Your browser is old and dusty. Try Google Chrome!

Details for sll1605

ORF sll1605
Accession NP_441227.1
Symbol
Category (3R)-hydroxymyristol acyl carrier protein dehydrase
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -254 -240 16.0275 0.104
NP_441061.1_2 Reverse -356 -370 12.8809 0.0441
NP_441061.1_2 Forward -331 -317 -2.26202 0.287
NP_442100.1_1 Forward -22 -3 5.87233 0.296
NP_442100.1_1 Reverse -35 -54 5.20389 0.296
NP_441418.1_6 Forward -370 -351 -0.590531 0.0102
NP_441418.1_6 Forward -364 -345 -1.47551 0.0136
NP_442291.1_7 Reverse -166 -180 12.0943 0.213
NP_442272.1_2 Reverse -29 -48 9.31004 0.29
NP_441453.1_4 Forward -124 -116 6.80426 0.121
NP_441453.1_4 Forward -364 -356 6.70593 0.121
NP_441453.1_4 Reverse -115 -123 6.11594 0.121
NP_441453.1_7 Reverse -157 -164 12.9205 0.23
NP_442151.1_6 Forward -124 -110 11.6026 0.0956
NP_442151.1_6 Reverse -115 -129 9.34103 0.152
NP_442151.1_6 Reverse -355 -369 8.45605 0.172
NP_442151.1_6 Reverse -163 -177 8.25939 0.178
NP_442151.1_6 Forward -284 -270 5.01447 0.298
NP_442151.1_6 Forward -130 -116 5.01447 0.298
NP_441818.1_1 Reverse -116 -127 12.0545 0.145
NP_441818.1_9 Forward -300 -281 -2.0655 0.201
NP_440259.1_4 Forward -189 -175 10.3712 0.264
NP_440348.1_6 Forward -260 -241 6.58763 0.203
NP_440348.1_6 Reverse -95 -114 3.14605 0.278
NP_442655.1_1 Reverse -247 -266 5.70265 0.157
NP_442655.1_10 Forward -367 -348 -11.0136 0.23
NP_442173.1_1 Reverse -116 -124 12.0158 0.0316
NP_442173.1_1 Reverse -356 -364 5.82095 0.2
NP_442173.1_1 Forward -123 -115 4.83764 0.241
NP_442752.1_4 Forward -364 -357 13.8055 0.0199
NP_442752.1_4 Forward -124 -117 13.8055 0.0199
NP_442752.1_4 Forward -158 -151 12.1338 0.0546
NP_443027.1_4 Forward -366 -356 9.32148 0.166
NP_439997.1_4 Forward -259 -240 6.19431 0.266
NP_442975.1_10 Reverse -351 -365 20.0584 0.00259
NP_440784.1_7 Reverse -356 -363 6.23397 0.241
NP_440784.1_7 Forward -123 -116 6.23397 0.241
NP_440784.1_7 Forward -363 -356 6.13563 0.241
NP_440784.1_7 Reverse -116 -123 6.13563 0.241
NP_440061.1_9 Reverse -147 -161 5.21053 0.293
NP_441054.1_4 Forward -380 -362 -4.11075 0.297
NP_440878.1_4 Forward -189 -171 11.1305 0.288
NP_442062.1_8 Forward -158 -148 3.51995 0.267
NP_441859.1_3 Reverse -114 -133 5.70185 0.192
NP_441859.1_3 Forward -125 -106 2.35861 0.262
NP_441859.1_3 Forward -365 -346 1.76863 0.275
NP_440304.1_4 Forward -372 -362 6.66654 0.149
NP_442242.1_4 Forward -363 -356 12.4288 0.0393
NP_440044.1_8 Reverse -116 -135 0.884433 0.189
NP_440044.1_8 Forward -363 -344 -3.73712 0.29
NP_439918.1_3 Forward -258 -239 3.93269 0.266
NP_441594.1_6 Forward -373 -354 5.70265 0.209
NP_442110.1_7 Forward -158 -144 0.786239 0.248
NP_442110.1_7 Reverse -355 -369 -0.197071 0.276
NP_442726.1_7 Reverse -199 -217 7.09898 0.192
NP_440273.1_1 Reverse -35 -54 13.0342 0.243
NP_440769.1_8 Forward -52 -33 11.0125 0.177
NP_440769.1_8 Reverse -34 -53 7.86593 0.248
NP_441083.1_5 Reverse -115 -125 17.7779 0.00336
NP_441083.1_5 Reverse -355 -365 9.81313 0.0224
NP_441083.1_5 Forward -124 -114 7.05986 0.067
NP_441434.1_8 Forward -54 -35 12.7346 0.154
NP_441738.1_2 Reverse -357 -364 15.28 0.0102
NP_441738.1_2 Reverse -117 -124 15.28 0.0102
NP_441738.1_2 Reverse -236 -243 6.72528 0.236
NP_441558.1_5 Reverse -353 -372 4.52268 0.28
NP_440209.1_1 Forward -364 -356 14.8674 0.012
NP_440209.1_1 Forward -124 -116 8.57422 0.0425
NP_440209.1_1 Reverse -355 -363 5.62429 0.0821
NP_440209.1_1 Reverse -115 -123 5.52596 0.0821
NP_442889.1_1 Reverse -88 -107 -13.2752 0.252
NP_441770.1_4 Reverse -54 -73 -7.17871 0.229
NP_441770.1_4 Forward -363 -344 -7.37537 0.229
NP_441770.1_5 Forward -201 -182 3.34271 0.229
NP_441025.1_5 Reverse -362 -376 14.8476 0.258
NP_441716.1_1 Forward -364 -350 9.5377 0.112
NP_441716.1_1 Reverse -115 -129 3.24451 0.272
NP_441327.1_1 Reverse -33 -52 14.401 0.184
NP_441327.1_1 Reverse -34 -53 9.11495 0.205
NP_441598.1_1 Reverse -162 -181 5.99764 0.295
NP_442111.1_4 Reverse -114 -128 9.2427 0.0619
NP_442111.1_4 Reverse -212 -226 3.8345 0.229
NP_441163.1_9 Reverse -346 -365 12.5858 0.272
NP_440851.1_6 Reverse -196 -213 7.512 0.263
NP_440906.1_5 Forward -363 -356 12.0355 0.0724
NP_440906.1_5 Reverse -356 -363 12.0355 0.0724
NP_440906.1_5 Forward -123 -116 6.23397 0.234
NP_440906.1_5 Reverse -116 -123 6.13563 0.241
NP_440747.1_10 Forward -127 -115 -11.9574 0.178
NP_440747.1_10 Forward -367 -355 -12.0557 0.199
NP_440747.1_10 Reverse -146 -158 -12.1541 0.227
NP_441130.1_10 Reverse -113 -127 14.8476 0.0398
NP_441130.1_10 Reverse -353 -367 10.9143 0.109
NP_441130.1_10 Forward -360 -346 5.99778 0.207
NP_441486.1_1 Reverse -352 -366 -5.70361 0.254
NP_441486.1_1 Forward -367 -353 -6.39192 0.294
NP_442634.1_4 Forward -160 -146 -5.01529 0.228
NP_440470.1_5 Reverse -33 -52 13.3207 0.158
NP_440470.1_5 Forward -53 -34 9.31004 0.234
NP_440842.1_10 Reverse -161 -175 6.48943 0.251
NP_440842.1_10 Forward -175 -161 5.40779 0.251
NP_440057.1_6 Reverse -34 -53 10.6956 0.289
NP_442848.1_1 Forward -370 -356 4.81781 0.095
NP_442848.1_1 Forward -130 -116 -2.16369 0.263
NP_442848.1_1 Reverse -349 -363 -4.32697 0.287
