Your browser is old and dusty. Try Google Chrome!

Details for sll1611

ORF sll1611
Accession NP_441220.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_4 Forward -243 -224 9.63507 0.278
NP_441480.1_1 Forward -249 -230 -0.787193 0.287
NP_440897.1_6 Reverse -357 -376 3.9319 0.14
NP_442151.1_1 Reverse -194 -213 4.42435 0.287
NP_440226.1_9 Reverse -300 -319 12.1925 0.215
NP_441098.1_3 Reverse -320 -339 -6.50185 0.28
NP_440996.1_1 Reverse -308 -327 18.6308 0.0234
NP_440996.1_2 Reverse -264 -273 14.8477 0.248
NP_441812.1_4 Reverse -367 -385 11.9172 0.253
NP_441470.1_6 Reverse -294 -313 28.2204 0.0000759
NP_442062.1_3 Forward -103 -84 -2.45882 0.271
NP_442062.1_3 Reverse -87 -106 -2.45882 0.271
NP_442972.1_2 Reverse -282 -296 15.2402 0.136
NP_440304.1_4 Reverse -26 -36 3.81494 0.292
NP_442268.1_3 Forward -371 -352 12.9783 0.284
NP_441492.1_1 Reverse -189 -208 11.1109 0.148
NP_442602.1_3 Reverse -53 -72 8.75091 0.0877
NP_441365.1_5 Reverse -189 -208 37.5619 0.000000115
NP_440300.1_5 Forward -180 -162 12.225 0.271
NP_441434.1_1 Forward -340 -326 10.0383 0.233
NP_441434.1_1 Reverse -326 -340 7.93745 0.26
NP_440178.1_7 Forward -364 -345 -15.0452 0.156
NP_441716.1_2 Forward -157 -138 3.35565 0.229
NP_442973.1_5 Reverse -197 -216 9.93088 0.287
NP_442145.1_4 Reverse -85 -104 4.05798 0.283
NP_442730.1_8 Forward -243 -224 8.16011 0.185
NP_442687.1_7 Reverse -238 -248 4.20827 0.262
NP_441077.1_6 Forward -110 -94 1.64498 0.299
NP_442658.1_1 Reverse -204 -214 6.37109 0.231
NP_442496.1_5 Reverse -256 -274 4.83737 0.288
NP_442690.1_1 Forward -103 -84 -13.3736 0.26
NP_442690.1_1 Forward -35 -16 -16.5201 0.289
NP_440200.1_7 Reverse -252 -271 6.22677 0.204
NP_441913.1_1 Reverse -365 -381 13.6262 0.246
NP_442598.1_2 Forward -399 -390 14.2577 0.252
NP_441000.1_1 Reverse -188 -206 13.3937 0.184
NP_440345.1_5 Forward -28 -14 14.525 0.276
NP_441369.1_1 Reverse -154 -173 38.7419 0.000000157
NP_441369.1_2 Reverse -184 -203 38.9385 0.0000000955
NP_441369.1_3 Reverse -137 -151 28.5156 0.00021
NP_442996.1_1 Reverse -82 -101 10.4559 0.21
NP_442281.1_1 Reverse -23 -37 2.65393 0.26
NP_441079.1_3 Reverse -208 -227 13.4708 0.166
NP_441566.1_3 Reverse -252 -271 14.5524 0.198
NP_440437.1_1 Reverse -348 -367 -5.80207 0.292
NP_442288.1_5 Reverse -152 -166 16.7159 0.12
NP_441556.1_6 Reverse -156 -174 12.4797 0.296
NP_442247.1_5 Forward -181 -167 14.4865 0.234
