Your browser is old and dusty. Try Google Chrome!

Details for sll1600

ORF sll1600
Accession NP_441237.1
Symbol mntB
Category manganese transport system membrane protein MntB
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -364 -350 -0.787057 0.239
NP_440795.1_7 Forward -364 -357 14.6904 0.0123
NP_440795.1_7 Reverse -357 -364 14.6904 0.0123
NP_441418.1_6 Reverse -356 -375 -19.4701 0.0888
NP_441418.1_6 Forward -350 -331 -30.5815 0.286
NP_442291.1_5 Reverse -355 -371 -4.85801 0.287
NP_441453.1_4 Reverse -356 -364 16.539 0.00633
NP_441453.1_4 Forward -365 -357 7.8859 0.0536
NP_442151.1_6 Reverse -137 -151 14.4542 0.0349
NP_442151.1_6 Forward -365 -351 8.75105 0.164
NP_440226.1_1 Reverse -356 -375 9.14423 0.0768
NP_440226.1_1 Forward -365 -346 2.85105 0.249
NP_442169.1_1 Reverse -140 -159 -2.36049 0.274
NP_441630.1_3 Reverse -348 -367 14.5524 0.05
NP_442744.1_8 Forward -306 -287 8.75091 0.152
NP_442744.1_9 Forward -371 -357 13.0292 0.282
NP_442173.1_1 Forward -364 -356 15.4574 0.00633
NP_442173.1_1 Reverse -357 -365 8.27922 0.101
NP_442752.1_4 Reverse -356 -363 13.8055 0.0199
NP_443027.1_4 Forward -367 -357 7.74818 0.235
NP_441812.1_3 Reverse -355 -369 14.5526 0.124
NP_442975.1_10 Forward -369 -355 21.3367 0.00107
NP_440784.1_7 Forward -364 -357 15.9687 0.0123
NP_440784.1_7 Reverse -357 -364 15.9687 0.0123
NP_442062.1_8 Reverse -356 -366 11.1898 0.0493
NP_442062.1_8 Forward -365 -355 7.84651 0.0871
NP_440735.1_10 Reverse -370 -384 17.7975 0.151
NP_440304.1_4 Reverse -354 -364 1.84832 0.299
NP_442242.1_4 Forward -364 -357 14.3954 0.0124
NP_442242.1_4 Reverse -357 -364 14.3954 0.0124
NP_440044.1_8 Reverse -317 -336 1.17943 0.18
NP_442602.1_3 Reverse -288 -307 2.94938 0.163
NP_441200.1_4 Reverse -103 -122 7.17762 0.272
NP_441935.1_1 Forward -321 -302 11.6025 0.208
NP_441082.1_10 Reverse -291 -304 7.88576 0.293
NP_441083.1_3 Forward -313 -303 13.9425 0.195
NP_441083.1_5 Forward -365 -355 19.0562 0.00147
NP_441083.1_5 Reverse -356 -366 1.65166 0.2
NP_441738.1_2 Forward -363 -356 15.28 0.0102
NP_441738.1_2 Reverse -343 -350 6.23363 0.264
NP_441645.1_6 Reverse -197 -211 14.3553 0.193
NP_440209.1_1 Reverse -356 -364 18.1123 0.00295
NP_440209.1_1 Forward -365 -357 15.1624 0.00583
NP_442889.1_1 Forward -312 -293 -3.14714 0.145
NP_442889.1_1 Reverse -290 -309 -11.8986 0.218
NP_442889.1_3 Reverse -122 -141 15.1424 0.282
NP_442889.1_8 Forward -368 -354 12.2903 0.0663
NP_442706.1_9 Reverse -367 -386 8.75091 0.241
NP_442570.1_3 Reverse -289 -308 -9.047 0.296
NP_440906.1_5 Forward -364 -357 15.8704 0.0124
NP_440906.1_5 Reverse -357 -364 15.8704 0.0124
NP_440832.1_10 Forward -313 -294 20.1573 0.0504
NP_440747.1_10 Reverse -353 -365 5.15219 0.0179
NP_440747.1_10 Forward -368 -356 -11.9574 0.178
NP_440747.1_10 Forward -309 -297 -11.9574 0.178
NP_441486.1_1 Forward -368 -354 4.71948 0.0415
NP_441486.1_1 Reverse -353 -367 3.34284 0.0619
NP_440842.1_10 Forward -113 -99 2.5562 0.274
NP_441695.1_8 Reverse -297 -311 22.2224 0.0363
NP_441014.1_2 Forward -313 -294 20.5506 0.122
NP_441014.1_10 Reverse -328 -347 -1.18128 0.257
NP_442848.1_1 Forward -371 -357 -3.63866 0.268
NP_441012.1_4 Reverse -299 -312 6.21414 0.284
NP_443018.1_3 Forward -364 -357 14.8871 0.0123
NP_443018.1_3 Reverse -357 -364 14.8871 0.0123
NP_441634.1_8 Reverse -354 -368 -3.147 0.295