NP_441012.1_4 Reverse -354 -367 6.90245 0.276
NP_443018.1_3 Reverse -116 -123 11.7405 0.0655
NP_443018.1_3 Forward -123 -116 5.44732 0.193
NP_443018.1_3 Forward -363 -356 5.34899 0.212
NP_443018.1_3 Reverse -356 -363 5.34899 0.212
NP_441634.1_8 Reverse -147 -161 5.21113 0.114
NP_441634.1_8 Forward -366 -352 -3.73699 0.295
NP_441634.1_8 Forward -126 -112 -4.32697 0.295
NP_440376.1_1 Forward -124 -115 5.99792 0.111
NP_440376.1_1 Reverse -199 -208 1.96635 0.236
NP_440376.1_1 Forward -364 -355 -0.000272808 0.285
NP_440376.1_1 Reverse -355 -364 -0.0986038 0.285
NP_440376.1_1 Reverse -115 -124 -0.196935 0.285
NP_441857.1_6 Forward -262 -252 14.3364 0.244
NP_441588.1_4 Reverse -357 -367 8.63316 0.14
NP_442687.1_7 Reverse -114 -124 5.97822 0.179
NP_442485.1_3 Forward -366 -347 -1.57384 0.26
NP_442485.1_3 Reverse -344 -363 -2.95047 0.271
NP_441422.1_7 Reverse -353 -370 -0.944468 0.173
NP_440887.1_10 Forward -366 -347 12.0942 0.299
NP_442658.1_1 Reverse -353 -363 10.4026 0.119
NP_442658.1_1 Reverse -113 -123 5.87944 0.246
NP_440141.1_4 Forward -373 -354 -12.0953 0.298
NP_442782.1_2 Forward -254 -240 1.37622 0.281
NP_442782.1_2 Forward -15 -1 0.392915 0.29
NP_440656.1_8 Reverse -344 -363 -1.18052 0.175
NP_442544.1_2 Reverse -155 -169 0.0979218 0.217
NP_441414.1_9 Forward -124 -105 -9.34199 0.259
NP_440720.1_1 Forward -135 -116 3.34271 0.26
NP_442937.1_5 Forward -369 -350 19.2723 0.0211
NP_442937.1_5 Forward -305 -286 9.73422 0.183
NP_442937.1_5 Reverse -96 -115 8.94757 0.205
NP_442937.1_5 Forward -129 -110 7.07928 0.263
NP_442321.1_1 Forward -174 -155 3.14605 0.126
NP_441958.1_5 Reverse -114 -124 0.865012 0.12
NP_441958.1_5 Forward -125 -115 0.865012 0.12
NP_441958.1_5 Forward -365 -355 -6.41148 0.28
NP_441127.1_1 Forward -370 -356 11.701 0.215
NP_441127.1_1 Forward -325 -311 7.86607 0.3
NP_440203.1_5 Reverse -118 -128 12.6642 0.141
NP_439905.1_1 Reverse -116 -129 7.00078 0.269
NP_440984.1_7 Reverse -110 -124 8.45605 0.144
NP_439990.1_5 Forward -369 -356 9.75405 0.133
NP_441338.2_9 Reverse -2 -21 5.30933 0.252
NP_442690.1_1 Reverse -3 -22 14.9458 0.0273
NP_442690.1_1 Reverse -33 -52 -1.86883 0.13
NP_442690.1_1 Forward -54 -35 -8.16202 0.183
NP_442911.1_2 Reverse -139 -158 -3.63879 0.115
NP_442911.1_2 Forward -134 -115 -4.22878 0.129
NP_440153.1_5 Forward -357 -343 1.17956 0.268
NP_440993.1_3 Reverse -105 -124 1.27698 0.232
NP_440993.1_4 Forward -172 -155 2.39878 0.3
NP_441099.1_5 Forward -374 -355 -4.6221 0.147
NP_441294.1_7 Reverse -351 -365 12.6102 0.0916
NP_441294.1_7 Forward -288 -274 10.4025 0.191
NP_440411.1_2 Forward -197 -178 2.65837 0.272
NP_442438.1_10 Forward -369 -355 7.07942 0.101
NP_442438.1_10 Reverse -144 -158 5.70279 0.129
NP_440879.1_6 Reverse -350 -369 -5.01543 0.294
NP_440377.1_1 Forward -194 -177 19.7774 0.0615
NP_440377.1_1 Reverse -177 -194 11.2737 0.291
NP_441000.1_6 Reverse -114 -128 -5.31028 0.273
NP_440605.1_5 Forward -372 -354 13.6872 0.145
NP_440605.1_6 Reverse -291 -310 17.436 0.265
NP_440147.1_4 Reverse -161 -174 6.1158 0.103
NP_440147.1_4 Forward -126 -113 0.707601 0.247
NP_441550.1_8 Forward -126 -116 15.5158 0.0132
NP_441550.1_8 Reverse -113 -123 15.2208 0.0132
NP_441550.1_8 Forward -366 -356 7.45273 0.159
NP_441916.1_10 Reverse -170 -189 4.52268 0.223
NP_441916.1_10 Reverse -141 -160 0.491109 0.281
NP_441041.1_4 Forward -158 -139 -12.5869 0.269
NP_441041.1_7 Reverse -112 -124 9.55551 0.109
NP_442396.1_5 Forward -247 -234 6.4108 0.238
NP_440569.1_10 Forward -51 -32 5.20389 0.24
NP_441547.1_2 Forward -135 -117 8.7706 0.212
NP_442004.1_6 Reverse -355 -369 1.17956 0.296
NP_441725.1_5 Forward -123 -113 7.05986 0.106
NP_441725.1_5 Forward -363 -353 -0.511621 0.26
NP_441725.1_5 Reverse -356 -366 -0.708283 0.267
NP_441725.1_5 Reverse -150 -160 -0.806614 0.271
NP_441725.1_5 Reverse -116 -126 -0.806614 0.271
NP_439966.1_7 Reverse -353 -363 10.206 0.0958
NP_439966.1_7 Reverse -113 -123 7.84605 0.149
NP_439966.1_7 Forward -126 -116 5.09279 0.243
NP_439966.1_7 Forward -366 -356 4.99446 0.248
NP_439966.1_9 Forward -366 -357 0.884706 0.253
NP_439966.1_9 Forward -126 -117 0.884706 0.253
NP_442941.1_3 Reverse -356 -366 1.25834 0.15
NP_442941.1_3 Reverse -116 -126 1.16001 0.15
NP_442941.1_3 Forward -157 -147 -1.29827 0.297
NP_440289.1_2 Reverse -112 -125 10.7374 0.0239
NP_440289.1_2 Reverse -352 -365 1.78924 0.115
NP_442281.1_1 Reverse -110 -124 7.66879 0.0949
NP_442281.1_1 Forward -163 -149 3.24392 0.238
NP_442901.1_4 Forward -184 -165 -1.18052 0.284
NP_442256.1_2 Reverse -113 -131 -7.35568 0.214
NP_440437.1_1 Reverse -143 -162 -4.42544 0.258
NP_442982.1_5 Forward -107 -88 -1.86883 0.273
NP_441644.1_6 Reverse -115 -125 14.4342 0.0126
NP_441644.1_6 Reverse -355 -365 5.87944 0.174
NP_443049.1_6 Forward -125 -115 14.4711 0.114
NP_441795.1_5 Forward -135 -116 7.66927 0.245
NP_442215.1_2 Forward -174 -158 -3.77637 0.222
NP_442215.1_2 Forward -126 -110 -6.13632 0.264
NP_442215.1_2 Forward -357 -341 -6.23465 0.266
NP_442029.1_1 Forward -366 -347 -9.53865 0.192
NP_440929.1_8 Reverse -115 -124 7.07956 0.0713
