Your browser is old and dusty. Try Google Chrome!

Details for sll1623

ORF sll1623
Accession NP_441093.1
Symbol
Category ABC transporter ATP-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -161 -175 -0.295402 0.227
NP_440557.1_1 Reverse -62 -81 -2.65548 0.297
NP_441453.1_7 Reverse -290 -297 11.9372 0.298
NP_441623.1_6 Reverse -177 -196 21.7306 0.0301
NP_441818.1_9 Forward -214 -195 -9.14533 0.287
NP_440996.1_3 Forward -176 -158 8.7706 0.294
NP_442752.1_4 Reverse -260 -267 12.1338 0.0546
NP_443027.1_4 Reverse -158 -168 7.55152 0.24
NP_443027.1_4 Forward -171 -161 6.66654 0.274
NP_440061.1_9 Forward -65 -51 5.01387 0.298
NP_441054.1_2 Forward -168 -149 9.14423 0.299
NP_440631.1_8 Forward -358 -339 18.1907 0.286
NP_442062.1_8 Forward -70 -60 2.83163 0.293
NP_440304.1_4 Forward -78 -68 4.40493 0.266
NP_440908.1_5 Forward -61 -44 13.4119 0.161
NP_441492.1_5 Forward -158 -139 2.29255 0.3
NP_440011.1_1 Forward -210 -191 17.6007 0.153
NP_441210.1_3 Reverse -251 -270 14.9458 0.255
NP_442196.1_10 Reverse -4 -23 12.7825 0.21
NP_441082.1_10 Reverse -112 -125 11.229 0.236
NP_442367.1_3 Forward -326 -307 8.75091 0.196
NP_442726.1_1 Reverse -103 -122 18.4857 0.0708
NP_441925.1_4 Reverse -192 -211 -16.8158 0.285
NP_440856.1_7 Forward -226 -207 -5.01543 0.224
NP_441558.1_5 Reverse -52 -71 11.2092 0.0852
NP_442889.1_8 Forward -313 -299 2.94893 0.295
NP_440447.1_6 Forward -51 -33 1.39578 0.266
NP_442570.1_3 Reverse -65 -84 -9.34199 0.298
NP_439953.1_2 Forward -389 -371 15.6538 0.183
NP_442111.1_4 Forward -64 -50 7.27608 0.101
NP_440343.1_3 Forward -69 -51 4.34495 0.266
NP_440747.1_10 Forward -320 -308 -11.8591 0.161
NP_441014.1_8 Reverse -195 -214 -8.26035 0.283
NP_441014.1_10 Forward -170 -151 -1.57461 0.262
NP_442848.1_5 Forward -95 -77 -3.81576 0.299
NP_441012.1_4 Forward -115 -102 5.91914 0.286
NP_443018.1_3 Forward -168 -161 12.5271 0.0523
NP_443018.1_3 Reverse -161 -168 12.5271 0.0523
NP_443018.1_3 Forward -62 -55 8.20058 0.153
NP_441634.1_8 Reverse -158 -172 9.83269 0.0959
NP_440376.1_1 Reverse -308 -317 3.04799 0.21
NP_440376.1_1 Reverse -54 -63 2.65466 0.216
NP_441588.1_4 Forward -308 -298 12.0747 0.14
NP_441588.1_4 Reverse -56 -66 7.45319 0.178
NP_442530.1_2 Forward -164 -154 12.9597 0.263
NP_441013.1_3 Reverse -67 -86 10.0292 0.219
NP_441763.1_10 Forward -321 -302 12.9783 0.125
NP_442658.1_1 Forward -84 -74 8.3377 0.199
NP_440141.1_8 Reverse -45 -64 9.43923 0.219
NP_441414.1_9 Forward -169 -150 -2.0655 0.11
NP_441487.1_6 Reverse -128 -147 1.27776 0.254
NP_441487.1_9 Forward -115 -96 -0.590531 0.259
NP_442300.1_10 Reverse -308 -327 9.43923 0.294
NP_441958.1_5 Reverse -53 -63 -1.29827 0.236
NP_440153.1_5 Reverse -302 -316 1.76955 0.245
NP_443055.1_6 Forward -125 -107 7.98318 0.15
NP_440827.1_3 Forward -93 -74 13.6675 0.222