NP_440376.1_1 Reverse -356 -365 9.73449 0.0365
NP_440376.1_1 Forward -365 -356 9.63616 0.0385
NP_440376.1_1 Forward -306 -297 4.52295 0.156
NP_441588.1_4 Forward -363 -353 15.9097 0.0369
NP_442687.1_7 Forward -366 -356 13.0581 0.0591
NP_442687.1_7 Reverse -257 -267 7.05986 0.142
NP_442687.1_7 Reverse -296 -306 4.89658 0.23
NP_440066.1_6 Reverse -194 -213 19.3707 0.153
NP_442485.1_3 Forward -317 -298 0.58944 0.239
NP_441846.1_10 Forward -213 -194 -4.81876 0.177
NP_441846.1_10 Forward -398 -379 -16.2252 0.256
NP_441013.1_2 Forward -311 -293 1.78911 0.242
NP_442658.1_1 Forward -367 -357 13.7459 0.0325
NP_442658.1_1 Reverse -354 -364 6.76441 0.214
NP_442205.1_9 Forward -204 -188 -2.98973 0.277
NP_441414.1_9 Forward -365 -346 10.4225 0.0208
NP_441414.1_9 Reverse -356 -375 -3.63879 0.14
NP_441256.1_1 Forward -368 -349 -5.11376 0.233
NP_442937.1_2 Forward -305 -286 22.123 0.0631
NP_442937.1_5 Reverse -351 -370 17.5024 0.0323
NP_441958.1_5 Reverse -355 -365 3.12662 0.0364
NP_441958.1_5 Forward -366 -356 2.43831 0.0422
NP_441127.1_1 Reverse -153 -167 11.701 0.215
NP_441127.1_5 Reverse -295 -314 21.0458 0.0475
NP_440995.1_8 Reverse -346 -365 6.78429 0.264
NP_440984.1_7 Reverse -351 -365 7.27608 0.178
NP_442911.1_2 Forward -375 -356 -9.047 0.249
NP_442064.1_4 Reverse -91 -110 9.83173 0.204
NP_442064.1_4 Forward -316 -297 9.34008 0.208
NP_442064.1_4 Forward -317 -298 5.01354 0.281
NP_443055.1_6 Reverse -348 -366 7.58986 0.156
NP_442567.1_3 Reverse -315 -331 13.1366 0.241
NP_441752.1_2 Forward -85 -66 14.9458 0.157
NP_440377.1_1 Reverse -313 -330 16.9751 0.153
NP_441000.1_6 Forward -366 -352 -3.63866 0.225
NP_440484.1_3 Reverse -354 -368 10.1277 0.242
NP_440147.1_4 Reverse -354 -367 0.707601 0.247
NP_440147.1_4 Reverse -295 -308 -0.275709 0.279
NP_441550.1_8 Reverse -354 -364 14.6309 0.0132
NP_441916.1_7 Reverse -356 -366 9.12481 0.0396
NP_441916.1_7 Forward -365 -355 2.04498 0.265
NP_441916.1_10 Reverse -295 -314 0.687771 0.278
NP_440383.1_10 Forward -251 -232 11.8975 0.234
NP_440569.1_6 Forward -353 -334 6.4893 0.228
NP_441547.1_2 Forward -317 -299 3.26407 0.289
NP_441725.1_5 Reverse -357 -367 9.32148 0.0553
NP_441725.1_5 Forward -364 -354 2.04498 0.115
NP_439966.1_7 Forward -367 -357 19.1541 0.00473
NP_439966.1_7 Reverse -354 -364 7.25606 0.15
NP_439966.1_9 Forward -367 -358 9.93116 0.186
NP_442941.1_3 Forward -364 -354 11.0914 0.0116
NP_442941.1_3 Reverse -357 -367 2.04498 0.146
NP_440289.1_2 Forward -368 -355 11.4257 0.0196
NP_440260.1_8 Forward -321 -303 -3.02911 0.246
NP_442281.1_1 Forward -370 -356 3.73557 0.221
NP_442281.1_1 Forward -311 -297 3.63724 0.224
NP_442901.1_4 Reverse -69 -88 0.294447 0.284
NP_442901.1_4 Forward -266 -247 -2.0655 0.294
NP_442256.1_2 Forward -367 -349 -6.66736 0.214
NP_442049.1_6 Reverse -348 -367 4.52268 0.247
NP_440375.1_8 Forward -364 -345 3.04771 0.223
NP_441644.1_6 Forward -365 -355 14.7292 0.0105
NP_441644.1_6 Reverse -356 -366 6.37109 0.161
NP_443049.1_6 Reverse -355 -365 13.8856 0.139
NP_443049.1_6 Forward -207 -197 12.1289 0.24
NP_442029.1_1 Forward -383 -364 -14.7502 0.272
NP_442247.1_8 Reverse -354 -368 16.5192 0.244
NP_440253.1_2 Reverse -356 -374 4.9357 0.1
NP_440253.1_2 Forward -365 -347 -3.71743 0.3
NP_440929.1_8 Reverse -356 -365 9.93116 0.0249
NP_440929.1_8 Forward -365 -356 9.83282 0.0254