NP_442933.1_10 Forward -364 -355 5.40793 0.19
NP_441751.2_8 Reverse -356 -370 3.24451 0.0692
NP_442554.1_8 Reverse -356 -366 8.33817 0.0754
NP_442554.1_8 Reverse -116 -126 8.23984 0.0776
NP_442554.1_8 Forward -123 -113 5.09324 0.161
NP_442554.1_8 Reverse -164 -174 2.7333 0.259
NP_442970.1_1 Forward -50 -36 10.3247 0.269
NP_441762.1_7 Forward -365 -353 -4.87757 0.183
NP_441762.1_7 Forward -125 -113 -5.07423 0.187
NP_441762.1_7 Reverse -354 -366 -5.36923 0.203
NP_441762.1_7 Reverse -114 -126 -6.05754 0.268
NP_442142.1_4 Reverse -352 -365 10.9334 0.0646
NP_442142.1_4 Reverse -112 -125 6.0169 0.175
NP_442292.1_1 Reverse -356 -365 8.75118 0.0306
NP_442292.1_1 Reverse -116 -125 8.65285 0.0335
NP_442476.1_3 Reverse -151 -170 10.8159 0.214
NP_440895.1_10 Reverse -354 -371 -5.46769 0.29
NP_443009.1_5 Forward -159 -148 6.84301 0.147
NP_441198.1_8 Forward -160 -150 15.3222 0.0427
NP_441468.1_1 Reverse -356 -363 6.13563 0.209
NP_441468.1_1 Forward -123 -116 6.13563 0.209
NP_441468.1_1 Reverse -116 -123 6.0373 0.223
NP_441468.1_1 Forward -363 -356 6.0373 0.223
NP_439939.1_4 Forward -45 -26 3.04771 0.199
NP_441015.1_10 Forward -369 -350 -2.45882 0.178
NP_441015.1_10 Forward -129 -110 -10.227 0.283
NP_441673.1_1 Forward -124 -115 1.37636 0.114
NP_441673.1_1 Forward -364 -355 1.27803 0.155
NP_441673.1_1 Reverse -355 -364 1.27803 0.155
NP_441673.1_1 Reverse -115 -124 1.1797 0.163
NP_441731.1_3 Forward -132 -113 -5.80207 0.29
NP_441426.1_4 Forward -167 -148 2.0644 0.292
NP_441826.1_2 Forward -370 -356 5.99778 0.0946
NP_441826.1_2 Reverse -349 -363 -2.36035 0.271
NP_441826.1_2 Reverse -355 -369 -3.24533 0.284
NP_441826.1_2 Reverse -143 -157 -3.63866 0.286
NP_441826.1_2 Forward -164 -150 -4.22864 0.293
NP_441393.1_9 Reverse -186 -205 18.0727 0.266
NP_442868.1_6 Forward -126 -116 7.74818 0.0697
NP_442868.1_6 Forward -366 -356 7.64985 0.0726
NP_442868.1_6 Reverse -113 -123 6.66654 0.103
NP_442868.1_6 Forward -160 -150 4.10993 0.186
NP_442719.1_2 Forward -50 -32 -2.53818 0.19
NP_442719.1_2 Forward -193 -175 -8.14302 0.242
NP_442719.1_2 Forward -51 -33 -10.1096 0.269
NP_442719.1_2 Forward -61 -43 -10.208 0.271
NP_441056.1_1 Reverse -355 -374 -7.96535 0.282
NP_441056.1_1 Reverse -349 -368 -8.45701 0.282
NP_441612.1_2 Forward -341 -331 8.45247 0.214
NP_443058.1_7 Forward -153 -134 4.42435 0.258
NP_442427.1_8 Reverse -106 -125 10.4225 0.165
NP_442808.1_1 Reverse -354 -364 17.5808 0.00507
NP_442808.1_1 Reverse -114 -124 9.71433 0.0481
NP_442808.1_1 Reverse -251 -261 3.8145 0.222
NP_442808.1_1 Reverse -70 -80 1.35624 0.287
NP_440145.1_3 Forward -374 -355 -4.42544 0.231
NP_442542.1_2 Reverse -113 -126 6.70579 0.211
NP_442050.1_5 Reverse -113 -123 11.7793 0.0832
NP_442342.1_9 Forward -174 -158 6.45005 0.218
NP_442342.1_9 Reverse -113 -129 5.95839 0.232
NP_441878.1_6 Reverse -162 -172 0.766681 0.134
NP_441878.1_6 Forward -173 -163 0.57002 0.14
NP_441878.1_6 Reverse -114 -124 0.57002 0.14
NP_441878.1_6 Reverse -345 -355 -7.29646 0.217
NP_441036.1_8 Reverse -354 -364 13.8447 0.0353
NP_442650.1_2 Forward -158 -144 12.4876 0.13
NP_442650.1_2 Reverse -355 -369 2.75286 0.246
NP_441557.1_5 Forward -124 -115 1.08137 0.0794
NP_441557.1_5 Forward -364 -355 0.983037 0.0911
NP_441557.1_5 Reverse -355 -364 0.688044 0.128
NP_441557.1_5 Reverse -115 -124 0.589713 0.134
NP_441445.1_1 Forward -133 -114 11.4058 0.0853
NP_442066.2_4 Reverse -355 -374 -6.58872 0.253
NP_442066.2_9 Reverse -111 -124 7.09911 0.247
NP_441308.1_8 Forward -160 -150 8.92815 0.24
NP_441308.1_8 Reverse -147 -157 8.23984 0.269
NP_442183.1_1 Forward -364 -350 9.04604 0.103
NP_442183.1_1 Forward -124 -110 7.66941 0.134
NP_442166.1_1 Reverse -363 -382 1.86774 0.193
NP_441773.1_6 Reverse -31 -45 21.1407 0.0728
NP_441819.1_5 Reverse -32 -51 14.3711 0.195
NP_441819.1_5 Forward -55 -36 13.9891 0.195
NP_441819.1_5 Reverse -2 -21 9.59652 0.262
NP_442347.1_2 Reverse -116 -125 10.3245 0.058
NP_442347.1_2 Forward -157 -148 6.39124 0.17
NP_442347.1_2 Reverse -356 -365 3.93297 0.284
NP_442645.1_2 Reverse -225 -244 -16.9135 0.245
NP_442888.1_9 Reverse -355 -374 15.1424 0.198
NP_441037.1_4 Forward -366 -356 8.48718 0.237
NP_441037.1_4 Forward -160 -150 7.02532 0.237
NP_441633.1_3 Reverse -147 -160 -4.01229 0.179
NP_441633.1_3 Forward -126 -113 -6.2739 0.242
NP_440136.1_2 Forward -123 -116 6.23397 0.171
NP_440136.1_2 Reverse -356 -363 6.23397 0.171
NP_440136.1_2 Forward -363 -356 6.13563 0.193
NP_440136.1_2 Reverse -116 -123 6.13563 0.193
NP_442998.1_10 Reverse -357 -364 15.5754 0.0102
NP_442998.1_10 Reverse -117 -124 15.5754 0.0102
NP_440299.1_1 Reverse -351 -364 5.72191 0.166
NP_440299.1_6 Forward -365 -346 12.4875 0.201
NP_441799.1_1 Reverse -111 -125 6.58715 0.167
NP_441007.1_10 Forward -369 -356 9.85238 0.083
NP_441007.1_10 Reverse -110 -123 8.86907 0.108
NP_440256.1_1 Forward -367 -348 -2.0655 0.112
NP_442007.1_8 Forward -125 -107 9.06482 0.293
NP_441559.1_8 Reverse -57 -71 -7.17857 0.287
NP_441559.1_8 Forward -267 -253 -7.2769 0.289
NP_440915.1_6 Forward -128 -114 11.7993 0.0243
NP_440915.1_6 Forward -368 -354 3.63784 0.101
