Your browser is old and dusty. Try Google Chrome!

Details for sll1609

ORF sll1609
Accession NP_441223.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_7 Reverse -277 -284 12.9205 0.23
NP_440120.1_4 Forward -238 -224 14.0609 0.287
NP_442655.1_2 Reverse -273 -292 -0.000545616 0.295
NP_442752.1_4 Forward -8 -1 5.54565 0.194
NP_441745.1_2 Forward -32 -13 21.2381 0.1
NP_441812.1_3 Reverse -287 -301 17.4042 0.0613
NP_441802.1_1 Reverse -254 -273 5.50599 0.283
NP_442602.1_3 Reverse -260 -279 1.76941 0.18
NP_441200.1_4 Reverse -351 -370 5.89931 0.291
NP_441208.1_9 Reverse -280 -294 7.37441 0.222
NP_441594.1_9 Reverse -164 -183 19.0757 0.133
NP_441546.1_1 Reverse -364 -377 16.1456 0.278
NP_441082.1_10 Reverse -277 -290 10.639 0.236
NP_441082.1_10 Reverse -257 -270 9.65572 0.242
NP_441082.1_10 Reverse -278 -291 8.77074 0.262
NP_441149.1_9 Reverse -110 -129 11.995 0.0962
NP_441738.1_2 Forward -268 -261 6.52862 0.261
NP_442706.1_5 Reverse -213 -232 12.1904 0.294
NP_442570.1_3 Reverse -280 -299 -6.98204 0.265
NP_441327.1_1 Reverse -214 -233 2.77174 0.283
NP_442145.1_3 Forward -241 -222 5.60432 0.262
NP_441265.1_6 Forward -131 -112 12.585 0.287
NP_440470.1_5 Reverse -38 -57 12.2703 0.169
NP_440057.1_4 Forward -42 -23 14.8688 0.192
NP_441014.1_10 Reverse -177 -196 2.35861 0.216
NP_440376.1_1 Reverse -361 -370 1.08137 0.258
NP_441077.1_6 Forward -49 -33 3.57312 0.268
NP_442530.1_6 Forward -81 -68 18.6813 0.14
NP_442836.1_10 Reverse -282 -292 14.4347 0.212
NP_440203.1_5 Reverse -273 -283 10.796 0.213
NP_442816.1_7 Reverse -44 -63 6.06331 0.242
NP_442816.1_7 Reverse -43 -62 5.29938 0.251
NP_441097.1_2 Reverse -352 -369 2.89044 0.293
NP_442690.1_1 Forward -399 -380 -8.94866 0.19
NP_442690.1_1 Reverse -38 -57 -10.1286 0.21
NP_442690.1_1 Reverse -25 -44 -10.227 0.212
NP_442853.1_2 Forward -137 -118 15.2408 0.127
NP_441099.1_5 Forward -269 -250 -5.9004 0.155
NP_442002.1_9 Reverse -268 -275 11.1505 0.185
NP_441646.1_7 Reverse -172 -186 14.3559 0.256
NP_442885.1_4 Reverse -14 -27 15.343 0.265
NP_439966.1_7 Forward -299 -289 6.56775 0.177
NP_439966.1_9 Reverse -259 -268 5.3096 0.253
NP_440983.1_5 Reverse -181 -200 -8.55534 0.295
NP_441514.1_4 Forward -233 -214 13.3767 0.269
NP_441514.1_6 Forward -281 -274 12.8221 0.252
NP_443030.1_1 Reverse -381 -398 8.49531 0.261
NP_442215.1_2 Forward -274 -258 -4.1697 0.228
NP_442177.1_5 Reverse -364 -378 7.76774 0.293
NP_439922.1_7 Forward -353 -336 16.7551 0.152
NP_442970.1_3 Reverse -39 -57 14.8427 0.168
NP_440881.1_10 Forward -358 -345 18.5055 0.249
NP_441198.1_4 Reverse -166 -185 8.45592 0.285
NP_439939.1_1 Forward -380 -361 13.3716 0.275