NP_442933.1_10 Reverse -356 -365 9.04618 0.063
NP_442933.1_10 Forward -365 -356 8.94785 0.0643
NP_442554.1_8 Forward -364 -354 15.3197 0.00882
NP_442554.1_8 Reverse -357 -367 4.3066 0.189
NP_442554.1_8 Reverse -298 -308 3.51995 0.222
NP_442554.1_8 Forward -305 -295 2.53664 0.268
NP_441762.1_7 Reverse -355 -367 4.95553 0.0444
NP_441762.1_7 Forward -366 -354 2.10393 0.0692
NP_442142.1_4 Forward -368 -355 10.5401 0.0712
NP_442142.1_4 Reverse -300 -313 2.67367 0.281
NP_442142.1_4 Reverse -353 -366 2.28034 0.295
NP_442292.1_1 Forward -364 -355 18.486 0.00229
NP_442292.1_1 Reverse -357 -366 0.786375 0.23
NP_441525.1_1 Forward -52 -39 15.1623 0.21
NP_441899.1_1 Reverse -24 -42 15.8504 0.162
NP_442381.1_8 Reverse -353 -372 -14.2585 0.28
NP_442381.1_8 Forward -368 -349 -14.8485 0.288
NP_441711.1_4 Reverse -347 -366 2.85105 0.264
NP_443009.1_5 Reverse -355 -366 9.69459 0.0913
NP_442301.1_2 Forward -100 -81 3.34192 0.296
NP_441715.1_4 Forward -364 -354 7.94484 0.107
NP_441715.1_4 Reverse -357 -367 7.15819 0.114
NP_440620.1_4 Forward -91 -77 15.6723 0.236
NP_440730.1_4 Forward -349 -330 9.24257 0.165
NP_441448.1_1 Forward -367 -348 10.3242 0.191
NP_440183.1_9 Reverse -299 -318 -17.2085 0.276
NP_441198.1_5 Forward -363 -350 13.3917 0.206
NP_440379.1_5 Reverse -294 -313 -10.4236 0.28
NP_440464.1_10 Forward -364 -354 13.0082 0.169
NP_441468.1_1 Forward -364 -357 15.8704 0.0124
NP_441468.1_1 Reverse -357 -364 15.8704 0.0124
NP_441020.2_6 Reverse -354 -371 11.1502 0.127
NP_441020.2_6 Forward -367 -350 8.49531 0.197
NP_440742.1_10 Reverse -359 -378 10.4225 0.293
NP_441015.1_8 Reverse -297 -316 6.88262 0.258
NP_441673.1_1 Reverse -356 -365 11.1111 0.0121
NP_441673.1_1 Forward -365 -356 11.0128 0.018
NP_441826.1_2 Forward -371 -357 -1.27871 0.242
NP_441637.1_8 Forward -325 -308 10.1669 0.284
NP_441764.1_8 Forward -80 -70 14.1818 0.284
NP_442868.1_6 Reverse -354 -364 9.81313 0.038
NP_442868.1_6 Forward -367 -357 0.668351 0.213
NP_442677.1_3 Reverse -280 -299 3.6377 0.223
NP_442808.1_1 Forward -366 -356 18.8591 0.00201
NP_441290.1_6 Forward -248 -229 18.289 0.128
NP_442820.1_3 Forward -319 -309 16.6958 0.201
NP_442820.1_3 Reverse -95 -105 14.4342 0.277
NP_442050.1_5 Forward -367 -357 8.14104 0.241
NP_442050.1_5 Reverse -354 -364 7.64939 0.243
NP_442342.1_9 Forward -308 -292 4.18844 0.251
NP_440334.1_2 Forward -238 -225 14.0806 0.274
NP_440558.1_2 Reverse -294 -313 4.42435 0.152
NP_441518.1_3 Reverse -346 -365 -3.83545 0.114
NP_441878.1_6 Forward -307 -297 11.2881 0.0176
NP_441878.1_6 Reverse -296 -306 10.7964 0.0176
NP_441878.1_6 Reverse -355 -365 0.668351 0.139
NP_441878.1_6 Forward -366 -356 0.57002 0.14
NP_441878.1_6 Reverse -302 -312 0.373358 0.144
NP_441878.1_6 Forward -313 -303 0.275027 0.146
NP_441036.1_8 Forward -366 -356 15.418 0.00944
NP_442721.1_3 Forward -313 -294 12.5858 0.281
NP_441557.1_5 Reverse -356 -365 10.8161 0.00464
NP_441557.1_5 Forward -365 -356 10.4228 0.00915
NP_441590.1_4 Reverse -298 -317 8.65176 0.249
NP_442419.1_2 Reverse -351 -370 -4.03212 0.281
NP_441739.1_2 Reverse -339 -355 9.4976 0.176
NP_440101.1_3 Forward -323 -304 1.57275 0.27
NP_442183.1_1 Reverse -356 -370 19.4691 0.00583
NP_442183.1_3 Forward -136 -117 18.4848 0.161
NP_441459.1_3 Reverse -294 -313 10.359 0.296
NP_440058.1_6 Forward -309 -290 4.42435 0.291