NP_440915.1_6 Forward -162 -148 1.08123 0.147
NP_440915.1_6 Reverse -145 -159 -3.34366 0.293
NP_442158.1_4 Forward -182 -172 14.533 0.176
NP_440717.1_3 Reverse -152 -166 21.8284 0.043
NP_442452.1_8 Reverse -115 -129 13.4703 0.273
NP_442866.1_1 Forward -317 -298 -5.01543 0.239
NP_440787.1_5 Reverse -177 -191 9.93102 0.256
NP_441199.1_6 Reverse -351 -370 13.7658 0.0437
NP_440677.1_1 Forward -224 -205 6.19431 0.278
NP_442386.1_9 Reverse -148 -157 8.2591 0.205
NP_442386.1_9 Reverse -354 -363 8.06244 0.209
NP_442386.1_9 Reverse -198 -207 4.52254 0.297
NP_442386.1_9 Reverse -114 -123 4.52254 0.297
NP_440570.1_4 Forward -173 -155 2.18243 0.238
NP_440570.1_5 Forward -114 -95 -3.93378 0.298
NP_441750.1_1 Forward -370 -351 -12.4886 0.3
NP_441750.1_4 Reverse -145 -164 6.88262 0.159
NP_441340.1_5 Forward -123 -116 13.5105 0.0314
NP_441340.1_5 Forward -363 -356 6.13563 0.175
NP_441340.1_5 Reverse -356 -363 5.93897 0.198
NP_441340.1_5 Reverse -116 -123 5.84064 0.208
NP_441340.1_9 Reverse -41 -51 7.29115 0.289
NP_441340.1_9 Forward -16 -6 7.29115 0.289
NP_441947.1_10 Reverse -353 -371 0.904127 0.276
NP_442791.1_5 Reverse -354 -373 -11.6036 0.29
NP_440168.1_9 Reverse -344 -363 -5.9004 0.296
NP_442506.1_2 Reverse -132 -151 5.70265 0.269
NP_442240.1_1 Reverse -141 -160 3.34192 0.29
NP_440586.1_8 Forward -363 -356 11.4451 0.0645
NP_440586.1_8 Reverse -116 -123 9.47853 0.146
NP_440586.1_8 Forward -123 -116 5.74197 0.283
NP_442251.1_6 Reverse -356 -363 12.0355 0.0627
NP_440684.1_9 Forward -370 -356 7.76774 0.253
NP_441262.1_3 Forward -364 -357 14.7888 0.0223
NP_441262.1_3 Forward -124 -117 14.7888 0.0223
NP_440027.1_3 Reverse -115 -133 10.2448 0.175
NP_440027.1_3 Forward -242 -224 5.52492 0.24
NP_440027.1_3 Reverse -352 -370 3.65664 0.267
NP_443051.1_1 Forward -125 -116 7.47288 0.0571
NP_443051.1_1 Forward -365 -356 0.786375 0.125
NP_443051.1_1 Reverse -114 -123 -1.18024 0.297
NP_439937.1_8 Forward -366 -347 -3.14714 0.265
NP_439937.1_8 Reverse -347 -366 -4.81876 0.286
NP_439937.1_9 Reverse -114 -131 19.5076 0.00778
NP_439937.1_9 Reverse -162 -179 -8.31994 0.176
NP_440439.1_1 Forward -127 -114 2.37923 0.135
NP_440372.1_2 Forward -123 -116 13.8055 0.0214
NP_440372.1_2 Forward -363 -356 6.72562 0.0929
NP_440372.1_2 Reverse -356 -363 6.62729 0.151
NP_440372.1_2 Reverse -116 -123 6.52896 0.188
NP_441789.1_7 Forward -399 -380 -3.04956 0.268
NP_440819.1_5 Forward -201 -193 6.41093 0.285
NP_440316.1_10 Forward -371 -361 14.533 0.194
NP_441803.1_2 Reverse -144 -163 7.27595 0.141
NP_441803.1_2 Reverse -350 -369 2.3594 0.213
NP_439977.1_5 Reverse -109 -128 -1.86883 0.263
NP_440139.1_1 Reverse -349 -368 3.53858 0.202
NP_440210.1_8 Reverse -355 -371 15.6932 0.17
NP_441572.1_7 Reverse -109 -128 -4.72043 0.243
NP_440267.1_2 Reverse -57 -71 6.78381 0.221
NP_442384.1_10 Forward -172 -159 3.16588 0.199
NP_442384.1_10 Reverse -115 -128 0.805932 0.278
NP_442339.1_1 Reverse -43 -62 13.7649 0.204
NP_442114.1_4 Reverse -355 -366 8.02348 0.227
NP_441877.1_7 Reverse -350 -369 7.57013 0.218
NP_441877.1_9 Reverse -30 -47 2.00546 0.292
NP_441018.1_7 Forward -368 -349 7.7676 0.265
NP_442790.1_4 Forward -133 -114 -9.24366 0.182
NP_442262.1_2 Reverse -163 -182 16.6971 0.247
NP_442262.1_10 Reverse -116 -123 13.2155 0.0213
NP_440344.1_10 Reverse -348 -365 9.87194 0.00789
NP_440344.1_10 Reverse -108 -125 0.432165 0.0358
NP_440344.1_10 Forward -165 -148 -5.27103 0.105
NP_440344.1_10 Reverse -192 -209 -11.6625 0.223
NP_441060.1_3 Forward -329 -310 10.5209 0.218
NP_441060.1_4 Forward -204 -186 7.29564 0.222
NP_441060.1_4 Reverse -167 -185 4.44404 0.252
NP_441335.1_8 Forward -176 -157 7.07928 0.281
NP_440562.1_3 Reverse -150 -167 9.57695 0.15
NP_441965.1_3 Forward -374 -355 6.19431 0.149
NP_441965.1_3 Forward -134 -115 -0.000545616 0.244
NP_441640.1_8 Reverse -116 -135 -4.52377 0.266
NP_442693.1_8 Forward -347 -328 13.47 0.253
NP_442556.1_10 Reverse -98 -117 9.59474 0.277
NP_442187.1_3 Forward -365 -355 16.893 0.0619
NP_442187.1_3 Forward -125 -115 15.6147 0.105
NP_440894.1_10 Reverse -350 -369 10.7175 0.155
NP_440894.1_10 Reverse -110 -129 8.45592 0.176
NP_440999.1_9 Reverse -351 -365 2.45787 0.149
NP_440999.1_9 Reverse -111 -125 1.08123 0.171
NP_440888.1_2 Reverse -115 -129 15.9285 0.00837
NP_440888.1_2 Reverse -355 -369 8.65209 0.152
NP_440888.1_2 Reverse -361 -375 6.48882 0.232
NP_440491.1_1 Reverse -352 -371 14.8111 0.097
NP_441268.1_1 Reverse -38 -57 12.3658 0.261
NP_442948.1_2 Forward -365 -346 8.55425 0.192
NP_442033.1_10 Reverse -113 -132 3.04771 0.0873
NP_440575.1_1 Reverse -267 -286 -2.45958 0.294
NP_442077.1_9 Forward -190 -171 0.786102 0.218
NP_442077.1_9 Reverse -181 -200 -3.44213 0.22
NP_441543.1_2 Reverse -356 -365 7.17789 0.131
NP_441543.1_2 Reverse -116 -125 7.07956 0.131
NP_442845.1_2 Forward -130 -116 12.3893 0.112
NP_442845.1_2 Forward -370 -356 7.57108 0.195
NP_442845.1_2 Reverse -143 -157 5.50613 0.231
NP_442845.1_2 Forward -172 -158 4.22782 0.264
NP_440722.1_2 Reverse -363 -382 1.86774 0.138
NP_441469.1_8 Reverse -354 -363 5.70292 0.257
NP_442315.1_2 Forward -248 -236 14.592 0.27
