Your browser is old and dusty. Try Google Chrome!

Details for sll1628

ORF sll1628
Accession NP_441087.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -353 -372 2.75272 0.225
NP_440795.1_7 Forward -135 -128 14.6904 0.0123
NP_440795.1_7 Reverse -128 -135 14.6904 0.0123
NP_440795.1_7 Reverse -9 -16 6.43063 0.265
NP_442291.1_5 Reverse -126 -142 10.3833 0.045
NP_440897.1_6 Forward -361 -342 -1.27961 0.187
NP_440897.1_6 Reverse -265 -284 -1.96793 0.2
NP_441453.1_4 Reverse -127 -135 16.539 0.00633
NP_441453.1_4 Forward -136 -128 16.539 0.00633
NP_441453.1_4 Reverse -280 -288 6.80426 0.121
NP_441453.1_4 Reverse -209 -217 4.24765 0.259
NP_441453.1_7 Forward -267 -260 12.9205 0.23
NP_442151.1_6 Forward -136 -122 16.6175 0.0139
NP_442151.1_6 Forward -289 -275 7.86607 0.188
NP_442151.1_6 Reverse -280 -294 5.1128 0.294
NP_441818.1_1 Reverse -128 -139 9.30127 0.246
NP_441818.1_6 Reverse -273 -287 9.63603 0.274
NP_441818.1_9 Forward -268 -249 -10.4236 0.293
NP_440226.1_1 Reverse -127 -146 16.4207 0.0217
NP_440226.1_1 Forward -136 -117 12.3892 0.0451
NP_440226.1_1 Forward -23 -4 5.89931 0.142
NP_442169.1_1 Forward -263 -244 -2.55715 0.279
NP_441342.1_2 Reverse -123 -137 13.1759 0.174
NP_440996.1_3 Forward -324 -306 12.9005 0.221
NP_440996.1_4 Forward -307 -297 17.5813 0.15
NP_442287.1_1 Forward -117 -107 14.3359 0.266
NP_442173.1_1 Forward -135 -127 15.4574 0.00633
NP_442173.1_1 Reverse -128 -136 15.4574 0.00633
NP_442173.1_1 Forward -288 -280 5.72262 0.203
NP_442173.1_1 Reverse -281 -289 4.54265 0.27
NP_442752.1_4 Reverse -280 -287 13.8055 0.0199
NP_442752.1_4 Forward -136 -129 13.8055 0.0199
NP_442752.1_4 Reverse -127 -134 13.8055 0.0199
NP_442752.1_4 Forward -86 -79 12.1338 0.0546
NP_442752.1_4 Forward -242 -235 9.47889 0.109
NP_443027.1_4 Forward -138 -128 11.8781 0.0872
NP_443027.1_4 Reverse -278 -288 11.4848 0.105
NP_443027.1_4 Forward -291 -281 6.46988 0.275
NP_441812.1_3 Reverse -126 -140 8.55439 0.251
NP_442975.1_10 Forward -140 -126 13.4703 0.0459
NP_442975.1_10 Forward -293 -279 2.75226 0.269
NP_441675.1_4 Forward -126 -107 2.26107 0.294
NP_440784.1_7 Forward -135 -128 15.9687 0.0123
NP_440784.1_7 Reverse -128 -135 15.9687 0.0123
NP_440784.1_7 Reverse -281 -288 6.23397 0.241
NP_440784.1_7 Forward -288 -281 6.13563 0.241
NP_442861.1_1 Forward -326 -307 14.8474 0.26
NP_442861.1_1 Forward -315 -296 10.8159 0.295
NP_441250.1_3 Forward -311 -292 6.88262 0.213
NP_440061.1_9 Forward -138 -124 9.53707 0.143
NP_440061.1_9 Forward -220 -206 7.17714 0.216
NP_440110.1_7 Reverse -111 -130 10.4225 0.289
NP_440110.1_8 Forward -291 -272 -0.000545616 0.216
NP_441054.1_2 Forward -246 -227 11.5042 0.267
NP_441054.1_4 Reverse -117 -135 6.60732 0.109
NP_441054.1_4 Forward -371 -353 -3.02911 0.259
NP_440878.1_9 Reverse -117 -136 9.63589 0.111
NP_442062.1_8 Reverse -127 -137 19.4496 0.000558
NP_442062.1_8 Forward -136 -126 17.3846 0.00193
NP_442062.1_8 Reverse -280 -290 7.15819 0.107
NP_440761.1_4 Forward -294 -275 -13.0786 0.257
NP_442974.1_5 Forward -248 -229 5.70265 0.267
NP_441859.1_3 Forward -219 -200 3.14526 0.249
NP_440304.1_4 Reverse -278 -288 9.22315 0.06
NP_440304.1_4 Forward -138 -128 1.84832 0.299
NP_440304.1_4 Reverse -125 -135 1.84832 0.299
NP_442242.1_4 Forward -135 -128 14.3954 0.0124
NP_442242.1_4 Reverse -128 -135 14.3954 0.0124
NP_442242.1_4 Forward -288 -281 10.8555 0.127
NP_440044.1_8 Reverse -12 -31 -0.590531 0.224
NP_441781.1_7 Reverse -71 -90 -1.47551 0.274
NP_441581.1_6 Forward -145 -126 16.0795 0.283
NP_441619.1_8 Reverse -121 -135 6.48882 0.295
NP_441208.1_9 Reverse -124 -138 5.70279 0.262
NP_440764.1_1 Reverse -321 -335 17.8958 0.22
NP_441594.1_6 Reverse -37 -56 2.55606 0.248
NP_442742.1_9 Forward -48 -29 -13.1769 0.269
NP_442110.1_7 Reverse -280 -294 1.37622 0.23
NP_442726.1_7 Reverse -345 -363 7.68896 0.192
NP_441083.1_5 Forward -136 -126 20.3345 0.00053
NP_441083.1_5 Reverse -127 -137 11.3864 0.0159
NP_442827.1_8 Forward -297 -278 -0.689632 0.234
NP_441434.1_7 Reverse -129 -143 12.586 0.108
NP_441434.1_8 Forward -311 -292 10.2463 0.248
NP_440645.1_6 Reverse -321 -340 18.6823 0.0431
NP_441738.1_2 Forward -287 -280 15.28 0.0102
NP_441738.1_2 Forward -134 -127 15.28 0.0102
NP_441738.1_2 Reverse -129 -136 15.28 0.0102
NP_441558.1_5 Reverse -278 -297 10.8159 0.0912
NP_441558.1_5 Forward -291 -272 5.30933 0.254
NP_441942.1_7 Forward -245 -226 16.8141 0.277
NP_440209.1_1 Reverse -127 -135 18.1123 0.00295
NP_440209.1_1 Forward -136 -128 18.1123 0.00295
NP_440209.1_1 Reverse -280 -288 8.57422 0.0425
NP_440209.1_1 Forward -289 -281 5.23096 0.145
NP_442889.1_1 Reverse -101 -120 -6.98204 0.197
NP_442889.1_8 Forward -139 -125 23.8933 0.00131
NP_440447.1_6 Reverse -119 -137 1.19912 0.267
NP_442398.1_4 Forward -313 -294 11.5033 0.181
NP_441713.1_1 Reverse -60 -79 -16.0285 0.275
NP_440178.1_7 Forward -137 -118 -20.65 0.196
NP_440178.1_7 Reverse -126 -145 -21.9284 0.246
NP_441716.1_1 Forward -229 -215 5.01447 0.243
NP_441716.1_1 Forward -116 -102 3.63784 0.259
NP_442111.1_4 Reverse -279 -293 7.17775 0.103
NP_442111.1_4 Reverse -126 -140 3.53951 0.24
NP_441624.1_7 Forward -169 -155 9.73436 0.217
NP_440906.1_5 Forward -135 -128 15.8704 0.0124
NP_440906.1_5 Reverse -128 -135 15.8704 0.0124
NP_440906.1_5 Reverse -281 -288 6.23397 0.234
NP_440906.1_5 Forward -288 -281 6.13563 0.241
NP_440747.1_10 Reverse -124 -136 14.887 0.00223
NP_440747.1_10 Forward -139 -127 7.31547 0.00577
NP_440747.1_10 Reverse -277 -289 -11.6624 0.131
NP_441130.1_10 Reverse -125 -139 8.84938 0.131
NP_442973.1_5 Forward -145 -126 13.8641 0.159
NP_441486.1_1 Forward -139 -125 14.1593 0.00654
NP_441486.1_1 Reverse -124 -138 4.62115 0.0425
NP_442634.1_4 Forward -291 -277 3.8345 0.0946
NP_442634.1_4 Reverse -278 -292 3.63784 0.102
NP_442634.1_4 Forward -244 -230 -5.31028 0.246
NP_441265.1_3 Forward -295 -281 4.22782 0.181
NP_441265.1_3 Reverse -274 -288 1.86788 0.2
NP_440842.1_6 Reverse -71 -90 10.9134 0.263