NP_441467.1_4 Reverse -50 -68 21.5528 0.138
NP_442347.1_2 Forward -364 -355 12.4878 0.056
NP_442347.1_2 Reverse -330 -339 3.7363 0.284
NP_441037.1_4 Reverse -354 -364 7.9999 0.237
NP_441633.1_3 Reverse -354 -367 -1.25902 0.154
NP_441633.1_3 Forward -148 -135 -1.65234 0.16
NP_440136.1_2 Forward -364 -357 15.9687 0.0123
NP_440136.1_2 Reverse -357 -364 15.9687 0.0123
NP_442590.1_9 Forward -366 -347 7.96426 0.246
NP_442998.1_5 Forward -106 -96 8.63316 0.261
NP_442998.1_10 Forward -363 -356 15.5754 0.0102
NP_442998.1_10 Reverse -358 -365 5.84064 0.235
NP_440899.1_1 Forward -324 -305 10.8472 0.178
NP_440299.1_1 Reverse -352 -365 4.54195 0.207
NP_441799.1_1 Reverse -352 -366 14.3553 0.0242
NP_441799.1_1 Forward -369 -355 5.60385 0.201
NP_442528.1_7 Forward -100 -81 16.1257 0.248
NP_442802.1_2 Forward -310 -291 15.5349 0.212
NP_440256.1_1 Reverse -353 -372 -3.3438 0.131
NP_441090.1_6 Reverse -290 -304 13.2743 0.13
NP_441559.1_8 Forward -311 -297 -5.70361 0.27
NP_441559.1_8 Forward -166 -152 -6.88358 0.281
NP_440915.1_6 Forward -310 -296 0.196253 0.173
NP_442158.1_4 Forward -264 -254 13.353 0.234
NP_440717.1_3 Reverse -248 -262 7.3738 0.28
NP_441704.1_8 Reverse -345 -364 9.43841 0.182
NP_442993.1_1 Reverse -356 -372 -5.84132 0.146
NP_442386.1_9 Forward -366 -357 17.6988 0.0144
NP_442386.1_9 Reverse -355 -364 13.8639 0.0289
NP_440570.1_5 Reverse -293 -312 -1.37718 0.272
NP_440570.1_5 Forward -310 -291 -1.67217 0.276
NP_441340.1_5 Forward -364 -357 15.6737 0.0124
NP_441340.1_5 Reverse -357 -364 15.6737 0.0124
NP_442791.1_5 Reverse -305 -324 -8.16202 0.279
NP_442506.1_9 Reverse -90 -109 8.35759 0.229
NP_440161.1_3 Forward -367 -348 9.93088 0.237
NP_442714.1_5 Reverse -145 -164 7.07928 0.238
NP_440586.1_8 Forward -364 -357 13.2151 0.026
NP_440586.1_8 Reverse -357 -364 13.2151 0.026
NP_442251.1_6 Forward -364 -357 15.2804 0.0124
NP_442251.1_6 Reverse -357 -364 15.2804 0.0124
NP_440192.1_4 Forward -324 -305 16.9652 0.166
NP_440684.1_9 Reverse -350 -364 11.7993 0.168
NP_441262.1_3 Reverse -356 -363 14.7888 0.0223
NP_441262.1_3 Forward -365 -358 6.52896 0.0809
NP_443051.1_1 Reverse -355 -364 10.4228 0.00754
NP_443051.1_1 Forward -366 -357 0.983037 0.125
NP_441232.1_10 Reverse -345 -364 5.211 0.177
NP_439937.1_9 Forward -308 -291 -13.6298 0.287
NP_440926.1_1 Forward -272 -253 20.2556 0.0126
NP_440926.1_5 Forward -317 -298 9.0459 0.252
NP_440408.1_7 Reverse -297 -316 7.27595 0.29
NP_440372.1_2 Forward -364 -357 16.3621 0.0124
NP_440372.1_2 Reverse -357 -364 16.3621 0.0124
NP_440171.1_3 Reverse -137 -156 2.3594 0.287
NP_442384.1_10 Reverse -297 -310 7.49244 0.0807
NP_441018.1_7 Forward -316 -297 12.7825 0.151
NP_442790.1_4 Forward -374 -355 -14.1602 0.272
NP_442262.1_10 Forward -364 -357 14.1988 0.0123
NP_442262.1_10 Reverse -357 -364 14.1988 0.0123
NP_441689.1_5 Reverse -354 -364 5.78111 0.197
NP_440344.1_10 Forward -372 -355 -6.746 0.114
NP_440282.1_10 Reverse -293 -312 -0.39387 0.21
NP_440531.1_6 Reverse -289 -308 -2.55715 0.253
NP_440531.1_6 Reverse -348 -367 -4.13045 0.276
NP_440531.1_8 Forward -323 -304 9.73422 0.207
NP_441060.1_4 Forward -86 -68 7.59063 0.222
NP_440189.1_10 Reverse -345 -364 7.27595 0.242
NP_441335.1_8 Reverse -286 -305 7.27595 0.281
NP_441965.1_10 Forward -368 -352 5.6634 0.199
NP_440297.1_9 Reverse -298 -308 6.46988 0.185