NP_441099.1_10 Reverse -147 -157 15.9091 0.254
NP_440147.1_4 Forward -65 -52 -0.37404 0.282
NP_441175.1_7 Reverse -166 -185 6.4893 0.257
NP_441916.1_10 Forward -203 -184 4.12936 0.223
NP_441041.1_4 Reverse -61 -80 -10.3253 0.231
NP_442396.1_5 Reverse -182 -195 7.98409 0.169
NP_440703.1_2 Reverse -180 -199 14.7157 0.265
NP_440703.1_9 Forward -126 -113 13.3917 0.192
NP_439966.1_7 Forward -319 -309 6.0761 0.195
NP_440736.1_3 Forward -72 -53 1.76941 0.282
NP_441678.1_9 Reverse -96 -115 -3.44213 0.288
NP_442281.1_1 Forward -68 -54 8.94708 0.0747
NP_442281.1_1 Reverse -56 -70 2.94893 0.249
NP_442012.1_6 Forward -97 -78 18.4857 0.132
NP_442982.1_5 Forward -86 -67 2.75272 0.215
NP_442068.1_4 Reverse -341 -360 5.89851 0.245
NP_441644.1_6 Forward -63 -53 4.01116 0.253
NP_442215.1_2 Forward -72 -56 -3.48138 0.216
NP_442215.1_2 Reverse -348 -364 -7.31629 0.291
NP_440576.1_5 Reverse -165 -184 12.8808 0.175
NP_442554.1_8 Reverse -161 -171 12.5664 0.0248
NP_442554.1_8 Forward -168 -158 10.4031 0.0466
NP_442554.1_8 Reverse -55 -65 2.04498 0.285
NP_442313.1_3 Reverse -290 -309 6.19431 0.28
NP_442313.1_5 Reverse -103 -122 5.40766 0.256
NP_442142.1_4 Forward -120 -107 8.86849 0.106
NP_442292.1_1 Forward -168 -159 5.21127 0.152
NP_442292.1_1 Reverse -161 -170 5.21127 0.152
NP_440183.1_9 Reverse -311 -330 -19.4701 0.279
NP_441468.1_1 Reverse -161 -168 3.97235 0.277
NP_441468.1_1 Forward -168 -161 3.97235 0.277
NP_442719.1_2 Reverse -179 -197 -5.88141 0.224
NP_442361.1_8 Reverse -345 -363 12.5072 0.282
NP_442808.1_1 Forward -118 -108 4.50281 0.197
NP_442808.1_1 Reverse -199 -209 3.02785 0.25
NP_441114.1_3 Forward -68 -59 17.1093 0.113
NP_440558.1_2 Forward -326 -307 -3.73712 0.238
NP_440558.1_5 Reverse -74 -88 13.8643 0.289
NP_441878.1_6 Reverse -60 -70 2.33998 0.0405
NP_441878.1_6 Reverse -53 -63 1.65166 0.0795
NP_441878.1_6 Forward -383 -373 -7.59145 0.245
NP_441520.1_8 Reverse -93 -112 9.24257 0.285
NP_441574.1_1 Forward -395 -376 -5.31042 0.26
NP_440276.1_8 Reverse -70 -89 6.68596 0.277
NP_440058.1_6 Reverse -82 -101 4.32602 0.291
NP_441549.1_9 Forward -204 -186 -4.99573 0.198
NP_442347.1_2 Forward -268 -259 4.32629 0.284
NP_442645.1_2 Forward -325 -306 -12.1936 0.144
NP_442645.1_2 Forward -78 -59 -20.945 0.289
NP_441799.1_1 Forward -321 -307 3.63724 0.289
NP_441007.1_10 Forward -174 -161 7.98409 0.124
NP_441007.1_10 Forward -391 -378 -0.669033 0.287
NP_440256.1_1 Reverse -64 -83 -9.44032 0.28
NP_441090.1_6 Reverse -54 -68 13.7659 0.125
NP_442007.1_8 Forward -332 -314 12.2114 0.258
NP_440915.1_6 Reverse -50 -64 1.67122 0.132
NP_441464.1_1 Forward -321 -302 9.0459 0.246
NP_441464.1_10 Reverse -306 -320 8.84938 0.267
NP_441464.1_10 Reverse -363 -377 8.06273 0.287
NP_442993.1_1 Reverse -61 -77 -12.3312 0.27
NP_440677.1_6 Forward -269 -250 7.96426 0.277