NP_443064.1_6 Reverse -355 -365 8.39772 0.292
NP_442337.1_8 Forward -67 -48 0.392778 0.252
NP_442578.1_7 Forward -123 -116 6.0373 0.18
NP_442578.1_7 Forward -363 -356 5.93897 0.183
NP_441462.1_2 Forward -124 -114 16.1063 0.00406
NP_441462.1_2 Forward -364 -354 -0.118297 0.184
NP_441621.1_7 Reverse -113 -127 -4.91696 0.248
NP_442204.1_1 Forward -128 -117 0.648657 0.281
NP_442780.1_3 Reverse -2 -21 7.4002 0.269
NP_440516.1_8 Forward -124 -115 18.9776 0.00442
NP_440516.1_8 Forward -364 -355 17.6993 0.00442
NP_440516.1_8 Reverse -115 -124 5.01461 0.118
NP_442428.1_5 Reverse -356 -363 6.13563 0.209
NP_442428.1_5 Forward -123 -116 6.13563 0.209
NP_442428.1_5 Forward -363 -356 6.0373 0.212
NP_442428.1_5 Reverse -116 -123 6.0373 0.212
NP_442428.1_7 Reverse -32 -51 7.96426 0.231
NP_441032.1_5 Reverse -346 -365 10.9142 0.245
NP_441443.1_7 Forward -367 -348 7.07928 0.158
NP_442823.1_9 Reverse -36 -55 16.3987 0.196
NP_440673.1_2 Forward -374 -355 9.90183 0.228
NP_440673.1_3 Reverse -357 -364 12.4288 0.0426
NP_440673.1_3 Reverse -117 -124 12.4288 0.0426
NP_440865.1_9 Forward -370 -351 -6.09707 0.22
NP_441052.1_2 Reverse -355 -365 10.7964 0.0285
NP_441052.1_2 Reverse -115 -125 10.6981 0.0285
NP_441052.1_2 Reverse -62 -72 2.92996 0.187
NP_441052.1_2 Reverse -346 -356 0.963343 0.255
NP_442219.1_8 Reverse -351 -370 15.0281 0.121
NP_442219.1_8 Reverse -223 -242 6.33108 0.3
NP_442219.1_9 Reverse -356 -365 8.06287 0.0696
NP_442219.1_9 Reverse -116 -125 7.96454 0.0696
NP_440436.1_4 Reverse -356 -365 13.9623 0.0193
NP_440436.1_4 Reverse -116 -125 7.57079 0.124
NP_440436.1_4 Forward -363 -354 5.80084 0.182
NP_441884.1_9 Forward -367 -348 -13.1769 0.138
NP_441884.1_9 Reverse -112 -131 -14.0619 0.138
NP_442086.1_6 Forward -110 -91 9.83255 0.273
NP_441719.1_4 Forward -123 -116 6.82395 0.0855
NP_441719.1_4 Forward -363 -356 6.72562 0.093
NP_441719.1_4 Reverse -356 -363 6.62729 0.151
NP_441719.1_4 Reverse -116 -123 6.52896 0.188
NP_441733.1_10 Forward -367 -354 12.704 0.106
NP_441733.1_10 Forward -127 -114 9.55739 0.113
NP_441733.1_10 Reverse -146 -159 3.5592 0.295
NP_440746.1_1 Forward -363 -344 15.0441 0.157
NP_441004.1_1 Forward -370 -351 -2.95047 0.15
NP_441004.1_1 Forward -178 -159 -15.5368 0.275
NP_441004.1_4 Forward -175 -165 7.94484 0.282
NP_442813.1_4 Forward -270 -251 -2.95047 0.287
NP_442813.1_4 Forward -142 -123 -3.54046 0.292
NP_443054.1_2 Reverse -147 -161 5.1128 0.24
NP_443054.1_2 Forward -161 -147 3.14618 0.24
NP_442430.1_2 Forward -365 -346 1.0811 0.285
NP_442430.1_10 Forward -374 -355 9.53674 0.287
NP_441851.1_10 Forward -159 -149 14.1397 0.0219
NP_441851.1_10 Reverse -148 -158 11.0914 0.0806
NP_441851.1_10 Forward -244 -234 6.17489 0.182
NP_442011.1_1 Forward -125 -106 -2.26216 0.272
NP_441668.1_4 Reverse -43 -62 -1.96717 0.285
NP_442515.1_1 Forward -125 -111 -2.85201 0.281
NP_440593.1_3 Reverse -110 -129 -6.68705 0.28
NP_442689.1_8 Reverse -7 -24 16.6568 0.0656
NP_442689.1_8 Forward -50 -33 5.15205 0.155
NP_442689.1_8 Reverse -37 -54 -7.43431 0.292
NP_441349.1_10 Forward -134 -115 -7.37537 0.248
NP_441409.1_6 Reverse -349 -368 -0.39387 0.0692
NP_441409.1_6 Reverse -89 -108 -7.4737 0.151
NP_440389.1_5 Reverse -39 -58 15.4039 0.195
NP_440432.1_2 Reverse -143 -162 -3.83545 0.268
NP_442843.1_1 Forward -192 -173 -6.29373 0.244
NP_441124.1_5 Forward -46 -36 12.8172 0.215
NP_441124.1_5 Reverse -40 -50 9.95241 0.299
NP_440431.1_3 Reverse -5 -24 -8.55534 0.235
NP_442450.1_3 Reverse -34 -52 9.06482 0.207
NP_440588.1_2 Forward -133 -114 -5.11376 0.24
NP_442006.1_2 Forward -208 -191 -8.51595 0.197
NP_442006.1_2 Forward -166 -149 -15.6941 0.228
NP_441003.1_9 Reverse -154 -173 10.9142 0.213
NP_441003.1_9 Forward -119 -100 3.6377 0.291
NP_442038.1_1 Reverse -7 -26 18.7807 0.0295
NP_441570.1_1 Forward -364 -346 -6.86402 0.0823
NP_441570.1_1 Forward -370 -352 -9.71562 0.146
NP_440078.1_10 Forward -158 -139 12.7825 0.155
NP_441078.1_4 Forward -124 -115 0.196389 0.205
NP_441078.1_4 Reverse -355 -364 0.0980582 0.205
NP_441078.1_4 Forward -364 -355 0.0980582 0.205
NP_441078.1_4 Reverse -115 -124 -0.000272808 0.205
NP_442729.1_5 Forward -365 -355 8.1415 0.248
NP_442729.1_5 Forward -105 -95 7.55152 0.29
NP_442729.1_8 Forward -162 -149 9.55739 0.125
NP_442443.1_1 Reverse -366 -385 -5.9004 0.287
NP_442443.1_1 Forward -269 -250 -6.1954 0.293
NP_440526.1_3 Reverse -356 -367 17.1677 0.052
NP_440526.1_3 Reverse -150 -161 10.5796 0.0646
NP_440526.1_3 Forward -123 -112 2.22148 0.267
NP_440526.1_3 Reverse -116 -127 1.04151 0.267
NP_441432.1_8 Forward -125 -116 14.0611 0.0258
NP_441432.1_8 Forward -365 -356 7.17789 0.102
NP_441432.1_8 Forward -371 -362 5.80125 0.137
NP_442320.1_4 Forward -381 -362 17.9932 0.266
NP_442320.1_8 Forward -370 -356 5.70279 0.0334
NP_442320.1_8 Forward -130 -116 -2.45868 0.0894
NP_442320.1_8 Reverse -349 -363 -4.32697 0.159
NP_441732.1_2 Reverse -351 -367 -7.90627 0.0983
NP_440629.1_4 Reverse -164 -183 12.4875 0.217
NP_440629.1_4 Reverse -241 -260 9.24257 0.255
NP_442815.1_6 Reverse -157 -176 16.8141 0.177
NP_442797.1_7 Reverse -142 -160 3.75572 0.234
