 7.07942 0.097
NP_440766.1_4 Reverse -303 -317 4.12949 0.135
NP_440766.1_5 Reverse -21 -33 13.3853 0.222
NP_440766.1_5 Forward -292 -280 6.70087 0.294
NP_441237.1_6 Forward -162 -145 4.26707 0.255
NP_441237.1_9 Reverse -308 -318 12.0747 0.139
NP_441979.1_5 Forward -127 -108 -2.65548 0.147
NP_442930.1_1 Reverse -330 -340 11.4843 0.258
NP_442930.1_1 Forward -337 -327 10.1076 0.278
NP_439910.1_2 Forward -129 -112 -21.594 0.183
NP_440457.1_1 Forward -125 -113 16.8536 0.0455
NP_440457.1_1 Reverse -108 -120 5.34885 0.141
NP_440457.1_1 Reverse -215 -227 -1.23932 0.3
NP_441981.1_9 Reverse -145 -159 16.7159 0.293
NP_440942.1_3 Forward -172 -153 2.16274 0.298
NP_441984.1_3 Reverse -108 -126 10.8356 0.184
NP_441984.1_3 Forward -358 -340 5.82068 0.276
NP_441889.1_7 Reverse -153 -171 13.4905 0.296
NP_441436.1_8 Forward -122 -103 9.24257 0.269
NP_442509.1_9 Reverse -112 -122 17.3841 0.00128
NP_442509.1_9 Forward -121 -111 16.2041 0.00739
NP_442514.1_5 Forward -74 -55 -4.32786 0.239
NP_440554.1_4 Forward -120 -110 13.943 0.0218
NP_440554.1_4 Reverse -113 -123 6.96153 0.107
NP_441885.1_5 Forward -121 -111 11.4848 0.00668
NP_441885.1_5 Reverse -112 -122 11.3864 0.00668
NP_441885.1_5 Reverse -307 -317 1.25834 0.11
NP_442341.1_7 Forward -122 -108 19.0758 0.00893
NP_442341.1_7 Reverse -111 -125 16.8142 0.0155
NP_442341.1_7 Reverse -306 -320 1.47456 0.288
NP_442341.1_9 Reverse -110 -124 9.24208 0.155
NP_442341.1_9 Reverse -305 -319 4.91554 0.287
NP_441756.1_5 Reverse -108 -127 3.6377 0.199
NP_441173.1_9 Forward -332 -324 13.1954 0.184
NP_441173.1_9 Reverse -267 -275 12.0154 0.214
NP_442395.2_4 Reverse -111 -130 2.55527 0.221
NP_442534.1_7 Reverse -111 -130 10.1275 0.211
NP_440423.1_6 Forward -129 -110 -13.9635 0.224
NP_443000.1_7 Forward -123 -113 8.82982 0.0437
NP_443000.1_7 Reverse -110 -120 2.04498 0.226
NP_443000.1_7 Forward -318 -308 0.57002 0.294
NP_440275.1_3 Reverse -110 -120 17.9746 0.0082
NP_440275.1_3 Forward -123 -113 10.0098 0.0454
NP_440091.1_1 Reverse -108 -120 3.2839 0.163
NP_440091.1_1 Forward -125 -113 1.41561 0.197
NP_441397.1_5 Forward -32 -16 15.1752 0.291
NP_441902.1_3 Forward -276 -266 16.2857 0.159
NP_443010.1_10 Reverse -109 -126 1.90109 0.289
NP_439962.1_4 Reverse -110 -129 -7.96535 0.292
NP_440175.1_7 Reverse -108 -126 9.85107 0.276
NP_440149.1_8 Forward -121 -102 -1.18052 0.157
NP_440149.1_10 Forward -121 -102 -11.7019 0.285
NP_441105.1_3 Forward -327 -308 -8.06369 0.265
NP_441105.1_3 Reverse -296 -315 -8.752 0.278
NP_440216.1_1 Reverse -112 -126 8.25939 0.0061
NP_440216.1_1 Forward -121 -107 -2.55701 0.0521
NP_440216.1_1 Forward -323 -309 -11.8985 0.228
NP_440216.1_1 Forward -316 -302 -12.1934 0.247
NP_440172.1_1 Reverse -112 -122 16.303 0.00854
NP_440172.1_1 Forward -316 -306 8.82982 0.0586
NP_440172.1_1 Forward -121 -111 8.73149 0.0586
NP_440172.1_1 Reverse -314 -324 8.63316 0.059
NP_442371.1_1 Forward -143 -133 12.4676 0.249
NP_442015.1_10 Forward -125 -112 11.229 0.0372
NP_442015.1_10 Reverse -108 -121 3.85419 0.178
NP_441226.1_7 Forward -120 -113 14.4934 0.0123
NP_441226.1_7 Reverse -113 -120 14.4934 0.0123
NP_441111.1_7 Forward -120 -112 18.7023 0.00294
NP_441111.1_7 Reverse -113 -121 18.7023 0.00294
NP_441111.1_7 Reverse -308 -316 8.86921 0.0589
NP_442379.1_10 Forward -128 -111 -0.846137 0.223
NP_440244.1_1 Forward -273 -254 -0.197208 0.187
NP_441766.1_2 Forward -121 -112 17.5026 0.00297
NP_441766.1_2 Reverse -112 -121 17.5026 0.00297
NP_441766.1_2 Reverse -307 -316 8.55452 0.054
NP_442417.1_5 Forward -316 -302 15.5359 0.0537
NP_442417.1_5 Forward -121 -107 13.3726 0.0786
NP_440416.1_9 Forward -330 -311 -19.1751 0.27
NP_443052.1_8 Reverse -102 -121 -9.83364 0.197
NP_443052.1_8 Forward -131 -112 -12.9802 0.27
NP_443052.1_8 Reverse -99 -118 -12.9802 0.27
NP_442116.1_6 Reverse -30 -47 9.88781 0.227
NP_440261.1_5 Reverse -113 -126 -0.767364 0.0655
NP_440261.1_5 Reverse -346 -359 -6.47056 0.201
NP_440261.1_5 Forward -120 -107 -10.4038 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCAGGAGCAGGCCCGTTTCAAAGGTTGGGAAATTGTCCGTTTGGGGCGCACCGCCAGAGGAGAAAAATTTACCCAAGGCCATTGGCGATCGAGTTGGGAAATTTGGCAGGGGGATAAATTAATTTGGGGAGAAAGGCAACAGCTAATTGGTTCGGAACAACTTTACGAATCTCCCAATGCCCTGGCGGGCTTCACTTGTTTGGGCACCTATGTGGACTTGAGTCGTTCCTTTGACCAGGATTTAGTCCATCAAGCTCAGGAGATAATTCACAGCCAAGGGCGATCGCCGCAGTTTGGCCTAACTTTAACTGCGACCCAAGGCCTAATTGCCCGCTACCGGGGAAACTCCACCCAAGAAGTTAAGGATATTTTTACGCAACTTAGTCAGGTAATTAGCCC

