Your browser is old and dusty. Try Google Chrome!

Details for sll1621

ORF sll1621
Accession NP_441096.1
Symbol
Category Other
Definition AhpC/TSA family protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_1 Forward -134 -115 7.68668 0.275
NP_442657.1_1 Reverse -118 -135 9.50584 0.289
NP_440815.1_4 Reverse -111 -129 19.1941 0.11
NP_442291.1_7 Forward -233 -219 12.6843 0.211
NP_441343.1_7 Forward -213 -194 11.3075 0.113
NP_442272.1_2 Forward -133 -114 13.7982 0.197
NP_442272.1_2 Forward -39 -20 10.074 0.263
NP_442272.1_2 Forward -132 -113 9.31004 0.29
NP_440150.1_2 Forward -234 -215 5.99684 0.261
NP_442752.1_4 Reverse -39 -46 12.1338 0.0546
NP_443027.1_4 Reverse -37 -47 5.87989 0.294
NP_440784.1_7 Forward -222 -215 6.43063 0.218
NP_442405.1_3 Reverse -178 -190 18.1313 0.252
NP_441054.1_1 Forward -230 -216 15.9292 0.21
NP_442062.1_3 Reverse -93 -112 4.03102 0.198
NP_442062.1_3 Reverse -155 -174 3.93269 0.198
NP_440761.1_4 Forward -391 -372 -20.2567 0.287
NP_442276.1_2 Reverse -215 -234 11.8975 0.273
NP_441925.1_4 Forward -362 -343 -14.2592 0.261
NP_441149.1_9 Reverse -63 -82 0.588665 0.231
NP_441434.1_1 Forward -128 -114 7.93745 0.26
NP_441738.1_2 Forward -282 -275 6.52862 0.261
NP_442889.1_1 Reverse -234 -253 2.3594 0.145
NP_442889.1_1 Reverse -214 -233 -11.9969 0.218
NP_442889.1_8 Reverse -176 -190 5.1122 0.239
NP_442889.1_8 Reverse -87 -101 4.42388 0.267
NP_442570.1_3 Reverse -238 -257 -5.70374 0.248
NP_439953.1_4 Reverse -154 -173 16.0274 0.205
NP_441327.1_1 Forward -141 -122 6.42389 0.25
NP_441624.1_7 Forward -386 -372 7.9644 0.241
NP_440747.1_10 Forward -226 -214 -12.1541 0.227
NP_440747.1_10 Reverse -237 -249 -12.2524 0.254
NP_441854.1_10 Reverse -212 -231 9.63589 0.139
NP_442330.1_4 Forward -292 -273 14.263 0.286
NP_441014.1_5 Forward -254 -236 11.6222 0.258
NP_441014.1_8 Forward -365 -346 1.27776 0.214
NP_441634.1_8 Reverse -209 -223 -3.83532 0.295
NP_441634.1_8 Forward -397 -383 -4.22864 0.295
NP_440376.1_1 Reverse -240 -249 1.86802 0.238
NP_442687.1_7 Forward -250 -240 4.69992 0.238
NP_441077.1_2 Reverse -98 -117 2.91208 0.254
NP_441077.1_6 Forward -129 -113 16.106 0.0934
NP_441846.1_10 Reverse -346 -365 -20.65 0.256
NP_441763.1_9 Reverse -345 -364 9.73422 0.191
NP_440203.1_6 Forward -136 -117 15.899 0.214
NP_442816.1_7 Reverse -124 -143 7.20922 0.238
NP_439905.1_1 Forward -228 -215 12.5073 0.194
NP_441097.1_1 Reverse -81 -100 27.1388 0.0015
NP_441097.1_6 Reverse -103 -120 23.6488 0.00534
NP_441097.1_7 Reverse -234 -249 22.3994 0.0581
NP_442690.1_1 Reverse -99 -118 -14.3569 0.272
NP_442690.1_1 Reverse -119 -138 -14.6519 0.273
NP_442690.1_1 Reverse -117 -136 -15.1435 0.278
NP_442911.1_2 Forward -30 -11 -8.85033 0.244
NP_441580.1_6 Forward -356 -337 -7.27704 0.239
NP_440153.1_8 Forward -366 -353 4.93583 0.183
NP_443055.1_6 Forward -56 -38 2.47668 0.209