NP_440297.1_9 Reverse -357 -367 0.865012 0.282
NP_440297.1_9 Forward -305 -295 0.0783647 0.282
NP_440297.1_9 Forward -364 -354 -0.118297 0.282
NP_442187.1_3 Reverse -355 -365 17.188 0.0619
NP_441592.1_4 Reverse -297 -316 7.37428 0.124
NP_440888.1_2 Reverse -189 -203 6.98048 0.212
NP_440888.1_2 Forward -365 -351 6.0955 0.249
NP_440888.1_2 Reverse -356 -370 5.30886 0.284
NP_442892.1_9 Reverse -318 -332 12.3887 0.296
NP_440600.1_4 Reverse -348 -366 0.412472 0.14
NP_440600.1_4 Forward -373 -355 -7.94566 0.294
NP_442033.1_10 Forward -308 -289 -12.9802 0.279
NP_441543.1_2 Forward -364 -355 16.9127 0.00359
NP_441543.1_2 Reverse -357 -366 8.94785 0.0968
NP_442845.1_2 Forward -387 -373 6.48943 0.209
NP_441469.1_8 Forward -366 -357 15.4377 0.0124
NP_441469.1_8 Reverse -355 -364 6.48957 0.227
NP_442315.1_1 Forward -389 -371 9.26226 0.206
NP_443064.1_6 Forward -198 -188 10.5308 0.148
NP_443064.1_6 Forward -365 -355 9.46426 0.219
NP_442578.1_7 Forward -364 -357 14.5921 0.026
NP_442578.1_7 Reverse -357 -364 14.5921 0.026
NP_442578.1_7 Forward -337 -330 9.97054 0.112
NP_440220.1_4 Forward -178 -159 -2.45958 0.271
NP_441462.1_2 Reverse -356 -366 9.32148 0.0234
NP_441462.1_2 Forward -365 -355 1.74999 0.0811
NP_442736.1_4 Forward -398 -379 17.2074 0.0677
NP_443062.1_1 Forward -365 -347 7.76586 0.168
NP_440454.1_2 Forward -91 -77 16.1498 0.163
NP_440516.1_8 Reverse -356 -365 18.9776 0.00442
NP_440516.1_8 Forward -365 -356 7.07956 0.0867
NP_442080.1_7 Reverse -351 -370 -4.91709 0.296
NP_441033.1_2 Forward -375 -356 3.14605 0.135
NP_442428.1_5 Forward -364 -357 15.8704 0.0124
NP_442428.1_5 Reverse -357 -364 15.8704 0.0124
NP_440673.1_2 Reverse -287 -306 9.31652 0.248
NP_440673.1_2 Forward -322 -303 8.63366 0.264
NP_440673.1_3 Reverse -358 -365 13.1171 0.0426
NP_440673.1_3 Forward -363 -356 12.4288 0.0426
NP_440673.1_7 Reverse -305 -324 4.32602 0.186
NP_441052.1_2 Forward -365 -355 20.5312 0.00106
NP_441052.1_2 Reverse -372 -382 2.7333 0.193
NP_441052.1_2 Reverse -356 -366 0.766681 0.256
NP_442219.1_9 Forward -364 -355 17.7976 0.00718
NP_442219.1_9 Reverse -357 -366 8.94785 0.0681
NP_440436.1_4 Forward -364 -355 17.2072 0.00233
NP_440436.1_4 Reverse -357 -366 9.04574 0.092
NP_441884.1_8 Forward -366 -347 -7.86702 0.254
NP_441884.1_9 Forward -368 -349 -23.895 0.284
NP_442412.1_5 Forward -216 -197 2.26107 0.294
NP_441719.1_4 Forward -364 -357 16.3621 0.0124
NP_441719.1_4 Reverse -357 -364 16.3621 0.0124
NP_441733.1_10 Reverse -353 -366 9.36073 0.119
NP_441004.1_1 Reverse -292 -311 -15.0452 0.271
NP_441004.1_1 Forward -312 -293 -15.2418 0.273
NP_441004.1_5 Reverse -294 -308 9.2427 0.262
NP_442813.1_4 Reverse -66 -85 1.67108 0.197
NP_442366.1_5 Reverse -353 -363 15.4175 0.0374
NP_442366.1_5 Forward -55 -45 11.3859 0.189
NP_442694.1_4 Forward -321 -312 13.3727 0.225
NP_441966.1_8 Reverse -291 -309 7.00065 0.0979
NP_441851.1_10 Reverse -355 -365 8.33817 0.118
NP_441851.1_10 Forward -366 -356 6.66654 0.159
NP_442622.1_8 Forward -365 -347 0.609134 0.0642
NP_441668.1_4 Forward -79 -60 4.03102 0.183
NP_442515.1_1 Reverse -355 -369 2.85119 0.129
NP_442515.1_1 Forward -147 -133 2.16287 0.141
NP_442515.1_1 Forward -129 -115 -2.65535 0.277
NP_441046.1_2 Forward -323 -304 -0.885524 0.287
NP_441349.1_10 Forward -375 -356 -2.95047 0.13
NP_440432.1_9 Forward -364 -349 9.71466 0.0419