NP_439939.1_4 Reverse -62 -81 -1.37718 0.28
NP_441020.2_6 Reverse -259 -276 8.29864 0.203
NP_441764.1_8 Reverse -328 -338 15.5217 0.284
NP_442719.1_2 Reverse -262 -280 -0.374908 0.162
NP_441612.1_2 Forward -187 -177 7.00028 0.268
NP_442427.1_8 Forward -230 -211 6.19431 0.247
NP_442808.1_1 Forward -293 -283 1.35624 0.287
NP_442692.1_1 Forward -269 -250 5.60432 0.111
NP_442542.1_2 Reverse -172 -185 7.00078 0.197
NP_442903.1_2 Forward -56 -37 10.265 0.165
NP_442903.1_10 Forward -326 -307 21.9273 0.0224
NP_441557.1_8 Reverse -115 -125 10.796 0.275
NP_442066.2_9 Forward -225 -212 6.4108 0.291
NP_441433.1_8 Forward -291 -272 -4.72043 0.294
NP_442241.1_2 Forward -174 -155 5.211 0.175
NP_440058.1_2 Reverse -298 -317 7.47261 0.289
NP_442347.1_2 Forward -296 -287 3.83464 0.284
NP_442347.1_8 Reverse -282 -301 2.3594 0.291
NP_442047.1_2 Forward -284 -270 13.2743 0.224
NP_442317.1_6 Reverse -296 -315 11.0125 0.203
NP_441633.1_3 Reverse -299 -312 0.707601 0.117
NP_442998.1_5 Reverse -267 -277 15.5163 0.149
NP_442998.1_5 Forward -117 -107 7.25653 0.298
NP_442334.1_2 Forward -320 -303 -14.3175 0.3
NP_441362.1_2 Forward -46 -27 5.55684 0.243
NP_441559.1_8 Reverse -257 -271 0.687908 0.163
NP_440915.1_6 Reverse -257 -271 7.66941 0.0669
NP_440717.1_2 Forward -132 -113 -11.4069 0.289
NP_441464.1_10 Reverse -281 -295 12.1926 0.201
NP_440306.1_5 Forward -63 -44 2.55606 0.189
NP_442453.1_6 Reverse -114 -128 18.3011 0.113
NP_441340.1_5 Reverse -351 -358 8.8889 0.084
NP_443028.1_4 Forward -58 -39 7.48206 0.293
NP_440327.1_6 Reverse -271 -290 4.916 0.266
NP_442959.1_5 Reverse -212 -231 12.9791 0.222
NP_441665.1_2 Reverse -264 -283 16.5191 0.0815
NP_441592.1_7 Reverse -309 -328 8.94757 0.234
NP_441896.1_5 Forward -201 -194 12.2322 0.273
NP_443036.1_3 Reverse -208 -225 16.7551 0.188
NP_441268.1_1 Reverse -57 -76 12.2703 0.265
NP_441304.1_10 Forward -281 -272 13.0777 0.255
NP_443064.1_6 Forward -378 -368 10.7247 0.136
NP_441223.1_5 Forward -45 -31 15.0979 0.293
NP_440519.1_3 Reverse -272 -291 10.8159 0.239
NP_442780.1_3 Reverse -37 -56 6.34979 0.269
NP_440454.1_2 Forward -57 -43 13.285 0.227
NP_442120.1_10 Reverse -206 -225 -8.65367 0.237
NP_441867.1_2 Reverse -260 -279 -17.0118 0.291
NP_440673.1_3 Forward -380 -373 8.20058 0.234
NP_440673.1_7 Forward -213 -194 6.58763 0.155
NP_441884.1_6 Reverse -208 -218 17.053 0.284
NP_441733.1_10 Reverse -258 -271 3.75586 0.288
NP_441004.1_1 Forward -310 -291 -6.98204 0.193
NP_441004.1_1 Forward -199 -180 -11.8986 0.243
NP_441004.1_2 Forward -204 -185 -3.93378 0.286
NP_441004.1_4 Forward -196 -186 13.7464 0.213
NP_442813.1_4 Reverse -4 -23 3.53937 0.197