NP_442386.1_9 Forward -170 -161 9.04574 0.175
NP_442386.1_9 Reverse -159 -168 9.04574 0.175
NP_442386.1_10 Reverse -308 -321 6.01747 0.262
NP_441750.1_7 Forward -203 -193 12.6647 0.295
NP_441340.1_5 Reverse -161 -168 4.07068 0.239
NP_441340.1_5 Forward -168 -161 4.07068 0.239
NP_440211.1_2 Reverse -72 -91 19.5664 0.194
NP_440586.1_8 Forward -62 -55 9.08521 0.178
NP_440586.1_8 Forward -168 -161 7.61025 0.227
NP_440586.1_8 Reverse -161 -168 7.61025 0.227
NP_440027.1_3 Forward -327 -309 2.18168 0.292
NP_440836.1_3 Reverse -306 -325 14.9458 0.182
NP_440439.1_1 Forward -320 -307 5.42749 0.0901
NP_441181.1_6 Forward -394 -376 5.91901 0.22
NP_442262.1_10 Forward -168 -161 10.4622 0.145
NP_442262.1_10 Reverse -161 -168 10.4622 0.145
NP_442262.1_10 Forward -62 -55 9.38056 0.202
NP_440163.1_10 Forward -206 -196 8.04317 0.292
NP_440282.1_3 Forward -93 -74 -2.16383 0.298
NP_441060.1_7 Reverse -312 -331 8.94757 0.244
NP_440189.1_2 Forward -325 -306 -0.688862 0.292
NP_440189.1_10 Forward -369 -350 3.83436 0.279
NP_442693.1_6 Reverse -199 -218 6.19431 0.278
NP_440297.1_9 Forward -168 -158 9.61647 0.0917
NP_440297.1_9 Reverse -161 -171 0.0783647 0.282
NP_441592.1_4 Forward -202 -183 0.786102 0.227
NP_443036.1_3 Forward -387 -370 16.9518 0.188
NP_440834.1_6 Reverse -302 -321 11.1109 0.206
NP_440999.1_1 Reverse -197 -216 18.8781 0.0285
NP_440999.1_1 Forward -377 -358 8.25844 0.156
NP_440888.1_2 Reverse -67 -81 9.24208 0.134
NP_442454.1_2 Reverse -263 -282 8.54611 0.291
NP_440575.1_8 Reverse -150 -169 -4.32711 0.265
NP_442845.1_2 Forward -175 -161 4.91614 0.249
NP_442578.1_7 Forward -385 -378 9.97054 0.112
NP_440220.1_4 Reverse -147 -166 -2.55791 0.279
NP_441462.1_2 Reverse -308 -318 -0.904945 0.265
NP_443062.1_1 Forward -169 -151 5.81572 0.218
NP_442428.1_5 Forward -168 -161 4.36568 0.271
NP_442428.1_5 Reverse -161 -168 4.36568 0.271
NP_442120.1_10 Reverse -61 -80 0.491109 0.157
NP_442120.1_10 Forward -82 -63 -13.4719 0.285
NP_440673.1_3 Forward -68 -61 8.98723 0.203
NP_441884.1_8 Reverse -106 -125 -7.57203 0.254
NP_440041.1_2 Reverse -100 -119 -3.3438 0.283
NP_440296.1_10 Reverse -310 -329 -14.8485 0.276
NP_442694.1_4 Reverse -108 -117 10.8161 0.294
NP_442694.1_9 Forward -158 -139 11.2092 0.228
NP_443054.1_2 Forward -319 -305 7.07942 0.169
NP_443054.1_2 Forward -72 -58 -0.590395 0.299
NP_441851.1_10 Reverse -259 -269 9.12481 0.114
NP_440495.1_2 Forward -169 -150 3.44104 0.284
NP_442011.1_4 Reverse -308 -326 14.8671 0.161
NP_440593.1_3 Forward -68 -49 -6.78538 0.28
NP_440155.1_9 Reverse -95 -114 9.14423 0.219
NP_442843.1_1 Reverse -109 -128 -11.4069 0.291
NP_440431.1_3 Reverse -153 -172 -8.06369 0.224
NP_440588.1_2 Reverse -184 -203 -5.31042 0.247
NP_442006.1_2 Reverse -52 -69 -17.9557 0.285
NP_441078.1_4 Reverse -61 -70 -1.57357 0.266