NP_442843.1_1 Forward -364 -345 -10.522 0.278
NP_439960.1_4 Reverse -355 -374 12.6833 0.28
NP_439960.1_10 Reverse -322 -340 -4.30741 0.293
NP_441477.1_5 Forward -304 -285 9.43923 0.268
NP_440431.1_3 Forward -91 -72 2.65439 0.0943
NP_442450.1_5 Forward -367 -357 9.61647 0.115
NP_442450.1_5 Reverse -354 -364 7.55152 0.13
NP_442168.1_6 Forward -169 -150 15.0441 0.202
NP_440588.1_2 Forward -315 -296 4.52268 0.0801
NP_440588.1_2 Reverse -294 -313 -4.91709 0.233
NP_442006.1_2 Forward -111 -94 -9.59759 0.197
NP_442006.1_2 Reverse -144 -161 -18.644 0.294
NP_441003.1_9 Reverse -294 -313 5.80098 0.257
NP_441570.1_1 Forward -365 -347 1.29745 0.0315
NP_441570.1_1 Reverse -356 -374 -6.76569 0.0818
NP_441078.1_4 Reverse -356 -365 9.93116 0.0203
NP_441078.1_4 Forward -365 -356 9.83282 0.0226
NP_441078.1_4 Reverse -297 -306 -1.37691 0.254
NP_441078.1_4 Forward -306 -297 -1.47524 0.266
NP_442729.1_5 Forward -382 -372 7.94484 0.254
NP_442729.1_8 Forward -58 -45 6.31247 0.203
NP_442348.1_2 Forward -322 -313 16.0277 0.113
NP_442348.1_2 Forward -307 -298 9.4395 0.28
NP_442443.1_1 Forward -314 -295 -1.18052 0.231
NP_442443.1_1 Forward -212 -193 -2.65548 0.259
NP_442443.1_1 Reverse -357 -376 -6.78538 0.298
NP_440526.1_3 Forward -364 -353 1.04151 0.267
NP_441432.1_8 Reverse -355 -364 16.8143 0.00595
NP_441333.1_1 Reverse -234 -244 12.9245 0.217
NP_442320.1_8 Forward -371 -357 4.12949 0.0551
NP_442320.1_8 Reverse -350 -364 3.63784 0.0578
NP_442344.1_7 Forward -364 -345 -6.39206 0.171
NP_441030.1_9 Forward -303 -286 8.49531 0.289
NP_440760.1_1 Forward -365 -346 -23.2067 0.288
NP_442797.1_7 Forward -207 -189 2.96908 0.236
NP_442353.1_4 Forward -344 -325 2.16195 0.236
NP_442489.1_7 Reverse -356 -365 10.4228 0.0151
NP_442489.1_7 Forward -365 -356 10.3245 0.0193
NP_442489.1_7 Reverse -297 -306 -1.37691 0.195
NP_442489.1_7 Forward -306 -297 -1.47524 0.203
NP_442079.1_7 Forward -364 -345 2.3594 0.229
NP_440559.1_1 Forward -364 -355 17.4043 0.00658
NP_441659.2_8 Forward -365 -355 8.63316 0.0405
NP_441659.2_8 Reverse -356 -366 2.43831 0.2
NP_441040.1_2 Forward -314 -295 -14.9469 0.286
NP_441040.1_2 Forward -315 -296 -15.4385 0.286
NP_441040.1_5 Reverse -292 -311 13.1758 0.148
NP_442008.1_2 Reverse -294 -313 10.6192 0.143
NP_442346.1_5 Reverse -355 -365 8.23984 0.143
NP_442346.1_5 Reverse -296 -306 6.66654 0.195
NP_442346.1_5 Forward -307 -297 6.46988 0.201
NP_442346.1_5 Forward -366 -356 5.19158 0.256
NP_440352.1_5 Forward -115 -96 9.93029 0.289
NP_440545.1_3 Reverse -293 -310 8.98696 0.0411
NP_440545.1_3 Forward -310 -293 -5.07437 0.24
NP_440025.1_3 Reverse -361 -375 12.1598 0.269
NP_440486.1_6 Forward -388 -369 5.40766 0.297
NP_440486.1_9 Forward -310 -296 15.7325 0.193
NP_440010.1_10 Reverse -344 -363 10.6192 0.209
NP_441943.1_9 Forward -183 -169 17.7968 0.231
NP_441888.1_5 Forward -302 -283 3.44104 0.229
NP_441948.1_4 Reverse -349 -367 -2.0458 0.158
NP_441047.1_2 Forward -364 -345 -1.57384 0.267
NP_441833.1_4 Forward -364 -357 15.9687 0.0124
NP_441833.1_4 Reverse -357 -364 15.9687 0.0124
NP_442799.1_2 Reverse -370 -389 -1.27885 0.294
NP_441895.1_10 Reverse -122 -141 -27.5332 0.282
NP_442699.1_8 Reverse -302 -321 -3.73712 0.238
NP_442699.1_8 Reverse -301 -320 -11.1119 0.238
NP_442162.1_9 Forward -364 -357 16.2637 0.0124