NP_442139.1_7 Forward -204 -185 13.5691 0.167
NP_443054.1_2 Reverse -267 -281 -0.000409212 0.283
NP_441157.1_1 Forward -52 -38 6.29216 0.218
NP_441668.1_4 Forward -280 -261 -1.96717 0.285
NP_442515.1_1 Forward -184 -170 2.2612 0.14
NP_442515.1_1 Reverse -300 -314 -5.01529 0.298
NP_442689.1_8 Reverse -29 -46 0.0388413 0.191
NP_441349.1_10 Reverse -278 -297 -4.13045 0.161
NP_442843.1_1 Reverse -351 -370 -10.227 0.277
NP_441124.1_5 Forward -343 -333 12.1487 0.23
NP_442237.1_3 Reverse -56 -70 17.3912 0.281
NP_440023.1_7 Reverse -272 -291 4.71934 0.293
NP_441003.1_9 Reverse -292 -311 6.39097 0.249
NP_440483.1_1 Reverse -256 -275 11.4058 0.154
NP_442348.1_2 Forward -279 -270 11.8978 0.225
NP_442443.1_4 Forward -119 -109 15.5158 0.179
NP_440526.1_3 Forward -179 -168 4.48308 0.267
NP_442344.1_4 Reverse -244 -263 19.0757 0.0483
NP_440629.1_5 Forward -280 -261 9.24257 0.269
NP_442510.1_9 Reverse -257 -271 16.3225 0.268
NP_442727.1_10 Forward -78 -59 0.687771 0.214
NP_442400.1_10 Forward -62 -49 13.6216 0.177
NP_441040.1_2 Reverse -274 -293 -16.5201 0.3
NP_440025.1_3 Reverse -266 -280 14.096 0.235
NP_441786.1_3 Forward -330 -311 6.98095 0.287
NP_440250.1_4 Reverse -26 -45 14.1583 0.18
NP_440010.1_3 Reverse -250 -269 -0.688862 0.25
NP_441943.1_8 Forward -267 -248 -6.1954 0.261
NP_441943.1_8 Forward -288 -269 -13.3736 0.265
NP_439970.1_4 Reverse -197 -216 -4.42544 0.293
NP_440671.1_1 Reverse -328 -347 4.79121 0.267
NP_440875.1_9 Reverse -1 -11 7.98268 0.251
NP_440875.1_9 Forward -268 -258 6.91198 0.294
NP_441727.1_3 Forward -377 -358 2.45773 0.3
NP_440833.1_6 Reverse -268 -282 10.717 0.242
NP_440833.1_6 Reverse -63 -77 9.24208 0.265
NP_442216.1_4 Reverse -272 -280 8.1805 0.255
NP_441617.1_6 Reverse -28 -47 -7.76869 0.295
NP_440812.1_10 Reverse -118 -131 11.3273 0.28
NP_442402.1_6 Reverse -207 -216 14.4544 0.241
NP_442402.1_10 Reverse -215 -225 12.9592 0.204
NP_442402.1_10 Forward -218 -208 12.4676 0.212
NP_441848.1_4 Reverse -57 -73 12.9937 0.195
NP_441848.1_4 Forward -228 -212 10.2244 0.261
NP_441848.1_4 Forward -57 -41 7.74165 0.288
NP_442460.1_3 Reverse -269 -288 10.8159 0.293
NP_441926.1_3 Reverse -107 -123 2.12349 0.297
NP_440160.1_9 Reverse -361 -380 9.63589 0.235
NP_441252.1_6 Reverse -266 -273 14.3954 0.168
NP_441408.2_7 Forward -45 -26 -1.96717 0.262
NP_441408.2_7 Forward -312 -293 -4.81876 0.286
NP_440914.1_1 Forward -291 -281 7.44401 0.237
NP_441011.1_10 Forward -353 -334 24.9755 0.0188
NP_441697.1_5 Reverse -212 -231 -7.49654 0.246
NP_441028.1_6 Reverse -179 -189 10.4026 0.203
NP_440116.1_4 Reverse -359 -378 13.2741 0.251
NP_441527.1_4 Forward -59 -40 -10.9342 0.277