NP_442797.1_7 Reverse -354 -372 -0.7675 0.287
NP_442797.1_7 Reverse -114 -132 -1.25915 0.294
NP_440199.1_10 Forward -367 -357 7.35486 0.231
NP_441057.1_4 Forward -365 -347 -4.20908 0.299
NP_440713.1_4 Forward -134 -115 8.94757 0.158
NP_442489.1_7 Reverse -355 -364 0.786375 0.152
NP_442489.1_7 Forward -124 -115 0.688044 0.152
NP_442489.1_7 Reverse -115 -124 0.688044 0.152
NP_442489.1_7 Forward -364 -355 0.589713 0.17
NP_441452.1_1 Forward -233 -214 12.5858 0.292
NP_440559.1_1 Reverse -356 -365 14.1594 0.0317
NP_440559.1_1 Reverse -116 -125 7.76787 0.0918
NP_440559.1_1 Forward -123 -114 6.39124 0.134
NP_441659.2_8 Reverse -115 -125 5.48657 0.106
NP_441659.2_8 Forward -124 -114 0.275027 0.27
NP_441022.1_1 Forward -43 -34 15.9587 0.163
NP_441022.1_1 Forward -13 -4 15.0954 0.183
NP_442913.1_10 Forward -167 -148 0.491109 0.153
NP_442913.1_10 Reverse -106 -125 -3.54046 0.212
NP_442913.1_10 Reverse -337 -356 -6.29373 0.3
NP_439912.1_5 Forward -260 -241 10.7175 0.274
NP_441040.1_2 Forward -132 -113 2.65439 0.119
NP_440708.1_6 Reverse -191 -210 -6.78538 0.24
NP_442346.1_5 Forward -365 -355 6.8632 0.188
NP_442346.1_5 Reverse -345 -355 6.27322 0.208
NP_442346.1_5 Reverse -114 -124 4.3066 0.291
NP_440545.1_3 Forward -128 -111 -1.92778 0.177
NP_440545.1_3 Forward -368 -351 -4.77938 0.232
NP_440831.1_3 Forward -133 -114 4.54267 0.3
NP_440250.1_4 Forward -53 -34 3.73524 0.264
NP_440010.1_4 Reverse -351 -370 0.0970122 0.25
NP_440010.1_4 Reverse -345 -364 -0.39464 0.252
NP_442137.1_1 Reverse -148 -167 15.9291 0.0653
NP_442551.1_4 Forward -174 -159 -3.46169 0.29
NP_442603.1_7 Reverse -115 -129 16.2235 0.0337
NP_442603.1_7 Forward -124 -110 9.43874 0.146
NP_441585.1_5 Reverse -296 -315 8.16011 0.211
NP_441888.1_7 Reverse -350 -364 1.27789 0.258
NP_441888.1_9 Reverse -47 -66 15.1413 0.26
NP_443022.1_6 Reverse -105 -124 13.7658 0.197
NP_440449.1_6 Forward -180 -162 8.3531 0.201
NP_441833.1_4 Reverse -356 -363 14.1004 0.0258
NP_441833.1_4 Reverse -116 -123 6.52896 0.0924
NP_441833.1_4 Forward -123 -116 6.23397 0.163
NP_441833.1_4 Forward -363 -356 6.13563 0.198
NP_441329.1_3 Forward -48 -38 15.8708 0.231
NP_441329.1_3 Forward -19 -9 13.3642 0.265
NP_441329.1_3 Reverse -38 -48 13.075 0.266
NP_442162.1_9 Forward -123 -116 12.9205 0.0282
NP_442162.1_9 Reverse -116 -123 12.9205 0.0282
NP_442162.1_9 Reverse -356 -363 6.62729 0.142
NP_442162.1_9 Forward -363 -356 6.52896 0.178
NP_442162.1_10 Reverse -86 -105 17.3814 0.209
NP_440671.1_1 Reverse -30 -49 8.71507 0.204
NP_442404.1_9 Reverse -118 -132 11.7987 0.263
NP_443026.1_5 Forward -260 -241 0.884433 0.283
NP_442943.1_1 Reverse -35 -50 14.5901 0.081
NP_440830.1_3 Reverse -33 -52 26.0563 0.00299
NP_442199.1_7 Reverse -38 -57 2.35861 0.26
NP_442140.1_3 Reverse -116 -126 11.4848 0.0757
NP_442140.1_3 Forward -363 -353 8.63316 0.119
NP_442140.1_3 Forward -123 -113 7.35486 0.142
NP_442140.1_3 Reverse -356 -366 4.10993 0.261
NP_441609.1_1 Reverse -95 -114 10.0292 0.117
NP_441609.1_1 Reverse -35 -54 -2.26216 0.286
NP_440875.1_9 Reverse -357 -367 8.66404 0.233
NP_441813.1_5 Reverse -353 -363 7.64985 0.068
NP_441813.1_5 Reverse -113 -123 5.78156 0.109
NP_441227.1_1 Forward -395 -376 15.9291 0.0718
NP_441227.1_4 Forward -73 -54 19.0757 0.0494
NP_441227.1_5 Forward -135 -116 19.174 0.149
NP_441227.1_7 Forward -347 -328 14.6161 0.232
NP_440884.1_6 Forward -146 -127 14.8474 0.243
NP_442089.1_9 Reverse -321 -340 15.1424 0.26
NP_440590.1_4 Reverse -356 -369 18.2105 0.00851
NP_440590.1_4 Reverse -116 -129 13.6873 0.0128
NP_440590.1_4 Reverse -150 -163 1.59258 0.118
NP_440567.1_1 Forward -123 -109 9.2427 0.0471
NP_440567.1_1 Forward -363 -349 6.98109 0.0795
NP_440567.1_1 Reverse -356 -370 6.58777 0.0816
NP_440567.1_1 Reverse -116 -130 1.57289 0.2
NP_442497.1_10 Forward -123 -114 1.08137 0.115
NP_442497.1_10 Reverse -356 -365 0.688044 0.141
NP_442497.1_10 Reverse -116 -125 0.589713 0.153
NP_442497.1_10 Reverse -150 -159 0.29472 0.199
NP_440821.1_4 Forward -126 -116 8.23984 0.053
NP_440821.1_4 Forward -366 -356 8.1415 0.055
NP_440821.1_4 Reverse -113 -123 7.35486 0.072
NP_440821.1_4 Reverse -353 -363 6.96153 0.0781
NP_440821.1_4 Forward -160 -150 6.56821 0.0853
NP_440821.1_4 Reverse -147 -157 4.69992 0.126
NP_442707.1_2 Forward -28 -18 17.0896 0.251
NP_440227.1_2 Reverse -34 -50 11.2683 0.274
NP_441239.1_9 Reverse -113 -125 12.9203 0.0402
NP_441239.1_9 Forward -174 -162 7.21714 0.169
NP_441239.1_9 Reverse -353 -365 3.77555 0.276
NP_441239.1_9 Reverse -154 -166 3.67722 0.279
NP_441951.1_4 Forward -370 -351 1.27776 0.286
NP_442691.1_5 Reverse -179 -197 17.5129 0.262
NP_442568.1_1 Forward -60 -41 2.85027 0.267
NP_441727.1_3 Reverse -108 -127 10.7175 0.161
NP_441892.1_1 Reverse -154 -171 -4.97604 0.271
NP_442083.1_9 Forward -176 -157 12.9791 0.163
NP_442216.1_4 Reverse -235 -243 15.3586 0.255
NP_440876.1_5 Reverse -357 -376 18.4857 0.127
NP_440949.1_7 Reverse -347 -366 9.53674 0.261
NP_440354.1_7 Forward -370 -352 7.68896 0.26
NP_441617.1_6 Forward -51 -32 -7.67036 0.292
NP_442809.1_1 Reverse -186 -205 10.7167 0.295
NP_440546.1_4 Forward -124 -114 14.9908 0.0459