NP_442348.1_2 Reverse -107 -116 9.14451 0.28
NP_440526.1_3 Reverse -161 -172 8.71129 0.116
NP_442274.1_6 Reverse -42 -61 15.0441 0.167
NP_440578.1_4 Reverse -254 -273 9.83255 0.278
NP_441945.1_6 Reverse -237 -256 8.55425 0.287
NP_443011.1_5 Reverse -311 -330 11.4058 0.281
NP_442489.1_7 Reverse -54 -63 5.3096 0.0708
NP_442489.1_7 Forward -70 -61 4.91628 0.0892
NP_442489.1_7 Reverse -61 -70 -1.57357 0.213
NP_442489.1_7 Reverse -308 -317 -1.6719 0.235
NP_441659.2_8 Forward -63 -53 4.60159 0.13
NP_442346.1_5 Reverse -60 -70 5.28991 0.253
NP_440459.1_2 Reverse -52 -69 11.8386 0.166
NP_441653.1_6 Forward -212 -198 18.8791 0.289
NP_442551.1_4 Reverse -371 -386 1.2582 0.245
NP_442140.1_3 Reverse -161 -171 9.7148 0.103
NP_440590.1_4 Reverse -55 -68 -0.570702 0.192
NP_441239.1_9 Forward -171 -159 3.08724 0.296
NP_441239.1_9 Forward -319 -307 2.98891 0.3
NP_442193.1_8 Reverse -133 -152 11.3067 0.267
NP_442216.1_4 Reverse -277 -285 8.08217 0.255
NP_442138.1_5 Forward -84 -65 12.1925 0.276
NP_440675.1_10 Reverse -109 -128 11.9958 0.256
NP_442499.1_1 Forward -168 -149 2.85105 0.279
NP_441848.1_6 Reverse -281 -300 16.6165 0.212
NP_441848.1_7 Reverse -150 -169 -4.22953 0.288
NP_440696.1_3 Reverse -314 -332 -4.20908 0.298
NP_442039.1_4 Reverse -309 -316 8.69224 0.172
NP_440753.1_8 Reverse -97 -116 19.174 0.188
NP_442380.1_5 Forward -148 -129 18.2453 0.142
NP_441926.1_3 Reverse -61 -77 3.89344 0.206
NP_442053.1_1 Forward -317 -308 5.80125 0.164
NP_440351.1_8 Reverse -98 -116 5.42735 0.271
NP_440914.1_1 Forward -76 -66 8.90788 0.186
NP_440914.1_1 Forward -82 -72 7.83437 0.219
NP_442533.1_1 Forward -211 -192 -14.2585 0.241
NP_442533.1_6 Forward -63 -54 4.81794 0.172
NP_442533.1_6 Forward -317 -308 3.04799 0.228
NP_442322.1_4 Forward -120 -103 -8.71327 0.286
NP_440854.1_5 Forward -148 -134 14.8129 0.274
NP_441482.1_7 Forward -323 -309 -4.62196 0.153
NP_439944.1_9 Reverse -161 -171 4.79825 0.296
NP_441680.1_4 Forward -332 -313 0.687771 0.246
NP_441961.1_2 Reverse -174 -193 6.19431 0.27
NP_440608.1_1 Forward -89 -70 5.81766 0.268
NP_442455.1_6 Forward -248 -229 21.1203 0.162
NP_439903.1_6 Reverse -151 -170 3.63691 0.207
NP_439903.1_6 Reverse -64 -83 3.04693 0.213
NP_442306.1_10 Forward -387 -368 -11.5053 0.133
NP_442306.1_10 Reverse -369 -388 -21.535 0.277
NP_441286.1_1 Forward -64 -52 -4.87757 0.18
NP_440670.1_8 Reverse -308 -317 5.3096 0.167
NP_442072.1_9 Reverse -60 -78 -12.6655 0.0877
NP_442072.1_9 Reverse -53 -71 -22.2037 0.225
NP_440907.2_8 Forward -62 -52 4.7978 0.243
NP_441021.1_1 Reverse -161 -180 5.60432 0.0704
NP_441021.1_1 Reverse -62 -81 -11.8986 0.275
NP_441463.1_3 Forward -393 -374 -7.57203 0.259
NP_442221.1_3 Reverse -74 -93 17.3057 0.281
NP_441962.1_4 Forward -174 -155 -10.0303 0.223
NP_441962.1_4 Reverse -155 -174 -12.1936 0.253