NP_440007.1_4 Reverse -334 -353 8.65258 0.294
NP_441825.1_4 Forward -313 -303 17.9746 0.158
NP_440480.1_10 Reverse -320 -334 17.2068 0.224
NP_441286.1_1 Reverse -300 -312 -5.95921 0.235
NP_440083.1_8 Forward -153 -134 6.29264 0.286
NP_442382.1_7 Forward -293 -274 5.30933 0.252
NP_441021.1_1 Forward -220 -201 -12.1936 0.281
NP_439958.1_2 Forward -236 -222 11.111 0.288
NP_442794.1_1 Reverse -182 -194 2.89058 0.286
NP_441962.1_4 Reverse -207 -226 4.22769 0.0978
NP_441431.1_2 Reverse -258 -272 6.48882 0.269
NP_442805.1_1 Reverse -38 -55 8.20031 0.22
NP_440114.1_10 Forward -318 -304 5.99778 0.289
NP_442698.1_10 Forward -130 -111 6.58763 0.233
NP_441237.1_9 Reverse -262 -272 10.5014 0.228
NP_441801.1_4 Reverse -273 -283 3.02829 0.231
NP_441332.1_6 Forward -292 -282 10.7754 0.287
NP_440473.1_9 Forward -321 -302 -9.83364 0.267
NP_442703.1_9 Forward -61 -43 11.8189 0.227
NP_440191.1_4 Reverse -217 -227 15.572 0.254
NP_440191.1_6 Forward -51 -37 13.094 0.294
NP_442932.1_9 Forward -129 -110 16.5191 0.14
NP_442354.1_8 Reverse -114 -133 9.73422 0.266
NP_441635.1_5 Forward -80 -66 17.0232 0.236
NP_442214.1_1 Forward -213 -194 9.83255 0.276
NP_440216.1_9 Forward -120 -111 13.5694 0.197
NP_442371.1_1 Forward -238 -228 12.2709 0.258
NP_442015.1_10 Forward -263 -250 3.16588 0.185
NP_440198.1_2 Forward -294 -275 19.9624 0.205
NP_440244.1_1 Forward -124 -105 -1.7705 0.205
NP_440416.1_9 Reverse -106 -125 -17.5035 0.241
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCTAAACGTTGGTTACAATATCGTCGCTTAGCCCAACTCCATCCTATGGCTAGGCTTTATCAAACTTTGCTGTATGACTTGGAGCAAAGGGGTTTTCGCAAAAGTCGAGCCCAAACCCCAGGGGAATTTGCCCAATCCCTGCGGGAACATCTAACTCCAGAGCAGGTAGAAATAATTGTGGAAATTTCCACAGCCTATGTGGCTTGGCGTTATGGAGAGCAACAACCCCACCTAGATTATCTGGGTCAGCAGTTTAAACTTCTAGAACACAGTTGGCGGAGCAAGGCAAAAACGAAGTTACCCTAAAATATGCCTGTGCTTAAATGGACAATTTTTTGAAATTAAACAGTAACAAAAAGTTAAAGCTAAACTTGAATCAGCCAAATAAAACAGGGGATCA

CDS

ATGATGGTCGTTGCTACAACTAAAATCCTAACAGCGGCTGAGTATCTGCAACGGGAAGAACAGGCCACTGAAAAAAGTGAGTTTATCCAAGGAGAAATTATTCCCATTGCCGGAGCCTCCGCCAACCATAATCGCTTAACCTTTAATTTAAGCCGCTTATTACCTCTAGAAATTGGCGATCGCCAATATGAAATTTTTGTCAGCGATATGAGGTTATGGATTGCTGAGTCTGAAAGTTATTTTTACCCCGATGTGATGGTAATTGCGGAAGAGCCAAAGTTTACTGATAATAGTCAGATGGCGGTGACCAATCCCTCTTTGATTGCCGAAGTCCTCTCCACTTCAGCAGCGGGCTTTGATAAAAATCAGAAATTTGGCTTTTACCGGACTATCCCTAAATTACAAGAATACTTATTAATTGATCAATTCTGTTATCGTGTAGAACATTACCAAAAAGTTGGTGATCGCCAATGGTTATTAACGGAACTGATGGGAGAAAATGCCGAAATTGAATTTAGTTTTATGAAAATATAG

Protein

MMVVATTKILTAAEYLQREEQATEKSEFIQGEIIPIAGASANHNRLTFNLSRLLPLEIGDRQYEIFVSDMRLWIAESESYFYPDVMVIAEEPKFTDNSQMAVTNPSLIAEVLSTSAAGFDKNQKFGFYRTIPKLQEYLLIDQFCYRVEHYQKVGDRQWLLTELMGENAEIEFSFMKI