NP_440934.1_4 Reverse -203 -222 7.17762 0.267
NP_442002.1_9 Forward -250 -243 12.2322 0.185
NP_440377.1_1 Reverse -268 -285 14.6559 0.19
NP_440569.1_10 Forward -346 -327 8.83258 0.231
NP_442996.1_1 Reverse -112 -131 8.06865 0.21
NP_439966.1_7 Reverse -369 -379 7.94438 0.145
NP_441514.1_6 Forward -71 -64 12.7238 0.29
NP_441079.1_7 Forward -131 -112 10.4217 0.091
NP_441079.1_7 Reverse -110 -129 -3.44288 0.236
NP_441079.1_7 Reverse -113 -132 -7.08111 0.286
NP_442256.1_2 Reverse -369 -387 -9.61729 0.281
NP_001035871.2_7 Reverse -373 -383 12.8614 0.243
NP_442012.1_5 Reverse -350 -369 2.16274 0.269
NP_440723.1_8 Reverse -350 -364 10.7177 0.259
NP_443049.1_6 Reverse -38 -48 14.1783 0.131
NP_442215.1_2 Reverse -218 -234 -2.20308 0.193
NP_440780.1_1 Reverse -102 -121 9.40553 0.274
NP_442933.1_1 Reverse -118 -137 11.1244 0.249
NP_442933.1_1 Reverse -127 -146 6.34979 0.27
NP_442933.1_6 Forward -119 -100 13.1297 0.287
NP_441751.2_8 Reverse -215 -229 -6.98191 0.294
NP_442075.1_3 Reverse -194 -213 17.0107 0.232
NP_442970.1_3 Reverse -122 -140 11.4544 0.29
NP_442142.1_4 Reverse -368 -381 3.36198 0.258
NP_443009.1_2 Reverse -229 -248 -4.32711 0.248
NP_442301.1_2 Forward -367 -348 6.78348 0.263
NP_440881.1_4 Forward -262 -243 8.45592 0.226
NP_440835.1_1 Forward -245 -226 -8.35868 0.186
NP_441020.2_6 Reverse -37 -54 7.02034 0.245
NP_441015.1_10 Reverse -346 -365 -2.55715 0.178
NP_441015.1_10 Forward -25 -6 -5.99873 0.239
NP_441015.1_10 Reverse -215 -234 -9.93197 0.282
NP_441731.1_1 Forward -165 -147 16.6176 0.258
NP_441731.1_3 Forward -231 -212 -6.1954 0.29
NP_441096.1_1 Forward -96 -77 23.4535 0.0213
NP_441096.1_2 Forward -393 -374 32.842 0.0000747
NP_441096.1_3 Forward -117 -98 20.053 0.13
NP_441096.1_5 Forward -365 -347 17.3246 0.297
NP_441096.1_9 Forward -334 -315 19.9606 0.213
NP_442719.1_2 Reverse -61 -79 -10.5029 0.276
NP_441911.1_7 Reverse -119 -138 -10.7193 0.218
NP_442808.1_1 Forward -365 -355 2.83119 0.254
NP_442808.1_1 Forward -49 -39 2.73286 0.256
NP_442050.1_1 Reverse -344 -363 6.68596 0.282
NP_442342.1_9 Forward -50 -34 10.1866 0.137
NP_440601.1_10 Forward -162 -143 13.6675 0.29
NP_440385.1_8 Reverse -120 -139 13.1297 0.2
NP_441878.1_6 Forward -230 -220 9.7148 0.0237
NP_441878.1_6 Reverse -213 -223 0.865012 0.132
NP_441433.1_8 Reverse -372 -391 -2.16383 0.267
NP_442777.1_3 Forward -393 -375 0.903388 0.297
NP_440084.1_8 Reverse -114 -128 11.1842 0.251
NP_440084.1_8 Reverse -113 -127 9.84729 0.271
NP_441458.1_8 Reverse -111 -130 21.8024 0.0189
NP_441458.1_10 Reverse -2 -21 6.58763 0.197
NP_441819.1_5 Forward -142 -123 9.59652 0.262
NP_441819.1_5 Reverse -118 -137 9.31004 0.27
NP_442632.1_1 Forward -46 -27 11.405 0.254
NP_442888.1_6 Forward -247 -228 1.27776 0.295
NP_442998.1_10 Reverse -181 -188 10.4622 0.0819
NP_442998.1_10 Forward -18 -11 9.28223 0.117
NP_440299.1_1 Forward -192 -179 2.96866 0.265