NP_442848.1_5 Reverse -225 -243 -3.6191 0.294
NP_441012.1_4 Forward -167 -154 14.1789 0.207
NP_443018.1_3 Forward -135 -128 14.8871 0.0123
NP_443018.1_3 Reverse -128 -135 14.8871 0.0123
NP_443018.1_3 Reverse -281 -288 12.6255 0.0471
NP_443018.1_3 Reverse -210 -217 10.7572 0.0907
NP_443018.1_3 Forward -288 -281 5.25066 0.214
NP_443018.1_3 Forward -217 -210 4.56234 0.241
NP_441316.1_7 Forward -291 -276 4.01147 0.137
NP_441634.1_8 Reverse -125 -139 5.21113 0.114
NP_441634.1_8 Forward -194 -180 -0.197071 0.25
NP_441634.1_8 Forward -366 -352 -4.22864 0.295
NP_440376.1_1 Forward -136 -127 19.4693 0.000692
NP_440376.1_1 Reverse -127 -136 19.4693 0.000692
NP_440376.1_1 Reverse -106 -115 7.86621 0.0583
NP_440376.1_1 Reverse -107 -116 1.96635 0.236
NP_440376.1_1 Forward -242 -233 0.688044 0.262
NP_440376.1_1 Reverse -280 -289 0.0980582 0.285
NP_440376.1_1 Forward -86 -77 0.0980582 0.285
NP_440376.1_1 Forward -289 -280 -0.196935 0.285
NP_441588.1_4 Forward -134 -124 15.9097 0.0369
NP_441588.1_4 Reverse -129 -139 7.05986 0.178
NP_442687.1_7 Forward -137 -127 15.8113 0.0125
NP_442687.1_7 Reverse -126 -136 8.92815 0.0994
NP_442687.1_7 Reverse -351 -361 4.99491 0.225
NP_442687.1_7 Reverse -10 -20 4.20827 0.262
NP_442687.1_7 Reverse -181 -191 3.61828 0.299
NP_442191.1_4 Reverse -78 -92 15.5501 0.0585
NP_441846.1_10 Forward -251 -232 -4.22878 0.163
NP_441846.1_10 Forward -252 -233 -20.1584 0.256
NP_441846.1_10 Forward -260 -241 -22.8133 0.266
NP_441846.1_10 Forward -243 -224 -23.2067 0.279
NP_442958.1_3 Forward -229 -210 3.83436 0.253
NP_441422.1_7 Forward -138 -121 -1.73112 0.194
NP_442658.1_1 Forward -138 -128 17.0891 0.00615
NP_442658.1_1 Forward -220 -210 9.91099 0.141
NP_442658.1_1 Reverse -95 -105 6.96107 0.214
NP_442658.1_1 Reverse -125 -135 6.76441 0.214
NP_442658.1_1 Reverse -278 -288 6.17443 0.235
NP_440141.1_3 Reverse -88 -107 3.04771 0.274
NP_440141.1_8 Reverse -174 -193 7.17762 0.246
NP_442496.1_5 Reverse -4 -22 9.85225 0.217
NP_441414.1_9 Forward -136 -117 9.53756 0.0236
NP_441414.1_9 Reverse -127 -146 -7.17871 0.212
NP_440720.1_1 Forward -300 -281 0.884433 0.283
NP_442321.1_4 Reverse -173 -192 -6.98204 0.284
NP_441317.1_4 Reverse -366 -380 11.4693 0.252
NP_441958.1_5 Forward -137 -127 12.2714 0.00183
NP_441958.1_5 Reverse -126 -136 12.2714 0.00183
NP_441958.1_5 Reverse -279 -289 2.63497 0.0388
NP_441958.1_5 Forward -290 -280 1.55333 0.095
NP_442836.1_5 Reverse -121 -140 7.66927 0.157
NP_440203.1_5 Forward -286 -276 10.4026 0.225
NP_439905.1_1 Forward -135 -122 7.29578 0.263
NP_440984.1_7 Forward -141 -127 15.6342 0.0511
NP_440984.1_7 Reverse -122 -136 10.9143 0.122
NP_441097.1_2 Forward -246 -229 6.03703 0.257
NP_439990.1_5 Reverse -122 -135 17.1289 0.0266
NP_439990.1_5 Forward -294 -281 6.4108 0.239
NP_442911.1_2 Reverse -117 -136 -3.54046 0.114
NP_442911.1_2 Forward -146 -127 -4.22878 0.129
NP_441580.1_6 Forward -300 -281 -6.68705 0.235
NP_440153.1_5 Reverse -128 -142 12.291 0.0656
NP_440153.1_8 Forward -23 -10 -2.93064 0.268
NP_442064.1_1 Reverse -122 -141 -2.75381 0.146
NP_440993.1_2 Forward -294 -278 4.18844 0.256
NP_440993.1_2 Reverse -275 -291 3.99177 0.256
NP_440496.1_9 Reverse -76 -95 -2.95047 0.247
NP_441099.1_5 Forward -299 -280 1.37609 0.0661
NP_441099.1_5 Reverse -117 -136 -9.047 0.212
NP_442002.1_9 Forward -137 -130 10.7572 0.185
NP_441294.1_7 Forward -140 -126 18.8495 0.00443
NP_442438.1_10 Forward -141 -127 1.96621 0.188
NP_441000.1_6 Reverse -126 -140 14.8476 0.0396
NP_440147.1_4 Reverse -125 -138 17.7189 0.00602
NP_440147.1_4 Forward -138 -125 10.049 0.0355
NP_441550.1_8 Reverse -125 -135 14.6309 0.0132
NP_441550.1_8 Forward -138 -128 8.82935 0.112
NP_441550.1_8 Reverse -278 -288 8.23937 0.127
NP_441550.1_8 Forward -291 -281 4.99446 0.274
NP_441916.1_7 Reverse -127 -137 18.4663 0.00144
NP_441916.1_7 Forward -136 -126 10.3048 0.0261
NP_441916.1_7 Forward -289 -279 7.45319 0.0656
NP_440206.1_4 Reverse -261 -280 4.32522 0.257
NP_441041.1_4 Reverse -280 -299 -7.4737 0.188
NP_441041.1_4 Forward -136 -117 -7.67036 0.191
NP_441041.1_4 Forward -247 -228 -12.6852 0.272
NP_441041.1_7 Forward -139 -127 17.9128 0.00663
NP_441041.1_7 Forward -292 -280 6.73736 0.195
NP_442396.1_5 Reverse -123 -136 21.1604 0.00421
NP_441725.1_5 Forward -135 -125 2.04498 0.115
NP_441725.1_5 Reverse -128 -138 2.04498 0.115
NP_441725.1_5 Forward -288 -278 -0.904945 0.274
NP_439966.1_7 Forward -138 -128 17.9741 0.00631
NP_439966.1_7 Forward -291 -281 9.02601 0.121
NP_439966.1_7 Reverse -125 -135 7.25606 0.15
NP_439966.1_7 Reverse -250 -260 4.60114 0.265
NP_439966.1_7 Reverse -231 -241 4.20782 0.285
NP_439966.1_7 Reverse -226 -236 4.20782 0.285
NP_439966.1_7 Reverse -278 -288 4.10949 0.289
NP_439966.1_9 Reverse -278 -287 0.983037 0.253
NP_439966.1_9 Forward -138 -129 0.884706 0.253
NP_442941.1_3 Forward -135 -125 11.0914 0.0116
NP_442941.1_3 Reverse -128 -138 10.7964 0.0116
NP_442941.1_3 Forward -288 -278 1.16001 0.15
NP_440289.1_2 Forward -139 -126 20.6688 0.00313
NP_440260.1_8 Reverse -104 -122 -6.76569 0.295
NP_442281.1_1 Forward -141 -127 19.6651 0.00247
NP_442281.1_1 Reverse -275 -289 8.25877 0.0832
NP_441334.1_7 Forward -291 -272 16.7157 0.0116
NP_440437.1_1 Forward -29 -10 9.53756 0.0507
NP_440437.1_1 Forward -142 -123 -1.67217 0.205
NP_440647.1_9 Forward -138 -120 4.44404 0.243
NP_442012.1_1 Reverse -34 -53 0.786102 0.231
NP_442012.1_1 Reverse -100 -119 0.491109 0.237
NP_441087.1_3 Forward -151 -136 20.1377 0.246
NP_441087.1_5 Forward -123 -104 29.1045 0.000681
NP_441087.1_6 Forward -186 -168 24.896 0.0111
NP_441556.1_4 Reverse -343 -362 13.9578 0.18
NP_440498.1_1 Reverse -118 -136 -1.25915 0.222
NP_442982.1_5 Forward -146 -127 -2.45882 0.286
NP_441644.1_6 Forward -136 -126 17.3841 0.00127
NP_441644.1_6 Reverse -127 -137 10.1076 0.0628
NP_441644.1_6 Reverse -209 -219 8.53436 0.0982
NP_441644.1_6 Reverse -280 -290 6.96107 0.141
NP_441644.1_6 Reverse -352 -362 4.50281 0.235