NP_440546.1_4 Forward -364 -354 11.0156 0.0991
NP_440462.1_6 Reverse -113 -123 6.46988 0.115
NP_440462.1_6 Reverse -353 -363 4.89658 0.18
NP_440868.1_4 Forward -128 -116 7.4138 0.0691
NP_440868.1_4 Reverse -351 -363 3.2839 0.137
NP_441204.1_1 Reverse -302 -321 5.01433 0.296
NP_442479.1_9 Reverse -4 -23 -7.4737 0.266
NP_442479.1_9 Forward -274 -255 -11.7019 0.275
NP_442479.1_9 Forward -195 -176 -13.1769 0.288
NP_442402.1_2 Forward -275 -261 16.5185 0.263
NP_442402.1_4 Forward -58 -39 0.392004 0.182
NP_442402.1_4 Forward -280 -261 -5.1145 0.236
NP_442402.1_4 Forward -57 -38 -9.34271 0.288
NP_442402.1_6 Reverse -260 -269 16.0277 0.241
NP_442402.1_10 Forward -271 -261 11.9759 0.23
NP_441848.1_4 Reverse -35 -51 17.9593 0.151
NP_441848.1_4 Forward -22 -6 8.50558 0.288
NP_441848.1_4 Forward -51 -35 8.12362 0.288
NP_440843.1_3 Reverse -36 -55 11.1109 0.211
NP_440843.1_3 Forward -260 -241 10.1275 0.255
NP_442039.1_4 Forward -123 -116 11.6422 0.0747
NP_442039.1_7 Reverse -49 -59 7.64985 0.273
NP_442039.1_10 Reverse -235 -253 12.2114 0.251
NP_440008.1_9 Reverse -143 -162 11.4058 0.202
NP_440825.1_6 Forward -314 -295 7.47261 0.285
NP_442837.1_3 Reverse -150 -157 9.47889 0.125
NP_442837.1_3 Forward -157 -150 9.47889 0.125
NP_442837.1_3 Reverse -356 -363 6.13563 0.25
NP_442837.1_3 Forward -123 -116 6.0373 0.25
NP_442837.1_3 Reverse -116 -123 6.0373 0.25
NP_442837.1_3 Forward -363 -356 5.93897 0.265
NP_440160.1_2 Reverse -88 -107 -2.75381 0.249
NP_440160.1_5 Reverse -66 -76 15.1225 0.267
NP_442053.1_1 Reverse -115 -124 14.4544 0.0114
NP_442053.1_1 Forward -124 -115 7.86621 0.0863
NP_442053.1_1 Forward -364 -355 7.76787 0.0895
NP_442053.1_1 Reverse -355 -364 7.17789 0.104
NP_440505.1_3 Forward -366 -356 15.3197 0.0131
NP_440505.1_3 Forward -126 -116 15.0247 0.0149
NP_440505.1_3 Forward -73 -63 4.79825 0.266
NP_440520.1_1 Forward -175 -156 -3.24547 0.208
NP_441252.1_6 Forward -245 -238 11.6422 0.288
NP_442532.1_7 Forward -364 -350 3.93283 0.182
NP_440914.1_1 Reverse -355 -365 13.4947 0.0297
NP_440914.1_1 Reverse -115 -125 13.1043 0.0386
NP_440914.1_1 Forward -158 -148 10.5669 0.132
NP_441011.1_8 Forward -123 -114 9.24284 0.131
NP_441011.1_8 Forward -363 -354 5.60459 0.247
NP_442931.1_8 Reverse -184 -203 3.04771 0.232
NP_442533.1_6 Reverse -115 -124 4.42462 0.179
NP_442533.1_6 Reverse -163 -172 4.22796 0.186
NP_442533.1_6 Forward -172 -163 3.7363 0.204
NP_442322.1_4 Reverse -299 -316 -9.89323 0.297
NP_439944.1_9 Reverse -356 -366 9.41981 0.1
NP_439944.1_9 Reverse -116 -126 9.32148 0.1
NP_441697.1_5 Forward -52 -33 -3.29489 0.217
NP_440116.1_8 Forward -123 -104 4.71934 0.0698
NP_440115.1_6 Forward -127 -117 17.9746 0.0163
NP_440115.1_6 Forward -367 -357 9.81313 0.115
NP_440007.1_9 Forward -162 -148 4.32615 0.267
NP_441602.1_3 Forward -129 -110 -1.86883 0.231
NP_441602.1_3 Reverse -144 -163 -5.9004 0.3
NP_441972.1_5 Forward -336 -317 2.75272 0.121
NP_441972.1_5 Reverse -116 -135 -7.76869 0.252
NP_441106.1_1 Reverse -354 -363 5.70292 0.131
NP_441420.1_1 Forward -125 -106 -3.83545 0.292
NP_441286.1_1 Forward -125 -113 13.8053 0.00558
NP_441286.1_1 Forward -365 -353 10.9537 0.0145
NP_441286.1_1 Reverse -148 -160 3.38223 0.0467
NP_441286.1_1 Reverse -354 -366 -6.84419 0.283
NP_441286.1_1 Reverse -114 -126 -6.84419 0.283
NP_442674.1_2 Forward -189 -170 8.55425 0.25
NP_440670.1_8 Forward -124 -115 8.75118 0.0606
NP_440670.1_8 Reverse -355 -364 6.8829 0.0907
NP_440670.1_8 Reverse -115 -124 6.19458 0.124
NP_440886.1_7 Reverse -354 -364 8.53436 0.0805
NP_440886.1_7 Reverse -114 -124 6.76441 0.114
NP_440197.1_8 Forward -333 -314 17.699 0.1
NP_442614.1_2 Forward -124 -110 16.4209 0.0675
NP_442072.1_9 Reverse -354 -372 -13.0589 0.098
NP_442072.1_9 Forward -159 -141 -22.4003 0.234
NP_441753.1_10 Forward -346 -327 0.786102 0.287
NP_440907.2_8 Reverse -150 -160 15.5158 0.0193
NP_440907.2_8 Reverse -116 -126 9.12434 0.113
NP_442264.1_2 Forward -374 -357 7.80699 0.228
NP_441021.1_1 Reverse -356 -375 2.3594 0.083
NP_441463.1_3 Reverse -351 -370 -3.93378 0.189
NP_441626.1_2 Forward -123 -116 12.2322 0.0511
NP_441626.1_2 Forward -363 -356 6.0373 0.212
NP_441626.1_2 Reverse -356 -363 6.0373 0.212
NP_441626.1_2 Reverse -116 -123 5.93897 0.231
NP_442615.1_1 Forward -133 -115 -5.58572 0.217
NP_442615.1_1 Reverse -106 -124 -7.25734 0.283
NP_441962.1_4 Forward -369 -350 -6.68705 0.18
NP_441962.1_4 Forward -129 -110 -14.3569 0.286
NP_441962.1_5 Reverse -152 -171 7.7676 0.236
NP_440387.1_1 Reverse -355 -371 -4.1697 0.178
NP_440855.1_5 Forward -168 -149 7.76679 0.285
NP_441431.1_2 Reverse -112 -126 8.94708 0.2
NP_441488.1_8 Forward -129 -115 10.2254 0.146
NP_441836.1_1 Forward -375 -356 13.9343 0.209
NP_441836.1_2 Forward -127 -108 -2.36049 0.229
NP_441193.1_3 Forward -145 -131 17.5025 0.263
NP_440358.1_8 Forward -97 -78 -0.197208 0.263
NP_440114.1_10 Forward -124 -110 14.1593 0.0429
NP_440114.1_10 Forward -152 -138 9.04604 0.186
NP_442323.1_7 Reverse -144 -163 6.98015 0.19
NP_440311.1_2 Forward -115 -96 14.6508 0.283
NP_441272.1_4 Forward -373 -354 14.8474 0.103