NP_442162.1_9 Reverse -357 -364 16.2637 0.0124
NP_440671.1_4 Forward -371 -357 6.58777 0.243
NP_442140.1_3 Forward -364 -354 12.2714 0.0632
NP_442140.1_3 Reverse -357 -367 10.1081 0.0926
NP_440875.1_9 Reverse -300 -310 8.08002 0.243
NP_441813.1_5 Forward -367 -357 17.188 0.00979
NP_441813.1_5 Reverse -354 -364 8.63316 0.0367
NP_440590.1_4 Forward -364 -351 0.707601 0.144
NP_440567.1_1 Forward -364 -350 3.53951 0.141
NP_442497.1_10 Forward -364 -355 10.4228 0.0087
NP_442497.1_10 Reverse -357 -366 1.37636 0.111
NP_440821.1_4 Forward -367 -357 16.6963 0.00797
NP_440821.1_4 Reverse -354 -364 9.41981 0.0286
NP_441239.1_9 Forward -367 -355 13.0187 0.0389
NP_441239.1_9 Forward -308 -296 7.21714 0.169
NP_441239.1_9 Reverse -295 -307 4.95553 0.234
NP_441892.1_1 Reverse -288 -305 3.77542 0.119
NP_441892.1_1 Reverse -347 -364 2.49712 0.14
NP_440796.1_3 Forward -372 -354 9.06482 0.243
NP_442270.1_6 Forward -366 -348 14.5721 0.293
NP_441874.1_1 Forward -216 -202 10.0294 0.265
NP_440876.1_5 Forward -363 -344 5.89931 0.283
NP_441617.1_3 Reverse -336 -355 7.66927 0.246
NP_442138.1_10 Forward -365 -346 -8.06369 0.296
NP_442052.1_8 Reverse -295 -305 14.4347 0.253
NP_441782.1_5 Reverse -348 -367 9.14423 0.256
NP_440546.1_4 Reverse -356 -366 13.0517 0.0572
NP_440546.1_4 Forward -365 -355 7.33119 0.246
NP_442041.1_10 Forward -313 -294 11.7008 0.248
NP_440675.1_10 Reverse -288 -307 12.9791 0.233
NP_440462.1_6 Forward -367 -357 14.4347 0.0209
NP_440462.1_6 Reverse -354 -364 1.35667 0.294
NP_440868.1_4 Forward -369 -357 9.67541 0.0441
NP_440868.1_4 Reverse -352 -364 5.84051 0.0879
NP_442499.1_3 Reverse -239 -257 4.14905 0.289
NP_440341.1_7 Reverse -341 -355 11.7993 0.233
NP_441848.1_7 Reverse -183 -202 -4.32786 0.289
NP_441084.1_6 Reverse -301 -315 15.8402 0.0737
NP_441084.1_6 Reverse -165 -179 9.53803 0.278
NP_441084.1_6 Forward -236 -222 9.15021 0.292
NP_442039.1_4 Forward -364 -357 15.1821 0.0124
NP_442039.1_4 Reverse -357 -364 15.1821 0.0124
NP_442039.1_7 Forward -354 -344 7.55152 0.275
NP_441926.1_3 Reverse -356 -372 4.18844 0.197
NP_440825.1_7 Forward -364 -354 12.9096 0.152
NP_442837.1_3 Forward -364 -357 15.7721 0.0124
NP_442837.1_3 Reverse -357 -364 15.7721 0.0124
NP_440160.1_2 Forward -312 -293 2.65439 0.217
NP_440160.1_2 Reverse -297 -316 0.392778 0.228
NP_440160.1_2 Reverse -296 -315 0.196116 0.228
NP_440160.1_9 Reverse -297 -316 14.4541 0.204
NP_440160.1_9 Forward -306 -287 9.63589 0.235
NP_439994.1_3 Reverse -25 -44 7.75569 0.3
NP_442053.1_1 Reverse -356 -365 17.601 0.00138
NP_442053.1_1 Forward -365 -356 16.2243 0.00451
NP_440505.1_3 Reverse -354 -364 9.22315 0.122
NP_440505.1_7 Forward -175 -156 -0.688862 0.271
NP_442360.1_5 Reverse -102 -112 12.9597 0.298
NP_441252.1_6 Forward -352 -345 11.6422 0.288
NP_441203.1_1 Reverse -357 -376 -14.9469 0.208
NP_442532.1_7 Reverse -356 -370 11.6026 0.122
NP_440914.1_1 Forward -365 -355 15.0561 0.00832
NP_440914.1_1 Reverse -356 -366 7.34642 0.241
NP_441011.1_8 Reverse -357 -366 15.3394 0.012
NP_441011.1_8 Forward -364 -355 8.25953 0.144
NP_442533.1_6 Reverse -356 -365 7.86621 0.0862
NP_442533.1_6 Forward -365 -356 7.37455 0.0898
NP_442533.1_6 Reverse -297 -306 7.27622 0.0928
NP_442533.1_6 Forward -306 -297 7.17789 0.0948
NP_442533.1_6 Forward -311 -302 5.50626 0.14
NP_442533.1_6 Forward -312 -303 4.52295 0.179