NP_441644.1_6 Forward -75 -65 4.40448 0.239
NP_441644.1_6 Reverse -134 -144 3.71617 0.267
NP_443049.1_6 Reverse -279 -289 11.7385 0.24
NP_440867.1_10 Reverse -112 -131 6.78429 0.251
NP_440867.1_10 Forward -269 -250 1.17943 0.299
NP_442215.1_2 Reverse -152 -168 13.0382 0.0255
NP_442215.1_2 Reverse -125 -141 0.648521 0.148
NP_442215.1_2 Forward -138 -122 -4.56302 0.235
NP_442029.1_6 Reverse -72 -91 13.4708 0.138
NP_440253.1_2 Reverse -127 -145 7.00065 0.0752
NP_440929.1_8 Forward -136 -127 19.2726 0.000701
NP_440929.1_8 Reverse -127 -136 19.2726 0.000701
NP_440929.1_8 Forward -289 -280 7.76787 0.0533
NP_440929.1_8 Reverse -280 -289 7.66954 0.0624
NP_442933.1_10 Forward -136 -127 17.601 0.00325
NP_442933.1_10 Reverse -127 -136 17.601 0.00325
NP_442933.1_10 Forward -289 -280 6.48957 0.119
NP_441751.2_8 Forward -288 -274 2.75286 0.0759
NP_441751.2_8 Forward -135 -121 -4.7203 0.179
NP_442554.1_8 Forward -135 -125 15.3197 0.00882
NP_442554.1_8 Reverse -128 -138 14.1397 0.0144
NP_442554.1_8 Forward -288 -278 9.32148 0.0608
NP_442554.1_8 Reverse -281 -291 6.37155 0.12
NP_442554.1_8 Forward -74 -64 4.50326 0.184
NP_442554.1_8 Reverse -210 -220 3.61828 0.218
NP_442075.1_3 Reverse -165 -184 18.3873 0.232
NP_441762.1_7 Forward -137 -125 9.57708 0.0142
NP_441762.1_7 Reverse -126 -138 2.98891 0.0676
NP_442142.1_4 Forward -139 -126 13.8833 0.0324
NP_442142.1_4 Reverse -124 -137 5.52525 0.188
NP_442142.1_4 Forward -109 -96 4.14862 0.231
NP_442292.1_1 Forward -135 -126 18.486 0.00229
NP_442292.1_1 Reverse -128 -137 9.63616 0.0183
NP_442292.1_1 Forward -288 -279 7.66954 0.0634
NP_442292.1_1 Reverse -281 -290 7.17789 0.0777
NP_442292.1_1 Reverse -210 -219 4.12963 0.185
NP_442292.1_5 Forward -279 -260 -1.7705 0.272
NP_440511.1_1 Forward -242 -224 7.88563 0.228
NP_441024.1_7 Reverse -65 -83 11.4247 0.243
NP_442476.1_6 Reverse -128 -142 3.14618 0.161
NP_442476.1_6 Forward -135 -121 1.67122 0.207
NP_442381.1_8 Forward -139 -120 -6.68705 0.164
NP_443009.1_5 Reverse -126 -137 18.3477 0.00265
NP_443009.1_5 Forward -97 -86 9.3996 0.0965
NP_443009.1_5 Reverse -208 -219 5.66304 0.193
NP_443009.1_5 Reverse -279 -290 4.97473 0.222
NP_441715.1_4 Reverse -128 -138 18.8596 0.00741
NP_441715.1_4 Forward -135 -125 7.94484 0.107
NP_441088.1_1 Reverse -11 -30 17.699 0.0395
NP_441448.1_2 Forward -141 -122 -1.37794 0.273
NP_441613.1_9 Reverse -278 -297 19.469 0.205
NP_441198.1_8 Reverse -207 -217 11.0251 0.228
NP_440379.1_5 Reverse -151 -170 -11.7019 0.3
NP_440464.1_10 Forward -135 -125 13.0082 0.169
NP_441468.1_1 Forward -135 -128 15.8704 0.0124
NP_441468.1_1 Reverse -128 -135 15.8704 0.0124
NP_441468.1_1 Reverse -281 -288 6.13563 0.209
NP_441468.1_1 Forward -288 -281 6.0373 0.223
NP_441468.1_1 Forward -217 -210 4.07068 0.263
NP_441618.1_3 Forward -289 -270 2.16274 0.228
NP_441020.2_6 Reverse -125 -142 7.02034 0.245
NP_441015.1_10 Forward -247 -228 -6.09707 0.241
NP_441015.1_10 Forward -253 -234 -9.93197 0.282
NP_441673.1_1 Forward -136 -127 20.8459 0.000698
NP_441673.1_1 Reverse -127 -136 20.8459 0.000698
NP_441673.1_1 Reverse -280 -289 1.37636 0.114
NP_441673.1_1 Forward -289 -280 1.1797 0.163
NP_441876.1_9 Forward -173 -163 14.0409 0.267
NP_441826.1_2 Forward -142 -128 3.34284 0.111
NP_441826.1_2 Reverse -176 -190 -4.4253 0.296
NP_441330.1_1 Forward -141 -122 -11.4069 0.183
NP_442490.1_9 Reverse -268 -287 -0.590531 0.179
NP_442868.1_6 Forward -138 -128 10.3048 0.038
NP_442868.1_6 Reverse -125 -135 9.81313 0.038
NP_442719.1_2 Forward -317 -299 -10.9946 0.286
NP_441612.1_2 Forward -136 -126 8.54929 0.21
NP_442227.1_2 Reverse -226 -245 -3.14714 0.289
NP_442427.1_8 Forward -145 -126 11.4058 0.152
NP_442427.1_8 Reverse -118 -137 5.89931 0.25
NP_442808.1_1 Forward -137 -127 18.4657 0.00201
NP_442808.1_1 Reverse -126 -136 8.63269 0.0481
NP_442808.1_1 Reverse -225 -235 2.63453 0.26
NP_442808.1_1 Reverse -250 -260 1.94622 0.281
NP_440145.1_3 Forward -252 -233 6.98095 0.0495
NP_442542.1_2 Forward -138 -125 8.47575 0.154
NP_442542.1_9 Reverse -273 -287 10.717 0.111
NP_442542.1_9 Forward -143 -129 4.52221 0.294
NP_442050.1_4 Reverse -132 -151 15.6341 0.0843
NP_442050.1_5 Forward -291 -281 12.5659 0.0574
NP_442050.1_5 Reverse -125 -135 7.64939 0.243
NP_442050.1_5 Reverse -278 -288 7.45273 0.256
NP_442050.1_5 Forward -138 -128 6.96107 0.27
NP_441114.1_3 Reverse -315 -324 8.65285 0.231
NP_441114.1_3 Reverse -184 -193 8.25953 0.231
NP_440558.1_2 Reverse -343 -362 -6.29373 0.273
NP_442792.1_6 Forward -252 -233 4.62101 0.282
NP_441878.1_6 Forward -137 -127 10.4031 0.0176
NP_441878.1_6 Reverse -126 -136 10.4031 0.0176
NP_441878.1_6 Reverse -351 -361 -0.0199663 0.163
NP_441878.1_6 Reverse -106 -116 -6.70647 0.194
NP_441878.1_6 Forward -362 -352 -7.19813 0.21
NP_441878.1_6 Forward -192 -182 -7.39479 0.222
NP_441878.1_6 Reverse -10 -20 -7.98478 0.285
NP_441036.1_8 Forward -137 -127 17.7779 0.000554
NP_441036.1_8 Reverse -126 -136 8.33817 0.174
NP_441036.1_8 Reverse -35 -45 8.33817 0.174
NP_441036.1_8 Forward -290 -280 5.38824 0.287
NP_441557.1_5 Forward -136 -127 19.9609 0.000699
NP_441557.1_5 Reverse -127 -136 19.9609 0.000699
NP_441557.1_5 Forward -289 -280 7.57121 0.049
NP_441557.1_5 Reverse -280 -289 1.08137 0.0794
NP_441557.1_8 Reverse -78 -88 15.7125 0.18
NP_441557.1_8 Forward -176 -166 11.9759 0.236
NP_442066.2_9 Reverse -123 -136 11.1307 0.154
NP_442066.2_9 Forward -140 -127 8.77074 0.185
NP_441433.1_8 Reverse -155 -174 -0.0988766 0.244
NP_442777.1_1 Reverse -234 -253 7.4718 0.244
NP_441458.1_10 Forward -145 -126 3.53937 0.248
NP_442830.1_5 Reverse -226 -240 6.58715 0.216
NP_441564.1_2 Forward -262 -243 3.93269 0.119
NP_442183.1_1 Reverse -280 -294 7.17775 0.147
NP_442170.1_4 Forward -376 -357 9.53756 0.251
NP_442347.1_2 Forward -135 -126 12.4878 0.056
NP_442347.1_2 Reverse -128 -137 11.1111 0.056
NP_442347.1_2 Forward -288 -279 3.14632 0.286
NP_442645.1_2 Reverse -119 -138 -2.85214 0.0487
NP_442645.1_2 Forward -144 -125 -22.2233 0.29