NP_441272.1_7 Forward -133 -123 13.8447 0.257
NP_440766.1_4 Forward -128 -114 18.9775 0.0255
NP_440766.1_4 Forward -368 -354 12.1926 0.0568
NP_441237.1_9 Forward -123 -113 14.1397 0.0488
NP_441237.1_9 Reverse -356 -366 10.5998 0.224
NP_442867.1_8 Reverse -192 -211 4.71934 0.277
NP_440457.1_1 Forward -128 -116 9.47875 0.0927
NP_440457.1_1 Forward -162 -150 2.79224 0.205
NP_440942.1_3 Reverse -96 -115 2.16274 0.298
NP_441984.1_1 Forward -370 -352 9.95058 0.214
NP_441889.1_7 Forward -115 -97 12.8022 0.296
NP_442509.1_9 Forward -124 -114 13.1559 0.061
NP_442509.1_9 Reverse -149 -159 11.091 0.147
NP_442936.1_10 Reverse -265 -279 8.21112 0.269
NP_440554.1_4 Reverse -116 -126 3.42162 0.23
NP_442862.1_3 Reverse -306 -323 10.8552 0.202
NP_442862.1_3 Reverse -36 -53 8.7903 0.236
NP_442862.1_3 Forward -51 -34 7.217 0.258
NP_442862.1_3 Reverse -375 -392 6.62702 0.263
NP_442737.1_5 Forward -365 -346 12.9759 0.253
NP_441885.1_5 Reverse -355 -365 1.35667 0.11
NP_441885.1_5 Reverse -115 -125 1.25834 0.11
NP_441885.1_5 Forward -124 -114 -0.0199663 0.186
NP_441885.1_5 Forward -158 -148 -0.216628 0.189
NP_441275.1_5 Reverse -237 -256 11.995 0.285
NP_442341.1_7 Reverse -114 -128 7.86607 0.0985
NP_442341.1_7 Forward -338 -324 4.12949 0.2
NP_442341.1_7 Reverse -354 -368 3.34284 0.227
NP_442341.1_7 Forward -125 -111 2.16287 0.267
NP_442341.1_7 Reverse -162 -176 1.86788 0.278
NP_441173.1_9 Forward -18 -10 9.85212 0.275
NP_442395.2_4 Reverse -240 -259 0.588665 0.264
NP_440191.1_2 Forward -58 -39 -1.8696 0.289
NP_440423.1_6 Forward -372 -353 -19.7651 0.244
NP_443000.1_7 Forward -126 -116 0.668351 0.293
NP_443000.1_7 Forward -366 -356 0.57002 0.294
NP_441842.1_1 Reverse -117 -130 18.7999 0.0142
NP_441842.1_3 Forward -121 -103 16.6371 0.193
NP_441842.1_10 Forward -131 -117 9.83269 0.182
NP_440275.1_3 Forward -126 -116 15.123 0.0182
NP_440275.1_3 Forward -366 -356 8.04317 0.0602
NP_440275.1_3 Reverse -347 -357 4.50326 0.188
NP_440275.1_3 Reverse -113 -123 1.25834 0.291
NP_440091.1_1 Reverse -345 -357 4.8572 0.134
NP_440091.1_1 Forward -368 -356 0.923956 0.225
NP_440091.1_1 Reverse -351 -363 -0.452677 0.273
NP_442354.1_8 Forward -392 -373 6.58763 0.266
NP_443010.1_10 Forward -127 -110 6.15298 0.192
NP_441389.1_5 Forward -117 -98 13.7658 0.219
NP_440175.1_4 Forward -174 -155 -4.6221 0.146
NP_442495.1_4 Forward -168 -158 11.2881 0.28
NP_442214.1_7 Reverse -7 -26 21.0909 0.0818
NP_441105.1_3 Forward -109 -90 -2.0655 0.156
NP_441105.1_3 Forward -375 -356 -4.32711 0.198
NP_441105.1_3 Forward -135 -116 -7.57203 0.255
NP_440216.1_1 Forward -124 -110 -11.2101 0.169
NP_440172.1_1 Forward -124 -114 7.55152 0.0761
NP_440172.1_1 Reverse -115 -125 2.24165 0.279
NP_442015.1_10 Reverse -145 -158 9.2624 0.0515
NP_442015.1_10 Reverse -351 -364 2.96921 0.187
NP_441226.1_7 Forward -123 -116 12.7234 0.0312
NP_441226.1_7 Reverse -116 -123 11.5435 0.0757
NP_441226.1_7 Forward -207 -200 8.29857 0.205
NP_442446.1_5 Reverse -357 -376 8.16093 0.178
NP_441111.1_7 Reverse -356 -364 8.96754 0.0463
NP_441111.1_7 Reverse -116 -124 8.86921 0.0589
NP_442379.1_10 Forward -371 -354 4.16874 0.156
NP_441766.1_2 Reverse -115 -124 14.7494 0.00772
NP_441766.1_2 Reverse -355 -364 8.65285 0.0495
NP_440416.1_9 Reverse -142 -161 -16.7168 0.22
NP_443052.1_8 Reverse -345 -364 -11.8003 0.237
NP_442116.1_6 Reverse -35 -52 19.055 0.0788
NP_442116.1_6 Forward -51 -34 9.88781 0.227
NP_442116.1_6 Forward -22 -5 9.12387 0.235
NP_442116.1_6 Forward -52 -35 9.02838 0.235
NP_442116.1_6 Reverse -36 -53 7.596 0.254
NP_442116.1_6 Reverse -34 -51 7.40502 0.258
NP_442116.1_6 Forward -23 -6 5.97264 0.289
NP_442403.1_9 Forward -367 -348 5.80098 0.211
NP_442154.1_1 Forward -314 -296 -19.0571 0.289
NP_440261.1_5 Forward -123 -110 -1.35735 0.0733
NP_440261.1_5 Reverse -116 -129 -4.89726 0.178
NP_440261.1_5 Reverse -150 -163 -10.8955 0.221
NP_440988.1_10 Reverse -113 -127 9.93309 0.19
NP_440988.1_10 Reverse -119 -133 8.57771 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACCTGAACCGCTTCTGCGCCAACTTTTAAGGCAGTGGCGATCGTGGTCGTAGCCCGTAGGACATCAATAACCACGGCACAGTCAGGCAAGGATTGATCTGGTGTTAATTCCGGCGTGTGATAAACAAAGATTTCCACAGGATTTGGCGGATTGTTTGGGGAATGAACAACCCTCCCATCTTATCGGTAGTGGGCCAACCCGGAAGAAGAATTGGCCAATTTTTCTGGGCTCATGGCCCAGGGGGGATCCCAATGGGCTTTAAACTGGTTTTCGGTGGCGATCGGGCCTAGAACCTGGCCAAAGTGCTGGACCTTAACTAAGCGTTGCTGGGAATAACCTGGTTTGCCAAAGTTTTTCAAAAATTTTCGTTTGTCCTAGATTTTTAGCAAAAGTTTTCCC

CDS

ATGGCAATGTCAACTCCGGAGGTGACTCCCACTTTAAGCGATAGTAATGGCAATGAAGCCGGTGTCCAAACCCAATTTACTATCCAGGAAATTAGTGATTTACTGCCCCACCGTTACCCCTTCGCCTTGGTGGACCGCATCATTGATTTTCAACCGGGTAAATGCGCCGTTGGCCTAAAGAATGTCACCATCAACGAACCGTTTTTTCCCGGCCATATTCCCGATCGCCCGATTATGCCGGGGGTGTTAATTGTGGAATCCATGGCCCAGGTGGGGGGAGTGATTTTGACCCAACTGCCGGGGATGCGGGGTAAATTCTTCGCCTTTGCTGGCATTGATGGGGTGCGGTTCCGGCGGCCAGTGGTGCCTGGGGATCAGCTAATTATGACAGTGGAATTACAATCCTTTAAACTGCAACGCATTGCCAAAATGCAAGGGGAAGCTAGGGTCGATGGACAACTGGTTTGTGGGGGGGAAATGCTCTTTTCCCTAATTGATTAG

Protein

MAMSTPEVTPTLSDSNGNEAGVQTQFTIQEISDLLPHRYPFALVDRIIDFQPGKCAVGLKNVTINEPFFPGHIPDRPIMPGVLIVESMAQVGGVILTQLPGMRGKFFAFAGIDGVRFRRPVVPGDQLIMTVELQSFKLQRIAKMQGEARVDGQLVCGGEMLFSLID