NP_442933.1_1 Forward -305 -286 7.11373 0.253
NP_442671.1_2 Reverse -162 -181 24.6829 0.000359
NP_442671.1_2 Forward -62 -43 -0.281761 0.294
NP_442970.1_1 Reverse -164 -178 9.56081 0.269
NP_440405.1_6 Reverse -320 -338 2.18243 0.26
NP_440881.1_10 Forward -371 -358 11.3273 0.249
NP_442076.1_5 Reverse -158 -177 9.93088 0.186
NP_441826.1_2 Reverse -357 -371 -0.197071 0.204
NP_441826.1_6 Reverse -318 -332 20.5508 0.0182
NP_441612.1_2 Reverse -262 -272 11.5505 0.21
NP_442227.1_4 Forward -66 -47 18.5831 0.111
NP_441911.1_10 Reverse -117 -136 10.3907 0.226
NP_440871.1_3 Forward -158 -144 15.905 0.166
NP_441036.1_7 Reverse -258 -268 16.7941 0.0578
NP_441445.1_1 Forward -381 -362 1.17943 0.259
NP_441739.1_2 Forward -71 -55 3.10612 0.285
NP_441116.1_10 Forward -270 -251 4.71934 0.257
NP_441819.1_5 Reverse -79 -98 8.35512 0.295
NP_442047.1_2 Forward -384 -370 15.4376 0.161
NP_441633.1_6 Forward -283 -264 8.75091 0.182
NP_440136.1_1 Forward -317 -301 9.69426 0.238
NP_442998.1_5 Reverse -60 -70 14.0414 0.151
NP_442998.1_5 Reverse -185 -195 8.53483 0.261
NP_440899.1_8 Forward -177 -158 -9.14533 0.258
NP_441118.1_2 Reverse -225 -244 24.4839 0.000875
NP_441118.1_10 Reverse -357 -375 24.0119 0.000829
NP_441362.1_2 Reverse -160 -179 5.55684 0.243
NP_441296.1_6 Forward -349 -330 0.982764 0.299
NP_440657.1_1 Forward -60 -41 11.4058 0.143
NP_440537.1_7 Reverse -138 -157 16.6629 0.0599
NP_440306.1_3 Reverse -321 -340 4.71934 0.295
NP_441340.1_5 Reverse -364 -371 8.8889 0.084
NP_441340.1_9 Reverse -90 -100 7.29115 0.289
NP_440161.1_3 Forward -39 -20 10.3242 0.23
NP_440372.1_3 Reverse -165 -179 15.0039 0.165
NP_441018.1_3 Forward -363 -344 10.52 0.286
NP_440530.1_6 Forward -356 -342 15.7664 0.201
NP_442910.1_1 Reverse -375 -394 -7.57203 0.254
NP_442129.1_6 Reverse -163 -182 13.9464 0.246
NP_440888.1_2 Forward -241 -227 6.19383 0.243
NP_441771.1_4 Reverse -261 -280 -4.42544 0.292
NP_440663.1_6 Forward -371 -352 14.4541 0.0249
NP_442845.1_2 Reverse -357 -371 3.93283 0.272
NP_442710.1_6 Reverse -271 -290 6.39097 0.204
NP_442710.1_7 Reverse -161 -180 -7.22274 0.294
NP_440148.1_1 Forward -22 -3 -5.70374 0.235
NP_439907.1_10 Reverse -355 -374 11.0117 0.273
NP_440519.1_6 Forward -246 -232 9.43936 0.29
NP_442694.1_8 Forward -178 -160 12.3105 0.191
NP_442694.1_9 Forward -22 -3 8.25926 0.277
NP_441542.1_4 Reverse -57 -71 4.52282 0.264
NP_441982.1_10 Forward -206 -187 8.55343 0.143