NP_442645.1_2 Forward -83 -64 -22.42 0.291
NP_441037.1_4 Reverse -125 -135 7.9999 0.237
NP_441037.1_4 Reverse -278 -288 7.51261 0.237
NP_441037.1_4 Forward -138 -128 6.92787 0.237
NP_442594.1_8 Forward -87 -68 7.57094 0.213
NP_442594.1_8 Forward -244 -225 6.39097 0.233
NP_441633.1_3 Reverse -125 -138 8.57408 0.0377
NP_441633.1_3 Forward -138 -125 5.72248 0.0481
NP_441633.1_3 Forward -220 -207 -3.22564 0.177
NP_440136.1_2 Forward -135 -128 15.9687 0.0123
NP_440136.1_2 Reverse -128 -135 15.9687 0.0123
NP_440136.1_2 Reverse -281 -288 6.23397 0.171
NP_440136.1_2 Forward -288 -281 6.13563 0.193
NP_442590.1_10 Reverse -100 -119 17.6007 0.113
NP_442590.1_10 Forward -367 -348 3.24438 0.294
NP_442998.1_2 Forward -28 -9 9.04509 0.208
NP_442998.1_10 Forward -287 -280 15.5754 0.0102
NP_442998.1_10 Forward -134 -127 15.5754 0.0102
NP_442998.1_10 Reverse -129 -136 15.5754 0.0102
NP_440299.1_1 Reverse -123 -136 12.9984 0.0319
NP_440299.1_1 Reverse -348 -361 5.23026 0.184
NP_441799.1_1 Reverse -123 -137 18.3868 0.0085
NP_441799.1_1 Forward -140 -126 10.0287 0.0797
NP_441799.1_1 Reverse -276 -290 4.8172 0.236
NP_441007.1_10 Reverse -275 -288 11.229 0.0646
NP_441007.1_10 Reverse -122 -135 1.29759 0.203
NP_441007.1_10 Forward -366 -353 -0.570702 0.287
NP_442333.2_5 Reverse -222 -241 -4.32711 0.214
NP_440256.1_1 Reverse -124 -143 15.3391 0.00687
NP_441559.1_8 Reverse -82 -96 3.24451 0.143
NP_441559.1_8 Reverse -102 -116 0.88457 0.16
NP_441559.1_8 Forward -91 -77 -0.000409212 0.171
NP_441559.1_8 Reverse -178 -192 -4.22864 0.219
NP_441559.1_8 Forward -141 -127 -5.9986 0.271
NP_440915.1_6 Forward -293 -279 3.8345 0.1
NP_440915.1_6 Forward -140 -126 3.63784 0.101
NP_440915.1_6 Forward -246 -232 -0.000409212 0.179
NP_440915.1_6 Forward -90 -76 -0.393733 0.193
NP_442866.1_1 Reverse -101 -120 -8.06369 0.275
NP_441464.1_1 Reverse -229 -248 7.27595 0.262
NP_441464.1_8 Forward -20 -6 6.58777 0.231
NP_441464.1_8 Forward -136 -122 3.63784 0.291
NP_441464.1_10 Reverse -363 -377 10.521 0.254
NP_440306.1_3 Forward -317 -298 8.25926 0.295
NP_441939.1_3 Reverse -128 -147 16.7157 0.0354
NP_441939.1_3 Forward -288 -269 5.211 0.284
NP_441494.1_6 Reverse -275 -288 5.82081 0.292
NP_442993.1_1 Reverse -127 -143 -7.70961 0.146
NP_442993.1_1 Forward -136 -120 -9.28291 0.181
NP_442386.1_9 Forward -137 -128 15.7322 0.0144
NP_442386.1_9 Reverse -126 -135 13.8639 0.0289
NP_442386.1_9 Reverse -76 -85 6.78414 0.219
NP_442386.1_9 Reverse -226 -235 4.52254 0.297
NP_442386.1_10 Forward -237 -224 11.7207 0.195
NP_442386.1_10 Forward -261 -248 4.93583 0.262
NP_440570.1_5 Reverse -117 -136 2.65439 0.234
NP_441340.1_5 Forward -135 -128 15.6737 0.0124
NP_441340.1_5 Reverse -128 -135 15.6737 0.0124
NP_441340.1_5 Reverse -281 -288 6.23397 0.132
NP_441340.1_5 Forward -288 -281 5.84064 0.208
NP_441340.1_5 Reverse -210 -217 3.97235 0.274
NP_441271.1_1 Forward -295 -277 11.9164 0.237
NP_441947.1_4 Forward -34 -15 12.4875 0.234
NP_442484.1_2 Reverse -116 -135 6.68596 0.156
NP_442791.1_5 Forward -104 -85 1.67108 0.21
NP_442791.1_5 Reverse -69 -88 -9.24366 0.279
NP_442791.1_5 Forward -87 -68 -10.0303 0.279
NP_440168.1_9 Forward -220 -201 -1.57384 0.275
NP_442240.1_2 Forward -288 -269 -15.4385 0.212
NP_440161.1_3 Reverse -311 -330 8.55425 0.269
NP_442714.1_7 Forward -135 -116 -2.45882 0.299
NP_441134.1_10 Forward -271 -253 9.36059 0.282
NP_440586.1_8 Reverse -281 -288 14.69 0.026
NP_440586.1_8 Forward -135 -128 13.2151 0.026
NP_440586.1_8 Reverse -128 -135 13.2151 0.026
NP_440586.1_8 Reverse -67 -74 5.8403 0.283
NP_442251.1_6 Forward -135 -128 15.2804 0.0124
NP_442251.1_6 Reverse -128 -135 15.2804 0.0124
NP_442251.1_6 Forward -288 -281 12.0355 0.0627
NP_441262.1_3 Reverse -280 -287 14.7888 0.0223
NP_441262.1_3 Reverse -127 -134 14.7888 0.0223
NP_441262.1_3 Forward -136 -129 14.7888 0.0223
NP_443051.1_1 Reverse -126 -135 10.4228 0.00754
NP_443051.1_1 Forward -137 -128 10.4228 0.00754
NP_443051.1_1 Reverse -279 -288 10.0295 0.0139
NP_443051.1_1 Forward -290 -281 7.66954 0.0571
NP_439984.1_2 Reverse -128 -141 14.9656 0.147
NP_439937.1_9 Reverse -105 -122 -11.8598 0.267
NP_439937.1_9 Reverse -240 -257 -14.6131 0.287
NP_440408.1_7 Forward -242 -223 11.1109 0.232
NP_440439.1_1 Forward -245 -232 5.52582 0.0884
NP_440439.1_1 Forward -139 -126 3.06754 0.121
NP_440439.1_1 Reverse -103 -116 0.412608 0.192
NP_440439.1_1 Forward -89 -76 -0.0790467 0.207
NP_440439.1_1 Reverse -277 -290 -0.37404 0.215
NP_439943.1_1 Reverse -107 -126 0.687771 0.179
NP_439943.1_4 Forward -329 -310 15.3391 0.111
NP_440372.1_2 Forward -135 -128 16.3621 0.0124
NP_440372.1_2 Reverse -128 -135 16.3621 0.0124
NP_440372.1_2 Reverse -281 -288 6.82395 0.0854
NP_440372.1_2 Forward -288 -281 6.52896 0.188
NP_440316.1_10 Forward -192 -182 6.96153 0.251
NP_441803.1_2 Reverse -275 -294 2.94938 0.2
NP_439977.1_5 Forward -295 -276 0.58944 0.207
NP_439977.1_5 Reverse -274 -293 -0.787193 0.236
NP_442368.1_3 Forward -208 -190 7.98396 0.3
NP_440139.1_1 Forward -142 -123 2.85027 0.222
NP_440267.1_2 Forward -141 -127 11.307 0.125
NP_442384.1_10 Forward -136 -123 15.8506 0.00946
NP_442384.1_10 Forward -361 -348 7.00078 0.0899
NP_442384.1_10 Reverse -77 -90 3.75586 0.179
NP_442384.1_10 Forward -96 -83 2.96921 0.206
NP_442384.1_10 Reverse -127 -140 2.87088 0.21
NP_442114.1_4 Reverse -127 -138 9.20345 0.17
NP_441877.1_7 Forward -141 -122 0.883656 0.253
NP_441018.1_7 Reverse -123 -142 7.7676 0.265
NP_442262.1_10 Forward -135 -128 14.1988 0.0123
NP_442262.1_10 Reverse -128 -135 14.1988 0.0123
NP_442262.1_10 Reverse -281 -288 12.9205 0.0422
NP_442262.1_10 Reverse -210 -217 9.87221 0.164
NP_441689.1_5 Reverse -125 -135 5.78111 0.197
NP_440163.1_10 Reverse -34 -44 8.04317 0.292
NP_440344.1_10 Forward -143 -126 -4.77938 0.1
NP_442123.1_3 Forward -289 -270 15.8307 0.102
NP_440189.1_10 Forward -333 -314 3.83436 0.279
NP_440826.1_5 Reverse -167 -185 14.7053 0.233
NP_442832.1_3 Reverse -66 -85 12.1925 0.288