NP_440299.1_1 Forward -364 -351 2.08368 0.299
NP_441799.1_9 Reverse -285 -304 -2.45882 0.213
NP_441559.1_8 Reverse -235 -249 -7.2769 0.289
NP_442860.1_7 Forward -140 -122 7.54704 0.283
NP_440915.1_6 Reverse -35 -49 7.07942 0.0757
NP_442158.1_4 Reverse -29 -39 10.8948 0.283
NP_440164.1_7 Forward -340 -321 15.0441 0.197
NP_442866.1_1 Forward -391 -372 -4.6221 0.228
NP_441464.1_8 Forward -223 -209 7.47274 0.206
NP_440026.1_8 Reverse -209 -227 17.0304 0.147
NP_440695.1_6 Reverse -160 -174 13.3201 0.24
NP_442993.1_1 Reverse -357 -373 -14.1995 0.297
NP_442327.1_3 Forward -132 -113 4.63094 0.283
NP_443028.1_4 Reverse -102 -121 15.7475 0.252
NP_440251.1_4 Forward -271 -254 17.8367 0.0992
NP_440251.1_6 Reverse -115 -133 19.0031 0.0957
NP_442240.1_2 Reverse -352 -371 -12.6852 0.163
NP_440586.1_8 Reverse -262 -269 7.02027 0.279
NP_440027.1_3 Forward -370 -352 5.91824 0.232
NP_440027.1_8 Forward -367 -348 12.9783 0.19
NP_439937.1_9 Forward -49 -32 -9.20492 0.183
NP_441595.1_5 Forward -379 -361 5.42735 0.257
NP_440398.1_6 Forward -391 -372 5.11266 0.275
NP_441789.1_7 Forward -365 -346 1.47364 0.245
NP_440316.1_10 Reverse -376 -386 8.1415 0.24
NP_439977.1_7 Forward -59 -40 14.6499 0.262
NP_440476.1_2 Forward -341 -322 12.1917 0.284
NP_442917.1_1 Forward -136 -117 10.0284 0.181
NP_441060.1_4 Forward -44 -26 2.67408 0.252
NP_441965.1_10 Reverse -211 -227 6.25339 0.183
NP_442280.1_10 Reverse -237 -255 5.35702 0.287
NP_441592.1_4 Forward -229 -210 2.94938 0.186
NP_440999.1_9 Forward -364 -350 -0.590395 0.212
NP_440888.1_2 Reverse -371 -385 5.89884 0.258
NP_440888.1_2 Forward -48 -34 5.01387 0.298
NP_440052.1_5 Forward -356 -337 -5.60541 0.293
NP_442277.1_7 Forward -143 -127 7.83714 0.196
NP_442277.1_7 Forward -132 -116 -1.1391 0.266
NP_441949.1_5 Reverse -163 -182 16.0787 0.115
NP_442845.1_2 Forward -386 -372 4.71948 0.254
NP_440089.1_1 Reverse -239 -257 11.1305 0.3
NP_441551.1_5 Forward -362 -346 6.2527 0.275
NP_441918.1_10 Forward -385 -367 13.7855 0.28
NP_442710.1_7 Forward -130 -111 -0.0145083 0.197
NP_442710.1_7 Reverse -113 -132 -2.22503 0.233
NP_442710.1_7 Forward -132 -113 -5.10833 0.279
NP_443064.1_6 Reverse -254 -264 8.97947 0.254
NP_440148.1_6 Reverse -195 -209 15.2817 0.3
NP_440911.1_3 Forward -309 -295 19.6651 0.205
NP_442780.1_3 Reverse -117 -136 9.7875 0.226
NP_441032.1_2 Forward -296 -277 10.6192 0.179
NP_441443.1_7 Reverse -224 -243 -2.55715 0.27
NP_440865.1_9 Reverse -345 -364 0.196116 0.143
NP_441052.1_2 Forward -229 -219 1.94665 0.221
NP_441669.1_2 Forward -283 -269 16.6169 0.279
NP_439949.1_7 Reverse -43 -57 11.6026 0.284
NP_442694.1_9 Forward -86 -67 10.4225 0.24
NP_441555.1_2 Forward -93 -74 10.8379 0.299
NP_442515.1_1 Forward -224 -210 4.91614 0.107
NP_442515.1_1 Forward -374 -360 -2.55701 0.277
NP_440338.1_4 Reverse -113 -132 11.7983 0.15
NP_442689.1_8 Reverse -123 -140 1.12048 0.191