NP_440005.1_3 Reverse -324 -343 21.2407 0.00993
NP_442689.1_8 Forward -31 -14 -6.54933 0.285
NP_442689.1_8 Forward -178 -161 -8.61428 0.294
NP_441124.1_5 Reverse -157 -167 12.7217 0.215
NP_441124.1_5 Reverse -89 -99 10.8118 0.283
NP_440431.1_3 Reverse -356 -375 -10.7186 0.276
NP_440943.1_5 Reverse -203 -217 14.1593 0.22
NP_442348.1_2 Forward -72 -63 9.53783 0.28
NP_442906.1_9 Forward -282 -263 4.32602 0.207
NP_441432.1_8 Reverse -231 -240 2.85133 0.281
NP_441333.1_1 Forward -26 -16 11.9712 0.241
NP_440284.1_8 Reverse -195 -214 29.6945 0.000000161
NP_440284.1_9 Reverse -263 -282 28.8104 0.00000727
NP_440336.1_1 Reverse -287 -306 10.5209 0.286
NP_441329.1_1 Forward -268 -249 5.29938 0.265
NP_442436.1_4 Forward -306 -292 12.3893 0.218
NP_440227.1_2 Reverse -334 -350 8.41667 0.29
NP_441541.1_1 Reverse -174 -192 -3.43572 0.264
NP_442499.1_4 Reverse -361 -375 11.0127 0.226
NP_442840.1_7 Reverse -265 -284 13.5691 0.064
NP_440341.1_7 Forward -391 -377 12.6843 0.2
NP_442402.1_10 Forward -69 -59 10.9926 0.272
NP_441848.1_4 Reverse -340 -356 7.74165 0.288
NP_441848.1_4 Reverse -113 -129 7.74165 0.288
NP_442679.1_1 Reverse -286 -305 3.83436 0.147
NP_440825.1_6 Forward -109 -90 7.17762 0.287
NP_441959.1_8 Reverse -164 -177 8.61288 0.286
NP_442456.1_5 Reverse -228 -246 6.80398 0.26
NP_440854.1_1 Reverse -83 -102 9.97848 0.152
NP_441697.1_5 Forward -109 -90 -9.50187 0.268
NP_441028.1_6 Forward -269 -259 14.6309 0.158
NP_441527.1_4 Reverse -254 -273 -12.1756 0.285
NP_440007.1_9 Reverse -70 -84 1.67122 0.285
NP_442673.1_5 Forward -288 -270 11.4255 0.272
NP_442674.1_2 Forward -27 -8 8.94757 0.236
NP_442463.1_3 Forward -247 -228 10.0292 0.275
NP_439940.1_1 Reverse -136 -155 31.957 0.00000438
NP_441463.1_3 Forward -47 -28 -2.55715 0.156
NP_440855.1_3 Forward -398 -379 9.63507 0.185
NP_441431.1_1 Forward -179 -161 5.06306 0.245
NP_442805.1_6 Reverse -225 -244 1.86774 0.292
NP_440114.1_10 Reverse -206 -220 7.37441 0.236
NP_442324.1_7 Reverse -194 -213 6.24429 0.268
NP_440766.1_5 Reverse -260 -272 7.65579 0.288
NP_440213.1_4 Forward -288 -269 15.6421 0.217
NP_442680.1_5 Reverse -331 -350 1.73297 0.237
NP_441436.1_8 Reverse -381 -400 7.07928 0.293
NP_442582.1_3 Reverse -83 -97 15.0039 0.208
NP_441496.1_1 Forward -278 -264 14.3354 0.265
NP_442341.1_5 Reverse -339 -358 15.0441 0.182
NP_441173.1_9 Forward -67 -59 14.3753 0.161
NP_441173.1_9 Forward -66 -58 10.2454 0.261