NP_441965.1_10 Forward -139 -123 10.6783 0.107
NP_440297.1_9 Forward -135 -125 -0.118297 0.282
NP_440297.1_9 Reverse -128 -138 -0.118297 0.282
NP_440297.1_9 Forward -360 -350 -0.511621 0.289
NP_442280.1_10 Reverse -67 -85 6.33103 0.279
NP_441896.1_3 Forward -298 -279 5.01433 0.133
NP_441896.1_3 Reverse -118 -137 -1.18052 0.253
NP_440999.1_9 Forward -140 -126 11.406 0.0448
NP_440999.1_9 Forward -27 -13 6.19444 0.101
NP_440999.1_9 Forward -293 -279 0.294584 0.189
NP_440888.1_2 Reverse -127 -141 16.5185 0.00647
NP_440888.1_2 Reverse -77 -91 9.24208 0.134
NP_440888.1_2 Forward -136 -122 8.06211 0.172
NP_440888.1_2 Forward -337 -323 5.01387 0.298
NP_440179.1_6 Forward -135 -116 9.83255 0.189
NP_442277.1_4 Forward -145 -126 1.86696 0.264
NP_442033.1_10 Forward -138 -119 1.67108 0.0882
NP_442033.1_10 Reverse -240 -259 -11.3086 0.251
NP_442033.1_10 Reverse -207 -226 -13.6686 0.287
NP_441759.1_8 Forward -44 -25 26.2529 0.0036
NP_441543.1_2 Reverse -128 -137 18.486 0.00236
NP_441543.1_2 Forward -135 -126 16.9127 0.00359
NP_441543.1_2 Forward -288 -279 6.09625 0.153
NP_441543.1_2 Reverse -281 -290 4.52295 0.234
NP_442845.1_2 Reverse -121 -135 5.99778 0.219
NP_442845.1_2 Forward -81 -67 4.62115 0.256
NP_442845.1_2 Reverse -71 -85 3.24451 0.298
NP_440208.1_1 Forward -119 -100 -11.2103 0.287
NP_441469.1_8 Forward -137 -128 16.126 0.00797
NP_441469.1_8 Reverse -126 -135 6.48957 0.227
NP_441469.1_8 Forward -192 -183 6.39124 0.227
NP_442315.1_2 Reverse -122 -134 9.28209 0.291
NP_443064.1_6 Forward -136 -126 12.5669 0.0796
NP_442578.1_7 Reverse -281 -288 14.6904 0.026
NP_442578.1_7 Forward -135 -128 14.5921 0.026
NP_442578.1_7 Reverse -128 -135 14.5921 0.026
NP_440071.1_1 Reverse -153 -170 8.10125 0.295
NP_441462.1_2 Forward -136 -126 11.5831 0.00406
NP_441462.1_2 Reverse -127 -137 11.5831 0.00406
NP_441462.1_2 Reverse -280 -290 2.04498 0.0806
NP_441462.1_2 Forward -289 -279 0.57002 0.144
NP_441462.1_2 Reverse -352 -362 -0.806614 0.254
NP_441621.1_7 Forward -291 -277 5.30946 0.0879
NP_441929.1_7 Reverse -57 -76 12.9791 0.265
NP_443062.1_1 Reverse -127 -145 6.49827 0.198
NP_443062.1_6 Forward -369 -350 1.96607 0.264
NP_441410.1_3 Forward -145 -126 8.35759 0.21
NP_440519.1_8 Forward -241 -225 3.89344 0.244
NP_442204.1_1 Forward -90 -79 3.40192 0.266
NP_442204.1_1 Reverse -276 -287 2.12362 0.266
NP_442204.1_1 Reverse -62 -73 -0.432984 0.299
NP_441560.1_8 Reverse -122 -141 14.0448 0.184
NP_440516.1_2 Reverse -121 -139 -2.83245 0.299
NP_440516.1_8 Forward -136 -127 16.9127 0.00442
NP_440516.1_8 Reverse -127 -136 16.9127 0.00442
NP_440516.1_8 Reverse -280 -289 1.08137 0.129
NP_442428.1_5 Forward -135 -128 15.8704 0.0124
NP_442428.1_5 Reverse -128 -135 15.8704 0.0124
NP_442428.1_5 Reverse -281 -288 6.13563 0.209
NP_442428.1_5 Forward -288 -281 6.0373 0.212
NP_442428.1_5 Forward -217 -210 4.46401 0.267
NP_441443.1_1 Forward -260 -241 -4.03212 0.287
NP_441443.1_7 Forward -278 -259 -3.14714 0.288
NP_442120.1_10 Forward -280 -261 -14.2585 0.288
NP_442120.1_10 Reverse -148 -167 -14.4552 0.288
NP_440673.1_3 Forward -287 -280 12.4288 0.0426
NP_440673.1_3 Forward -134 -127 12.4288 0.0426
NP_440673.1_3 Reverse -129 -136 12.4288 0.0426
NP_440673.1_3 Reverse -184 -191 6.72562 0.277
NP_441052.1_2 Forward -136 -126 19.9412 0.00106
NP_441052.1_2 Reverse -127 -137 10.5014 0.0285
NP_442219.1_9 Forward -135 -126 17.7976 0.00718
NP_442219.1_9 Reverse -128 -137 8.35786 0.0681
NP_440436.1_4 Reverse -128 -137 18.1905 0.00233
NP_440436.1_4 Forward -135 -126 17.2072 0.00233
NP_441884.1_9 Forward -292 -273 -14.1602 0.138
NP_441884.1_9 Forward -139 -120 -24.19 0.284
NP_442864.1_10 Forward -376 -357 16.0274 0.191
NP_440314.1_9 Forward -135 -116 9.93088 0.0293
NP_440314.1_9 Reverse -210 -229 -7.86702 0.243
NP_441719.1_4 Forward -135 -128 16.3621 0.0124
NP_441719.1_4 Reverse -128 -135 16.3621 0.0124
NP_441719.1_4 Reverse -281 -288 13.5105 0.026
NP_441719.1_4 Forward -288 -281 6.52896 0.188
NP_441733.1_10 Reverse -124 -137 7.09911 0.156
NP_441004.1_1 Reverse -5 -24 -17.3068 0.29
NP_441004.1_4 Reverse -8 -18 14.238 0.175
NP_442366.1_3 Reverse -126 -144 -2.73412 0.232
NP_442366.1_5 Reverse -124 -134 15.4175 0.0374
NP_442873.1_9 Forward -30 -11 16.5182 0.0693
NP_440296.1_10 Forward -245 -226 -12.2919 0.269
NP_441115.1_4 Reverse -279 -297 15.2596 0.042
NP_442694.1_4 Reverse -118 -127 12.2911 0.253
NP_440328.1_4 Forward -142 -123 4.71934 0.161
NP_443054.1_2 Reverse -125 -139 3.34284 0.24
NP_443054.1_2 Forward -117 -103 0.392915 0.267
NP_443054.1_2 Forward -165 -151 -0.0987402 0.284
NP_443054.1_2 Forward -138 -124 -0.0987402 0.284
NP_443054.1_4 Reverse -182 -201 14.7483 0.191
NP_441851.1_10 Forward -137 -127 16.008 0.00552
NP_441851.1_10 Reverse -126 -136 15.8113 0.00552
NP_441851.1_10 Forward -87 -77 4.79825 0.247
NP_441851.1_10 Reverse -279 -289 4.40493 0.271
NP_440347.1_2 Reverse -334 -353 6.19431 0.267
NP_441668.1_4 Forward -201 -182 -1.86883 0.283
NP_442515.1_1 Forward -137 -123 4.62115 0.107
NP_442515.1_1 Reverse -126 -140 3.04785 0.125
NP_442515.1_1 Reverse -351 -365 0.491246 0.19
NP_440593.1_3 Forward -25 -6 -6.78538 0.28
NP_441982.1_6 Forward -131 -122 12.5809 0.274
NP_441046.1_2 Forward -366 -347 0.294447 0.271
NP_441046.1_2 Reverse -116 -135 -0.983855 0.287
NP_441349.1_10 Forward -146 -127 -2.36049 0.118
NP_441409.1_6 Reverse -121 -140 -7.17871 0.145
NP_440432.1_9 Reverse -128 -143 4.79811 0.0644
NP_440432.1_9 Forward -19 -4 0.766545 0.157
NP_440432.1_9 Forward -288 -273 -1.10174 0.167
NP_440432.1_9 Forward -217 -202 -2.8717 0.176
NP_440432.1_9 Forward -176 -161 -5.13331 0.236
NP_442843.1_1 Reverse -98 -117 -1.37718 0.194
NP_442843.1_1 Forward -135 -116 -4.42544 0.239
NP_439960.1_6 Reverse -307 -326 10.6192 0.21
NP_440474.1_8 Forward -288 -274 4.12889 0.291
NP_440431.1_3 Forward -76 -57 -7.27704 0.202
NP_442450.1_5 Reverse -125 -135 7.55152 0.13
NP_442168.1_5 Forward -85 -66 4.42435 0.218
NP_442168.1_5 Forward -135 -116 -4.03212 0.299