NP_442024.1_9 Forward -282 -269 17.5222 0.18
NP_442450.1_5 Forward -50 -40 10.8948 0.115
NP_440588.1_2 Forward -232 -213 -5.21209 0.243
NP_440483.1_1 Forward -385 -366 -4.6221 0.221
NP_441078.1_4 Reverse -179 -188 5.80125 0.104
NP_441078.1_4 Forward -188 -179 5.70292 0.111
NP_442388.1_4 Forward -364 -345 15.9282 0.197
NP_442443.1_1 Reverse -356 -375 -0.885524 0.227
NP_441094.1_7 Forward -257 -238 17.9024 0.126
NP_440913.1_1 Reverse -37 -55 3.3624 0.299
NP_442913.1_10 Forward -238 -219 4.12936 0.0936
NP_440025.1_3 Forward -191 -177 10.7076 0.29
NP_442551.1_4 Reverse -218 -233 2.43817 0.245
NP_442900.1_1 Reverse -208 -227 -6.98204 0.251
NP_442603.1_7 Reverse -371 -385 6.58715 0.236
NP_442828.1_2 Forward -131 -112 13.9891 0.242
NP_441329.1_1 Reverse -100 -119 6.06331 0.265
NP_441329.1_6 Forward -141 -122 7.30471 0.179
NP_440772.1_10 Forward -140 -121 11.2603 0.273
NP_442045.1_5 Forward -308 -289 -2.55715 0.294
NP_442140.1_3 Reverse -228 -238 6.17489 0.184
NP_442028.1_1 Reverse -116 -129 9.32449 0.251
NP_442028.1_1 Reverse -120 -133 7.70113 0.289
NP_442028.1_1 Reverse -117 -130 7.70113 0.289
NP_441239.1_9 Forward -362 -350 3.97222 0.269
NP_441239.1_9 Reverse -212 -224 3.38223 0.285
NP_441951.1_4 Forward -242 -223 0.491109 0.297
NP_441951.1_4 Reverse -221 -240 0.392778 0.297
NP_441892.1_1 Reverse -368 -385 -4.58271 0.264
NP_441892.1_4 Reverse -219 -238 1.17943 0.266
NP_441017.1_8 Reverse -251 -266 6.86307 0.287
NP_440212.1_9 Reverse -112 -131 7.48109 0.158
NP_440212.1_9 Reverse -111 -130 3.73283 0.214
NP_440212.1_9 Forward -130 -111 1.71454 0.262
NP_440949.1_7 Forward -222 -203 11.11 0.233
NP_440546.1_4 Reverse -377 -387 9.17338 0.151
NP_440546.1_4 Reverse -227 -237 8.39772 0.192
NP_440546.1_4 Forward -380 -370 8.30077 0.196
NP_440546.1_6 Forward -294 -275 20.2556 0.0493
NP_440462.1_6 Reverse -37 -47 4.69992 0.187
NP_441848.1_4 Forward -138 -122 16.1449 0.151
NP_441848.1_4 Forward -64 -48 7.64616 0.288
NP_440696.1_6 Reverse -215 -234 4.62101 0.285
NP_442679.1_1 Forward -146 -127 -2.36049 0.24
NP_442679.1_1 Forward -155 -136 -3.83545 0.264
NP_442894.1_2 Reverse -79 -98 11.8975 0.154
NP_442360.1_5 Forward -255 -245 14.4347 0.228
NP_442456.1_5 Forward -384 -366 7.98396 0.26
NP_440914.1_7 Reverse -124 -143 6.15881 0.288
NP_441011.1_8 Reverse -378 -387 5.21127 0.278
NP_442533.1_1 Reverse -346 -365 4.42435 0.0798
NP_442533.1_6 Reverse -220 -229 11.3078 0.0442
NP_442533.1_6 Forward -223 -214 2.94966 0.232
NP_442541.1_10 Forward -229 -215 4.8172 0.248
NP_442232.1_5 Reverse -197 -216 16.4207 0.133
NP_440854.1_1 Forward -137 -118 18.5728 0.0256
NP_440854.1_5 Forward -131 -117 15.5768 0.274
NP_442229.1_3 Reverse -381 -398 16.9518 0.207
NP_442203.1_1 Forward -132 -118 17.5821 0.15
NP_441697.1_5 Reverse -111 -130 2.05265 0.178
NP_441697.1_5 Forward -131 -112 -2.24448 0.207
NP_441697.1_5 Reverse -112 -131 -10.5523 0.28