CDS

ATGATTTATCTAACCCGTCTTCAGCCCCAACCACCTGCTCCGGGCACGGGGGTAAGATTAGCCATTTACCAAAACCAAGGCGGGCCCATTGGTAATACTGAGGCGATCGCCTATTACTTGGCAAAAATGGAAGAAGCCCTCCAGGGAGCCCAACGTTTTGAAGCCCAGCTAATTAGCTTTGCCGAACTTTATCTAACTGGTTATGCCCTTTCTCCCCAAGAAGTCCATCAATTGGCGATCGCCAGGGACGGGGAAGTGATGACCCAGGTGGGGCAACTAGCGCACAAATATCAGATGGCCATCATTTGTCCCTACCCAGAAAAGGCGGCCATTAACGGGGAAATCCACTACTACGACAGCATTAATCTGTTTGATGACCAAGGAAAATTGGTCAAAACCTATCGCAAAACCCATCTTTGGGGCCCCGACGAAAGCAAAATTTACTCCCGCGGCCATCGCCATAAGGAAGAAGGTAAAGCCTTTACGGTCCATAAAGTTAACGGTTTTCCCATCGGTTTATTGAACTGTTATGAAGCGGAATTTGCCGAATTGACCCGTATCCTAGCCCTGCGGGGGGCAAAATTAGTGGTTATTCCCACGGCGGCGGATATTTGGACCTTGTTATCCACTGGGGAAAGGACAAAAATTCCCTACCCTGATGTGTCCCACAACGTTATTCCCGTGCGGGCTTTGGAAAATCATATTTTTGTTGCCTACTGCAATCGGGCTGGCGCTGAAACCAGGCTCAATGCCCAGGGGAAAACGGTATTGGTGGGGGAATATTTAGGCAACAGTGCCATTGCCGGGCCCCATGGTGATCTTTTGCTCTATCCCCGTAATGAAGAAACTTTGCTCATTGCCGATTGTGTCTCCGCAGATTATGGTTCCCTCCATCCAGAACAAACTAATTACTTAGTTGATCGCCAATCAAATCTGTATGGGTCTTTGGCCAGCGAGTTAACCTGA

Protein

MIYLTRLQPQPPAPGTGVRLAIYQNQGGPIGNTEAIAYYLAKMEEALQGAQRFEAQLISFAELYLTGYALSPQEVHQLAIARDGEVMTQVGQLAHKYQMAIICPYPEKAAINGEIHYYDSINLFDDQGKLVKTYRKTHLWGPDESKIYSRGHRHKEEGKAFTVHKVNGFPIGLLNCYEAEFAELTRILALRGAKLVVIPTAADIWTLLSTGERTKIPYPDVSHNVIPVRALENHIFVAYCNRAGAETRLNAQGKTVLVGEYLGNSAIAGPHGDLLLYPRNEETLLIADCVSADYGSLHPEQTNYLVDRQSNLYGSLASELT