NP_440588.1_2 Reverse -118 -137 -2.26216 0.163
NP_440195.1_4 Reverse -115 -134 10.9142 0.154
NP_442006.1_2 Forward -218 -201 -17.8574 0.283
NP_441078.1_4 Forward -136 -127 19.6659 0.0007
NP_441078.1_4 Reverse -127 -136 19.6659 0.0007
NP_441078.1_4 Reverse -280 -289 0.196389 0.205
NP_441078.1_4 Forward -289 -280 -0.000272808 0.205
NP_441078.1_4 Forward -361 -352 -1.86856 0.272
NP_442729.1_8 Reverse -123 -136 10.639 0.125
NP_442729.1_8 Reverse -348 -361 5.62415 0.238
NP_440539.1_9 Forward -138 -119 -2.55715 0.286
NP_440526.1_3 Reverse -128 -139 2.02482 0.267
NP_440526.1_3 Forward -135 -124 1.04151 0.267
NP_440526.1_3 Reverse -281 -292 0.844851 0.267
NP_441432.1_8 Reverse -126 -135 16.8143 0.00595
NP_441432.1_8 Forward -137 -128 8.25953 0.0755
NP_441432.1_8 Reverse -279 -288 7.27622 0.101
NP_441432.1_8 Forward -219 -210 5.21127 0.185
NP_441432.1_8 Forward -192 -183 3.53964 0.244
NP_441432.1_9 Reverse -49 -62 11.1192 0.235
NP_442320.1_8 Forward -142 -128 5.30946 0.0394
NP_442344.1_7 Forward -135 -116 2.55606 0.0638
NP_442447.1_1 Forward -309 -290 11.3075 0.258
NP_442003.1_4 Forward -135 -116 11.3075 0.277
NP_442003.1_4 Reverse -315 -334 9.63589 0.299
NP_440760.1_1 Forward -136 -117 5.99764 0.0115
NP_440760.1_1 Reverse -127 -146 -21.83 0.245
NP_440760.1_6 Forward -251 -232 13.9625 0.263
NP_441131.1_6 Forward -208 -190 3.16574 0.267
NP_441945.1_10 Forward -362 -343 7.86593 0.282
NP_441057.1_3 Reverse -62 -81 -12.3902 0.255
NP_442353.1_4 Forward -142 -123 11.6017 0.0922
NP_442353.1_6 Reverse -98 -117 8.35759 0.298
NP_440913.1_1 Forward -277 -259 3.95239 0.285
NP_442727.1_1 Reverse -117 -131 12.4876 0.262
NP_442489.1_7 Forward -136 -127 20.1576 0.000695
NP_442489.1_7 Reverse -127 -136 20.1576 0.000695
NP_442489.1_7 Forward -289 -280 7.47288 0.0613
NP_442489.1_7 Reverse -280 -289 0.688044 0.152
NP_442489.1_7 Forward -361 -352 -1.37691 0.195
NP_441706.1_10 Reverse -124 -143 19.2723 0.07
NP_442079.1_7 Forward -288 -269 5.211 0.178
NP_442079.1_7 Forward -135 -116 3.14605 0.212
NP_442079.1_7 Forward -217 -198 1.86774 0.24
NP_440559.1_1 Forward -135 -126 17.4043 0.00658
NP_440559.1_1 Reverse -128 -137 8.75118 0.0586
NP_440559.1_1 Reverse -281 -290 4.71961 0.217
NP_440559.1_1 Forward -217 -208 4.42462 0.277
NP_441659.2_8 Forward -136 -126 18.1713 0.00133
NP_441659.2_8 Reverse -127 -137 11.9764 0.0147
NP_441659.2_8 Reverse -280 -290 8.04317 0.0508
NP_441659.2_8 Reverse -352 -362 6.17489 0.084
NP_441659.2_8 Reverse -209 -219 3.42162 0.161
NP_441659.2_8 Forward -289 -279 1.74999 0.227
NP_441659.2_8 Forward -23 -13 -0.216628 0.292
NP_442913.1_10 Forward -145 -126 5.99764 0.0664
NP_442913.1_10 Reverse -118 -137 -0.4922 0.161
NP_442913.1_10 Reverse -2 -21 -4.72043 0.244
NP_442849.1_1 Forward -253 -239 10.521 0.204
NP_439956.1_7 Forward -247 -228 3.14605 0.261
NP_440779.1_5 Reverse -127 -144 -6.15601 0.164
NP_442346.1_5 Reverse -126 -136 16.6963 0.00248
NP_442346.1_5 Reverse -65 -75 12.4681 0.0421
NP_442346.1_5 Reverse -351 -361 9.61647 0.118
NP_442346.1_5 Forward -137 -127 9.02648 0.118
NP_442346.1_5 Reverse -10 -20 7.55152 0.165
NP_442346.1_5 Reverse -279 -289 5.87989 0.225
NP_442346.1_5 Reverse -208 -218 4.20827 0.296
NP_440545.1_3 Forward -293 -276 5.05372 0.0646
NP_440545.1_3 Reverse -276 -293 0.432165 0.139
NP_440545.1_3 Forward -120 -103 0.137172 0.144
NP_441856.1_3 Reverse -349 -368 -3.44213 0.289
NP_440555.1_1 Reverse -116 -135 1.17943 0.294
NP_441653.1_2 Forward -147 -128 5.94546 0.235
NP_442603.1_7 Forward -136 -122 9.43874 0.146
NP_441888.1_7 Forward -223 -209 8.75105 0.178
NP_441888.1_7 Forward -141 -127 2.5562 0.225
NP_441948.1_4 Forward -143 -125 3.65739 0.108
NP_441948.1_4 Reverse -120 -138 -0.570838 0.139
NP_441047.1_2 Reverse -155 -174 8.35759 0.159
NP_441779.1_3 Forward -37 -18 11.1109 0.228
NP_441833.1_4 Forward -135 -128 15.9687 0.0124
NP_441833.1_4 Reverse -128 -135 15.9687 0.0124
NP_441833.1_4 Forward -288 -281 6.52896 0.0924
NP_441833.1_4 Reverse -281 -288 6.23397 0.163
NP_442162.1_9 Forward -135 -128 16.2637 0.0124
NP_442162.1_9 Reverse -128 -135 16.2637 0.0124
NP_442162.1_9 Reverse -281 -288 6.62729 0.142
NP_442162.1_9 Forward -288 -281 6.52896 0.178
NP_440671.1_4 Reverse -189 -203 6.09611 0.261
NP_440671.1_4 Forward -142 -128 5.30946 0.286
NP_442199.1_5 Forward -144 -125 -2.85214 0.196
NP_442140.1_3 Reverse -128 -138 14.238 0.0486
NP_442140.1_3 Forward -135 -125 12.2714 0.0632
NP_442140.1_3 Forward -217 -207 3.91327 0.271
NP_440875.1_9 Forward -287 -277 17.5217 0.0116
NP_440875.1_9 Reverse -129 -139 16.6457 0.0145
NP_440875.1_9 Reverse -282 -292 11.1948 0.179
NP_440875.1_9 Reverse -79 -89 9.83208 0.233
NP_440875.1_9 Forward -207 -197 7.69067 0.255
NP_441813.1_5 Forward -138 -128 19.4496 0.00647
NP_441813.1_5 Reverse -125 -135 8.63316 0.0367
NP_440590.1_4 Reverse -128 -141 11.9173 0.0173
NP_440590.1_4 Forward -135 -122 9.85238 0.0331
NP_440590.1_4 Reverse -281 -294 -4.01229 0.257
NP_440567.1_1 Forward -288 -274 12.6843 0.022
NP_442497.1_10 Forward -135 -126 10.4228 0.0087
NP_442497.1_10 Reverse -128 -137 10.4228 0.0087
NP_442497.1_10 Forward -288 -279 7.76787 0.0731
NP_442497.1_10 Reverse -281 -290 5.99792 0.095
NP_440821.1_4 Forward -138 -128 10.2065 0.0163
NP_440821.1_4 Reverse -125 -135 9.41981 0.0286
NP_440821.1_4 Reverse -278 -288 1.06167 0.142
NP_440821.1_4 Forward -291 -281 0.373358 0.18
NP_441239.1_9 Forward -138 -126 14.1986 0.0288
NP_441239.1_9 Forward -220 -208 10.0687 0.0888
NP_441239.1_9 Reverse -125 -137 5.93884 0.202
NP_441239.1_9 Forward -291 -279 5.54551 0.217
NP_440706.1_1 Reverse -123 -142 -5.40875 0.269
NP_441892.1_1 Forward -200 -183 -3.5994 0.244
NP_440665.1_1 Forward -175 -156 -10.227 0.244
NP_442193.1_1 Reverse -265 -283 9.45892 0.245
NP_442193.1_1 Forward -274 -256 9.36059 0.245
NP_442270.1_9 Forward -31 -12 -6.78538 0.209
NP_442270.1_9 Forward -107 -88 -7.37537 0.213
NP_442270.1_9 Reverse -116 -135 -9.24366 0.228
NP_441508.1_4 Forward -130 -116 13.285 0.297