NP_441697.1_5 Reverse -113 -132 -10.7433 0.284
NP_440816.1_2 Forward -133 -114 5.56364 0.297
NP_441028.1_6 Reverse -366 -376 3.8145 0.281
NP_441527.1_4 Forward -141 -122 -4.82277 0.189
NP_441527.1_4 Reverse -98 -117 -12.5576 0.291
NP_441527.1_4 Forward -145 -126 -12.9396 0.296
NP_441527.1_5 Forward -251 -232 13.765 0.287
NP_441001.1_10 Reverse -204 -223 6.68596 0.249
NP_440799.1_10 Reverse -94 -113 11.0125 0.267
NP_439958.1_2 Reverse -325 -339 11.111 0.288
NP_441431.1_2 Forward -363 -349 12.6836 0.11
NP_440634.1_10 Forward -214 -195 4.42355 0.3
NP_441993.1_1 Reverse -345 -364 6.33227 0.181
NP_440358.1_8 Reverse -194 -213 5.01433 0.2
NP_440082.1_5 Reverse -124 -143 16.852 0.256
NP_440114.1_10 Reverse -377 -391 10.521 0.146
NP_441425.1_2 Reverse -112 -131 14.6558 0.237
NP_441421.1_6 Forward -132 -115 11.0337 0.279
NP_440457.1_1 Reverse -35 -47 0.0389777 0.25
NP_441801.1_4 Reverse -367 -377 2.53664 0.292
NP_441332.1_6 Forward -49 -39 11.7436 0.252
NP_441496.1_1 Forward -340 -326 13.476 0.291
NP_441159.1_1 Forward -187 -168 -3.73712 0.286
NP_441159.1_8 Reverse -123 -142 2.16195 0.236
NP_441885.1_5 Reverse -179 -189 0.176696 0.177
NP_440478.1_9 Forward -226 -207 8.65258 0.268
NP_441397.1_8 Reverse -322 -335 12.1892 0.269
NP_442451.1_2 Forward -64 -45 -9.63698 0.259
NP_441635.1_1 Reverse -112 -131 15.135 0.172
NP_441122.1_1 Forward -192 -177 4.30646 0.28
NP_441207.1_7 Forward -141 -127 9.64265 0.275
NP_439962.1_4 Forward -362 -343 -3.54046 0.253
NP_440175.1_4 Reverse -212 -231 -11.3086 0.186
NP_442015.1_3 Forward -50 -31 9.53674 0.296
NP_443052.1_9 Forward -362 -343 -6.09707 0.276
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGATTGGCATAGACCCCATAGCGCTGGGGAGTAACCCGCAGCCCCCGCTCCTTCAGCGTTTGAATAATTTCTTCTCTGTTTAAGGGCATACTGTTCCTCCTAACATCGGTGCGGCAACATTCGCTGATTTTTGATGGGTAAGTCCCTCTGGGCAAACCTCAGGAACCATGGGTCCTGGCCAGCACACCAATGATAATGATCCGCACTGTTTGGCTATAGTCTATCTAGCTTAACATTTTCTAGAAGGACTATTAGATAGAATAATTATAAAAAAAATATTAATTTTTAAGCTTGACTTATTTCTATCTCAGAACTATTCTGAGAAAAGAGGGCAAGCATTGATGAAAAATGCTCCATCCCCTCAGAAAAATTTAGTCGTTTAGATAGCCAGAGGTAACC

CDS

ATGACCCCCGAACGAGTTCCCAGTGTAGTGTTCAAAACCCGTGTCCGTGACGAATCTGTACCTGGTCCCAATCCCTACCGTTGGGAAGACAAAACCACTGAACAAATCTTTGGTGGCAAAAAGGTTGTGCTTTTCTCCCTACCCGGTGCCTTCACCCCCACCTGTTCTTCTAACCACTTGCCCCGCTACGAGCAGTTGTTTGAAGAATTCCAAGCCTTGGGAGTAGATGACATCATCTGTCTATCTGTGAACGATGCCTTTGTTATGTTCCAATGGGGCAAACAAATTGGTGCCGACAAAGTGAAATTACTACCCGATGGTAACGGCGAATTCACCCGCAAAATGGGTATGTTGGTGGAAAAATCCAACCTCGGTTTCGGGATGCGTTCCTGGCGCTATTCCATGTTTGTCAACGATGGCAAAATCGAAAAAATGTTTATTGAGCCTGAGTTCGGTGACAACTGTCCCGTAGATCCCTTCGAGTGTTCCGACGCTGACACCATGTTGGCCTACCTCAAAGGTGCTGAAGCGCCCGGGGTTTCTGAGCCCGTTAAAGCTTTTGTCGGCTAA

Protein

MTPERVPSVVFKTRVRDESVPGPNPYRWEDKTTEQIFGGKKVVLFSLPGAFTPTCSSNHLPRYEQLFEEFQALGVDDIICLSVNDAFVMFQWGKQIGADKVKLLPDGNGEFTRKMGMLVEKSNLGFGMRSWRYSMFVNDGKIEKMFIEPEFGDNCPVDPFECSDADTMLAYLKGAEAPGVSEPVKAFVG