NP_440191.1_6 Forward -179 -165 13.1895 0.294
NP_441397.1_8 Reverse -260 -273 15.8179 0.142
NP_441902.1_3 Reverse -260 -270 13.0789 0.23
NP_442451.1_7 Reverse -159 -178 12.9791 0.113
NP_442451.1_7 Reverse -290 -309 8.65258 0.26
NP_441190.1_2 Reverse -268 -287 4.03102 0.17
NP_440216.1_9 Reverse -365 -374 5.50626 0.292
NP_441064.1_4 Forward -386 -367 7.07928 0.276
NP_440117.1_7 Reverse -301 -315 17.9942 0.0592
NP_442116.1_6 Forward -180 -163 7.50051 0.254
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCTTTTTTTAGAGCTTCCCAGTCTAATTTCCTATGGCGACGCTCTACTTTTGTTGGGCTTAAATCTACTCTATTTAACCATCTGTATATCGAGGCTTTTCCTATTTTATATATCTTGGAAGCCTCAGTTATTTTTCCTCCAGCTTCTATATAAGCTACTACCCTTTGCCTTAAATCTAAACTGTAAGCCATTGTTTAAACCTGTTCATTTTGTACACTCCATAATTTTACATTAAATTCTCTCATCGTTAATTGAAATGACTATAGATTTGACTATTTTCATATACCAAAGGAAGCAGTTAAGATTTTCTTAACACTTTGCATCAGCTCGGAATTTTCCCAAAACAGGTAAAATCATTTACACTGAAATTGCTTTGTTTAACTTTTAGGGATTATTCCTG

CDS

GTGCTCACTGCTCAATCTGAATACGTTAAAAAACTCCGTCCTCTTTTGCCACCGGAAGCATTCCAAGCCGATCCCAAGAAATTAGTTATTTTAGGTTTAAACCTAGGTATTTATGTTGCGGGACTAACCATCGCTCGTCATCTCCATCAGTGGCCTGGGCAATGGCTTTGGTTATTTTTGCCCATGGCCCTATTAATGGGTAATAGCGTCACCGTATTTTTATTCGGTAGCCACGACCTGATGCACGGTAGTGTGCTCAAAAAACGTTCTAAAATTTCTTACCTGATTAGTTTATTAGGTCTTTCCCTCTGGTGGATGCCCCCTAGTCAATGGCGATCGCTCCATAATCAAGTTCATCATAATAACACCAATAGTTTGCGGGACCCTGACCGAAATTATCTGCACGAACAGCCGAAAACTTGGGGAAAATGGATTCATCACCTGTTTGCTCCCTCGGGAGAAGTTAATACCCTTTGGTTAATTTTTGGCATGGGTACTGCCTGGGGTGTACATAATTTTCGTAACCTGATTTCCGTACTTTTCTTCACTGGTGGTAACGCCGATTTTGTTCCGGCTGCTTTTACGGTTAAAGCCCAAGACCGCCAAAGAATTTGGTTGGAATTAGCAGCCATAGGGGCAGTGCATTTAAGCATTTTGTTTTACCTGCAATTCCAATTGATTCCCATTATTTTAGGCTACTTTTTGCCGATTTTCCTGGGTCATGCTATGGGCATGTTTTATATCTACACCAACCATTTGGCTTGCCCGATGACGGATATTAATGATCCTTTGGTTAATAGTGTTTCTTTGCGGATGCCCAAGTTATTTGATTGCTTACATTTTAATTTTTCTTACCACACAGAGCACCACTTATTTCCCGACGTAAATTCCGATTATTATCCTTTAGTGCAGGATTTGCTACAAACCCATTATCCTGGGCAGATGAATTTGTTGACTGCCAAAGAAGCCTGGAAAATGTTACTGGAAACTCCCCGCCATTACCAAGGGGAAACAACCCTAGTGGGCTACAACGGTGGTGAGACGATCGCCTGTCCATTGCCGAAAAATGTCCCCGATTTAACCGAGACCAAAGTAACCGCATCGGTTTAA

Protein

MLTAQSEYVKKLRPLLPPEAFQADPKKLVILGLNLGIYVAGLTIARHLHQWPGQWLWLFLPMALLMGNSVTVFLFGSHDLMHGSVLKKRSKISYLISLLGLSLWWMPPSQWRSLHNQVHHNNTNSLRDPDRNYLHEQPKTWGKWIHHLFAPSGEVNTLWLIFGMGTAWGVHNFRNLISVLFFTGGNADFVPAAFTVKAQDRQRIWLELAAIGAVHLSILFYLQFQLIPIILGYFLPIFLGHAMGMFYIYTNHLACPMTDINDPLVNSVSLRMPKLFDCLHFNFSYHTEHHLFPDVNSDYYPLVQDLLQTHYPGQMNLLTAKEAWKMLLETPRHYQGETTLVGYNGGETIACPLPKNVPDLTETKVTASV