NP_442138.1_10 Reverse -14 -33 -8.06369 0.296
NP_442809.1_7 Reverse -299 -318 19.7631 0.205
NP_440546.1_4 Reverse -127 -137 11.8882 0.0679
NP_440546.1_4 Reverse -66 -76 10.9186 0.101
NP_440546.1_4 Forward -136 -126 10.046 0.109
NP_440546.1_4 Forward -86 -76 8.78555 0.171
NP_441230.1_5 Forward -141 -122 -0.0988766 0.277
NP_440462.1_6 Forward -138 -128 17.2863 0.00752
NP_440462.1_6 Reverse -278 -288 16.2046 0.0132
NP_440462.1_6 Reverse -125 -135 1.35667 0.294
NP_440462.1_6 Forward -291 -281 1.16001 0.298
NP_442611.1_1 Reverse -195 -214 -2.16383 0.284
NP_442611.1_3 Forward -208 -190 13.3922 0.238
NP_440868.1_4 Forward -140 -128 10.3637 0.0388
NP_440868.1_4 Reverse -123 -135 8.10212 0.0602
NP_440868.1_4 Reverse -276 -288 6.92215 0.0822
NP_442402.1_4 Reverse -63 -82 -8.85106 0.284
NP_442882.1_8 Reverse -102 -121 9.93088 0.194
NP_442039.1_4 Forward -135 -128 15.1821 0.0124
NP_442039.1_4 Reverse -128 -135 15.1821 0.0124
NP_441811.1_8 Reverse -121 -135 12.0943 0.209
NP_441811.1_8 Forward -102 -88 7.27608 0.251
NP_440825.1_7 Forward -135 -125 12.9096 0.152
NP_442696.1_6 Reverse -223 -242 -13.8652 0.291
NP_442837.1_3 Forward -135 -128 15.7721 0.0124
NP_442837.1_3 Reverse -128 -135 15.7721 0.0124
NP_442837.1_3 Forward -288 -281 12.1338 0.0702
NP_442837.1_3 Reverse -281 -288 6.0373 0.25
NP_440160.1_2 Forward -117 -98 -0.000545616 0.228
NP_442053.1_1 Forward -136 -127 18.3876 0.0007
NP_442053.1_1 Reverse -127 -136 18.3876 0.0007
NP_442053.1_1 Forward -289 -280 6.78456 0.115
NP_440505.1_3 Forward -138 -128 15.9097 0.00857
NP_440505.1_3 Reverse -125 -135 9.22315 0.122
NP_440505.1_3 Reverse -278 -288 6.56821 0.176
NP_440505.1_3 Forward -88 -78 4.50326 0.284
NP_440505.1_7 Reverse -103 -122 -1.86883 0.284
NP_441701.1_3 Forward -245 -228 20.4917 0.0662
NP_441203.1_1 Forward -288 -269 -14.8485 0.205
NP_440914.1_1 Forward -136 -126 17.5935 0.000537
NP_440914.1_1 Reverse -127 -137 8.6151 0.186
NP_441011.1_8 Reverse -128 -137 16.9127 0.00602
NP_441011.1_8 Forward -135 -126 8.25953 0.144
NP_441011.1_8 Forward -288 -279 6.78456 0.184
NP_442101.1_10 Forward -283 -264 -11.0136 0.261
NP_442533.1_1 Forward -364 -345 -8.26035 0.202
NP_442533.1_1 Forward -245 -226 -8.752 0.211
NP_442533.1_1 Forward -253 -234 -14.4552 0.243
NP_442533.1_1 Forward -254 -235 -15.7335 0.257
NP_442533.1_6 Forward -136 -127 17.2076 0.00137
NP_442533.1_6 Reverse -127 -136 17.2076 0.00137
NP_442533.1_6 Reverse -352 -361 5.60459 0.137
NP_442533.1_6 Reverse -66 -75 4.62128 0.179
NP_442533.1_6 Reverse -233 -242 4.52295 0.179
NP_442533.1_6 Reverse -77 -86 4.12963 0.191
NP_442533.1_6 Forward -361 -352 3.7363 0.204
NP_442533.1_6 Forward -20 -11 2.75299 0.241
NP_442322.1_4 Reverse -225 -242 9.18288 0.141
NP_442322.1_4 Reverse -224 -241 -5.37003 0.266
NP_442229.1_1 Reverse -125 -139 8.3571 0.184
NP_441482.1_7 Forward -142 -128 -10.2268 0.209
NP_441482.1_7 Reverse -121 -135 -10.7185 0.213
NP_439944.1_9 Forward -135 -125 10.5014 0.0887
NP_439944.1_9 Forward -288 -278 7.94484 0.123
NP_439944.1_9 Reverse -281 -291 6.17489 0.192
NP_441028.1_6 Forward -174 -164 17.4824 0.132
NP_441028.1_6 Reverse -246 -256 5.78111 0.243
NP_441028.1_6 Reverse -270 -280 3.51951 0.292
NP_442202.1_10 Forward -116 -102 3.24451 0.278
NP_440116.1_8 Forward -135 -116 18.879 0.00742
NP_440115.1_6 Reverse -277 -287 16.9913 0.0288
NP_440007.1_9 Reverse -191 -205 3.8345 0.267
NP_440608.1_6 Forward -135 -116 3.53858 0.29
NP_441602.1_3 Reverse -101 -120 5.80098 0.141
NP_441106.1_1 Forward -137 -128 18.191 0.0028
NP_441106.1_1 Reverse -126 -135 9.63616 0.0311
NP_441106.1_1 Reverse -279 -288 8.75118 0.0469
NP_439903.1_6 Reverse -179 -198 3.24359 0.211
NP_442306.1_10 Reverse -122 -141 -20.3551 0.208
NP_441286.1_1 Reverse -126 -138 6.03717 0.0258
NP_441286.1_1 Forward -137 -125 3.38223 0.0467
NP_441286.1_1 Forward -290 -278 -5.86088 0.229
NP_442674.1_3 Reverse -239 -258 3.83357 0.294
NP_440670.1_8 Forward -136 -127 18.3876 0.000699
NP_440670.1_8 Reverse -127 -136 18.3876 0.000699
NP_440670.1_8 Reverse -280 -289 7.47288 0.0773
NP_440670.1_8 Forward -289 -280 5.89959 0.131
NP_441930.1_2 Forward -192 -182 12.8614 0.248
NP_440886.1_7 Forward -137 -127 17.7774 0.0011
NP_440886.1_7 Reverse -126 -136 7.94438 0.0805
NP_440886.1_7 Reverse -351 -361 6.17443 0.141
NP_442614.1_2 Forward -136 -122 8.16106 0.255
NP_442614.1_2 Reverse -37 -51 7.27608 0.275
NP_442614.1_2 Reverse -167 -181 6.6861 0.287
NP_442614.1_2 Reverse -320 -334 6.19444 0.291
NP_442382.1_3 Forward -263 -244 12.8808 0.0513
NP_442382.1_9 Reverse -83 -102 17.2065 0.239
NP_442072.1_9 Reverse -279 -297 -12.4689 0.0852
NP_442072.1_9 Reverse -126 -144 -13.6489 0.118
NP_442072.1_9 Reverse -351 -369 -22.892 0.266
NP_442773.2_1 Reverse -60 -79 13.4708 0.248
NP_440907.2_8 Reverse -281 -291 14.0409 0.0342
NP_440907.2_8 Forward -288 -278 9.71433 0.103
NP_440907.2_8 Reverse -128 -138 7.94438 0.117
NP_440907.2_8 Forward -135 -125 7.64939 0.117
NP_441021.1_1 Reverse -281 -300 -8.06369 0.193
NP_442459.1_8 Forward -196 -177 16.8141 0.089
NP_442842.1_9 Reverse -150 -169 10.8159 0.21
NP_441626.1_2 Forward -135 -128 15.7721 0.0124
NP_441626.1_2 Reverse -128 -135 15.7721 0.0124
NP_441626.1_2 Reverse -281 -288 6.13563 0.177
NP_441626.1_2 Forward -288 -281 5.93897 0.231
NP_442794.1_1 Reverse -123 -135 9.28209 0.0795
NP_442794.1_1 Forward -167 -155 2.89058 0.286
NP_442615.1_1 Forward -145 -127 3.85406 0.0512
NP_442615.1_1 Reverse -118 -136 2.96908 0.0595
NP_442615.1_1 Reverse -271 -289 -5.09406 0.204
NP_441962.1_4 Forward -360 -341 -6.09707 0.175
NP_440387.1_1 Forward -136 -120 11.8583 0.0149
NP_441431.1_2 Forward -139 -125 17.6002 0.0263
NP_441431.1_2 Forward -89 -75 5.70218 0.291
NP_441836.1_2 Forward -81 -62 -3.14714 0.234
NP_441174.1_2 Reverse -277 -291 12.1926 0.261
NP_442352.1_1 Forward -175 -162 13.9033 0.281
NP_440114.1_10 Reverse -127 -141 16.0275 0.0207
NP_442323.1_7 Reverse -260 -279 8.06178 0.163