NP_441742.1_7 Reverse -370 -389 12.4875 0.29
NP_441742.1_7 Forward -386 -367 12.2908 0.294
NP_440387.1_1 Reverse -61 -77 -4.07137 0.174
NP_441488.1_8 Forward -20 -6 12.192 0.146
NP_441993.1_1 Reverse -295 -314 2.92126 0.246
NP_440293.1_3 Reverse -302 -321 -3.63879 0.251
NP_441237.1_9 Forward -69 -59 11.2881 0.189
NP_442867.1_8 Reverse -306 -325 7.37428 0.244
NP_440457.1_1 Reverse -50 -62 7.61046 0.101
NP_440987.1_4 Forward -257 -238 4.62101 0.239
NP_440798.1_2 Forward -65 -51 15.7319 0.235
NP_441801.1_4 Reverse -278 -288 3.02829 0.231
NP_442680.1_5 Forward -201 -182 1.14682 0.251
NP_440942.1_3 Reverse -75 -94 10.5209 0.138
NP_441332.1_6 Reverse -199 -209 12.034 0.236
NP_441332.1_6 Reverse -193 -203 11.8404 0.244
NP_441885.1_5 Reverse -54 -64 -0.904945 0.241
NP_442341.1_7 Reverse -53 -67 4.42448 0.191
NP_440750.1_6 Forward -156 -137 7.30471 0.296
NP_442354.1_8 Reverse -311 -330 6.68596 0.266
NP_441105.1_3 Reverse -56 -75 -5.80207 0.224
NP_440216.1_1 Forward -70 -56 -11.7018 0.212
NP_440216.1_1 Reverse -308 -322 -12.6851 0.296
NP_440216.1_9 Forward -167 -158 7.76787 0.286
NP_440216.1_9 Reverse -162 -171 7.76787 0.286
NP_440216.1_9 Forward -80 -71 6.78456 0.289
NP_440172.1_1 Forward -310 -300 2.04498 0.286
NP_440172.1_1 Reverse -61 -71 1.84832 0.294
NP_440416.1_9 Reverse -66 -85 -19.6667 0.276
NP_440416.1_9 Reverse -306 -325 -21.83 0.297
NP_440988.1_10 Reverse -158 -172 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTCGGCTTATTGATGCGGTCAATGTCCACATCCCACAATTGGTTGAGGCCGACAATGTACACATTACCCAACAGGCAGGCCAGCCAAGCGCCGAACACTAAATCCAGGGAAGCAGGGGAGTTAACTGAGTTTCCATCCCCGAGAATAGTTAACAGATACACAGCCCAGACGCTCAGAGTTGTACCAATGATGGTATGGGGGCGGGAGAAGCGCCAAAAAGCTTGGATAGTTGCCATGGCAATAATTTTGAGAAATGAAATCTCTTTGCAGTGTACCTAAACCCACCAAGGCCGGACCATTTTCCTGCCCTAATCCAGAGCAAAGGCAAAGTCCATTGCCCATCGACCCACATTTGGCTCGGTAACCTAGAATTGGAGAGCCTTATTCCATCACATTTCC

CDS

ATGTCCACCCCCGCCATCATTGCCCAGGACCTAAATTTTCAATGGTCTGCCGATCGCCCCGGTTTGCAAAACTGTAGTCTGGCGGTGCCCCAAGGTCAGTTTTGGATGCTGTTGGGCACCAATGGTAGTGGAAAATCTACCCTATTAAGGTTATTGGCGGGACTCCTCACCCCCCAATCCGGTCTGGTGAAACTGGCCGAACCCATGGGCTTTGTTTTCCAAAATCCTGACCATCAATTAGTTATGCCCACCGTCGGGGCCGATATTGCCTTTGGTTTAGTCAAGGAAAAACTTTCTCCCCAGGAAGTACAAGTCCGGGTAGGAGAAGCCCTGCAAGCGGTTAACCTAGCTGAGATGGCCCGCCGTCCCATCTATGCCCTCAGTGGCGGCCAAAAACAACGCATTGCCATTGCCGGGGCGATCGCCAGACACTGTTCCGTGCTTTTATTGGATGAGCCCACTGCCTTGCTGGACCGAGATAGTCAACAGGAATTGGTATTGCAAGTACAAAAATTAGTCAAACAAAGGGGCATCACCGCCCTGTGGGTAACCCATCGCTTAGACGAGCTAGACTATTGTGATGGAGCCTTTCTGTTGGAGGAAGGCAAAATTGTGGCGCAGGGAGATCCCAAACCCCTCAAGCAAAGAATGATGAACAAGACCGCAGTTTAA

Protein

MSTPAIIAQDLNFQWSADRPGLQNCSLAVPQGQFWMLLGTNGSGKSTLLRLLAGLLTPQSGLVKLAEPMGFVFQNPDHQLVMPTVGADIAFGLVKEKLSPQEVQVRVGEALQAVNLAEMARRPIYALSGGQKQRIAIAGAIARHCSVLLLDEPTALLDRDSQQELVLQVQKLVKQRGITALWVTHRLDELDYCDGAFLLEEGKIVAQGDPKPLKQRMMNKTAV