NP_442323.1_7 Reverse -190 -209 2.35861 0.266
NP_442087.1_2 Forward -136 -117 17.5684 0.117
NP_440293.1_3 Forward -268 -249 -3.93378 0.256
NP_440766.1_4 Forward -293 -279 6.19444 0.104
NP_439988.1_3 Forward -240 -226 3.44117 0.299
NP_441237.1_9 Forward -135 -125 14.828 0.0242
NP_442743.1_4 Reverse -128 -147 -2.65548 0.21
NP_441311.1_2 Reverse -274 -288 11.7003 0.243
NP_439910.1_2 Forward -297 -280 -13.0392 0.127
NP_439910.1_2 Forward -144 -127 -13.5308 0.162
NP_440457.1_1 Forward -90 -78 4.75886 0.154
NP_440457.1_1 Forward -140 -128 -0.649339 0.271
NP_440457.1_1 Reverse -276 -288 -0.649339 0.271
NP_440457.1_1 Forward -240 -228 -0.74767 0.273
NP_440798.1_6 Reverse -128 -141 5.13249 0.14
NP_440798.1_6 Forward -288 -275 0.0192843 0.294
NP_440801.1_8 Forward -137 -118 4.42435 0.2
NP_441332.1_6 Reverse -189 -199 10.6786 0.294
NP_441332.1_6 Forward -41 -31 10.6786 0.294
NP_442509.1_9 Reverse -127 -137 16.2041 0.00739
NP_442509.1_9 Forward -96 -86 12.2709 0.0995
NP_442509.1_9 Forward -115 -105 9.321 0.192
NP_442509.1_9 Forward -136 -126 8.14104 0.192
NP_441253.1_1 Forward -278 -259 7.96426 0.205
NP_440554.1_4 Reverse -128 -138 16.4996 0.0189
NP_440554.1_4 Reverse -281 -291 6.96153 0.107
NP_440554.1_4 Reverse -210 -220 6.46988 0.123
NP_440554.1_4 Forward -288 -278 5.78156 0.132
NP_441845.1_6 Reverse -115 -133 -1.16082 0.285
NP_441885.1_5 Forward -136 -126 20.9245 0.000538
NP_441885.1_5 Reverse -127 -137 11.4848 0.00668
NP_440478.1_10 Forward -138 -124 6.6861 0.288
NP_441428.1_8 Forward -25 -6 3.14605 0.251
NP_442341.1_7 Forward -137 -123 13.6676 0.0334
NP_442341.1_7 Reverse -126 -140 3.14618 0.234
NP_442341.1_9 Forward -138 -124 10.5204 0.133
NP_441756.1_3 Reverse -84 -103 16.9124 0.141
NP_441756.1_5 Forward -120 -101 -1.37718 0.255
NP_441173.1_9 Forward -173 -165 10.1471 0.261
NP_443000.1_7 Forward -138 -128 11.5831 0.0344
NP_443000.1_7 Reverse -125 -135 10.3048 0.0345
NP_443000.1_7 Reverse -278 -288 1.06167 0.274
NP_441842.1_10 Reverse -273 -287 8.75105 0.211
NP_440275.1_3 Forward -138 -128 15.418 0.0178
NP_440275.1_3 Forward -291 -281 9.12481 0.055
NP_440275.1_3 Reverse -278 -288 9.12481 0.055
NP_440275.1_3 Reverse -125 -135 8.04317 0.0602
NP_440091.1_1 Forward -140 -128 10.7571 0.0429
NP_440091.1_1 Reverse -10 -22 3.38223 0.163
NP_442451.1_2 Forward -144 -125 -10.227 0.265
NP_440149.1_8 Forward -136 -117 -0.590531 0.151
NP_441105.1_3 Forward -147 -128 -3.83545 0.185
NP_442373.1_2 Forward -243 -224 -10.1286 0.272
NP_440216.1_1 Reverse -127 -141 25.959 0.000481
NP_440216.1_1 Forward -136 -122 -10.5218 0.145
NP_440216.1_1 Forward -289 -275 -12.0951 0.24
NP_440172.1_1 Forward -136 -126 15.0247 0.00945
NP_440172.1_1 Reverse -127 -137 8.73149 0.0586
NP_440172.1_1 Forward -191 -181 8.4365 0.0621
NP_440172.1_1 Forward -218 -208 2.7333 0.268
NP_442662.1_7 Forward -267 -248 23.5006 0.0215
NP_442015.1_10 Reverse -83 -96 3.85419 0.178
NP_442015.1_10 Forward -140 -127 3.16588 0.185
NP_442015.1_10 Reverse -123 -136 1.39592 0.204
NP_441226.1_7 Forward -135 -128 14.4934 0.0123
NP_441226.1_7 Reverse -128 -135 14.4934 0.0123
NP_441226.1_7 Reverse -78 -85 8.29857 0.205
NP_441485.1_2 Reverse -106 -125 12.5858 0.274
NP_441757.1_3 Forward -227 -208 -0.885524 0.245
NP_441111.1_7 Forward -135 -127 18.7023 0.00294
NP_441111.1_7 Reverse -128 -136 18.7023 0.00294
NP_441111.1_7 Forward -288 -280 8.86921 0.0589
NP_440244.1_1 Reverse -166 -185 -0.39387 0.187
NP_441766.1_2 Forward -136 -127 17.5026 0.00297
NP_441766.1_2 Reverse -127 -136 17.5026 0.00297
NP_441766.1_2 Forward -289 -280 6.48957 0.096
NP_440416.1_9 Forward -44 -25 -16.6185 0.218
NP_443052.1_9 Forward -171 -152 -7.37537 0.297
NP_440072.1_5 Forward -249 -231 -4.11075 0.292
NP_442154.1_1 Forward -363 -345 -14.1405 0.217
NP_440261.1_5 Forward -288 -275 7.88576 0.0316
NP_440261.1_5 Forward -135 -122 -2.73398 0.0924
NP_440261.1_5 Reverse -128 -141 -2.73398 0.0924
NP_440261.1_5 Forward -217 -204 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGACTGCACTCTGTCCGGTTCATAGACCAAAAAACTGAAGGTGGTGGCCCTAGTAGCGATTAAACCCTCCTCCTTTTGGGCACTGGTTTGCCAAATTTGGGCTAATTCAGATTCGATCGCCTCGAGGGAAACGTCCTTGGGGGCTTGGAGGGAAACGAGGGGAGGGGCTTGGGTGGTACTCATGCAATGGCTCCAATGGAATCGGACTGGGCAATGACGCTGATACTTTCCCCCCATGGTAGTGGCAGATTCTAAATTACAACCGGCGATCGCCAAAAATCCGGGGCCAAACCCCGCCAGTGTTGATAATCCCCGGGGATGGGTAAACCATGGCCTAGAATAATTGTCAGTAAGTGTCGCCCCCGTAATCCGTCAACAGTGACCGTCACCCCATTTTAGG

CDS

ATGCAGAAATTTTTCCAGCGTATTTGGCAGTGGATCCAACAACTTTTTGCCCCCCTGGTGGGCGGCCCAGGGCCGGGGACTAAATCTCTCCAGGAACTGCCCCCCCTGAGCGACACTGACTATGAGTTTTTGTTTAATCAACTGCTGGAAGGCATTGCCCACGGTTGGCACGAAGGGCGTATTCTCAAATTTTTTCAACAGTTAGACCACCGCTGTCGGCCTAAGCAATGGCTTGATTGGTTAGACCGTTTTCAAACTACGGTGCTAGCTTCCCCTTCTCCCAATTTAGTTCTAGCCGCCCGGATGATGCGTTTGGGGGAATTGGCCCAATCCTTTCCCCAGATTGCTCCCATTGGCGATAAATCCCAGCGCATTGGCAGGGAGCTGTATGCCCGGCAGTCACCGCCCCAGATGGATACGGTGTGGGAATATGATGGCCCCGATCTAGTTTCCATAGACCAGGCCCAAGGGCAAATGGAAACCTTCACCTTTGATGAATTGGTGCAACGGTTACCCCAGGATGCCGCTTTGGCAACCCATTTTGCTGGCTTTTTGGGCATTGAAAGCACCGATCCCCAGGTGATTTTGCGGGCATTGATGGAAAAATTCGCCATTCCAGAGGAAATGTTAACTGAAGCCTTGAACCATGGGGGTGAATCGAGCTCGGCTCCGGTGGATAGTTTAGTCGAAGATCAGGGGACTGCGTCCGCTCTGGCACAAGAAGAGTTGTGGCCTCTTGTTGACCCGGTTACCATCGACAACTCCCAATTTGAAAATAACCAAGAACCCCATACTGCCGAAGATTGGTTAAACCTTGGCATACAGCAGGCCCAGAGAGGAGAACTGGAAACGGCGATCGCCAGTTGGGGGGAGGCGATCAGTTTAAATCCCCAGATGACTTCCGCCTGGCAAAATCGGGGTAGTGCGTTGGGAGTTATGGGTAAGTTAGAAGAGGCCTTGGCTAATTTTGATGAAGCTTTAGCACAAAATCCCGACGATGCTGAGGTTTGGTTAAGCCGGGGTTTACTGCTCGAAGCTATGGAGCGCAAAGAAGAGGCTATTCCCAGCTATGAAAAGGCTTTAACTTTAGAACCTACCCTACCGGAAGCCCAGGAAAGATTAGAAGAGTTGCAAGGCCTACTGTCCCAGGATTAA

Protein

MQKFFQRIWQWIQQLFAPLVGGPGPGTKSLQELPPLSDTDYEFLFNQLLEGIAHGWHEGRILKFFQQLDHRCRPKQWLDWLDRFQTTVLASPSPNLVLAARMMRLGELAQSFPQIAPIGDKSQRIGRELYARQSPPQMDTVWEYDGPDLVSIDQAQGQMETFTFDELVQRLPQDAALATHFAGFLGIESTDPQVILRALMEKFAIPEEMLTEALNHGGESSSAPVDSLVEDQGTASALAQEELWPLVDPVTIDNSQFENNQEPHTAEDWLNLGIQQAQRGELETAIASWGEAISLNPQMTSAWQNRGSALGVMGKLEEALANFDEALAQNPDDAEVWLSRGLLLEAMERKEEAIPSYEKALTLEPTLPEAQERLEELQGLLSQD