NP_442533.1_6 Reverse -303 -312 4.52295 0.179
NP_442533.1_6 Reverse -298 -307 1.37636 0.3
NP_441089.1_6 Reverse -282 -301 9.63589 0.258
NP_442541.1_10 Reverse -297 -311 2.16228 0.265
NP_443050.1_2 Forward -309 -290 7.86593 0.287
NP_442322.1_4 Reverse -295 -312 -3.89507 0.253
NP_441482.1_7 Forward -371 -357 -3.73699 0.138
NP_441482.1_7 Forward -312 -298 -10.8168 0.216
NP_439944.1_9 Forward -364 -354 10.5014 0.0887
NP_442269.1_10 Forward -324 -305 6.78429 0.217
NP_441028.1_6 Forward -167 -157 5.78111 0.243
NP_441028.1_6 Forward -181 -171 5.19112 0.265
NP_441527.1_4 Forward -246 -227 -7.01908 0.229
NP_441106.1_1 Reverse -355 -364 9.63616 0.0311
NP_441106.1_1 Forward -366 -357 9.04618 0.0371
NP_441106.1_6 Forward -146 -127 15.1416 0.252
NP_441869.1_8 Forward -92 -73 19.9598 0.17
NP_442306.1_4 Reverse -26 -42 20.0197 0.234
NP_441286.1_1 Reverse -355 -367 13.5103 0.00683
NP_441286.1_1 Forward -366 -354 -5.86088 0.229
NP_442674.1_2 Reverse -106 -125 10.0292 0.208
NP_440670.1_8 Reverse -356 -365 9.04618 0.0606
NP_440670.1_8 Forward -365 -356 8.75118 0.0606
NP_440886.1_7 Forward -366 -356 17.7774 0.0011
NP_440886.1_7 Reverse -355 -365 6.66608 0.115
NP_442382.1_9 Forward -175 -156 16.1249 0.239
NP_442072.1_9 Reverse -308 -326 -23.482 0.297
NP_440907.2_8 Forward -364 -354 7.64939 0.117
NP_440841.1_4 Forward -367 -348 -9.73531 0.262
NP_441463.1_3 Reverse -346 -365 -0.983855 0.135
NP_441463.1_3 Forward -375 -356 -4.81876 0.215
NP_441626.1_2 Forward -364 -357 15.7721 0.0124
NP_441626.1_2 Reverse -357 -364 15.7721 0.0124
NP_441460.1_2 Reverse -99 -112 16.0466 0.162
NP_442794.1_1 Reverse -352 -364 9.38042 0.0795
NP_442615.1_1 Forward -374 -356 -4.30741 0.183
NP_440387.1_1 Reverse -356 -372 5.56507 0.0315
NP_440387.1_1 Forward -365 -349 -3.48138 0.16
NP_441963.1_2 Forward -341 -322 2.3594 0.229
NP_441431.1_2 Forward -309 -295 6.68548 0.263
NP_441836.1_2 Reverse -161 -180 -1.37718 0.217
NP_441836.1_2 Forward -344 -325 -5.9004 0.288
NP_441993.1_1 Forward -312 -293 1.36194 0.28
NP_442224.1_1 Forward -367 -348 -4.03212 0.233
NP_440114.1_10 Reverse -356 -370 9.73436 0.164
NP_441425.1_3 Reverse -112 -122 15.2213 0.273
NP_442698.1_10 Reverse -149 -168 10.8159 0.233
NP_442698.1_10 Forward -304 -285 1.17943 0.297
NP_441206.1_4 Reverse -308 -327 -3.93378 0.263
NP_441510.2_7 Reverse -372 -386 13.1753 0.28
NP_442087.1_2 Reverse -119 -138 14.8577 0.202
NP_440293.1_3 Forward -314 -295 -1.86883 0.239
NP_439988.1_3 Forward -310 -296 5.21113 0.288
NP_441237.1_1 Forward -275 -256 27.2371 0.00186
NP_441237.1_2 Forward -353 -334 28.0238 0.00143
NP_441237.1_3 Forward -326 -307 24.1197 0.00519
NP_441237.1_4 Forward -394 -375 28.3188 0.000236
NP_441237.1_5 Forward -184 -166 23.8152 0.0143
NP_441237.1_6 Forward -306 -289 30.9148 0.000123
NP_441237.1_7 Forward -65 -46 23.3039 0.0387
NP_441237.1_9 Forward -364 -354 14.828 0.0242
NP_441237.1_10 Forward -134 -115 22.0964 0.0789
NP_442743.1_1 Reverse -287 -306 5.40686 0.273
NP_440278.1_4 Reverse -312 -331 16.3215 0.268
NP_440643.1_6 Reverse -298 -317 4.42435 0.22
NP_439910.1_2 Forward -373 -356 -13.4325 0.162
NP_442867.1_8 Forward -363 -344 7.7676 0.242
NP_442680.1_5 Reverse -139 -158 0.853752 0.257
NP_440801.1_8 Forward -366 -347 10.0292 0.134
NP_440142.1_7 Forward -305 -286 6.29264 0.26
NP_441984.1_1 Forward -312 -294 5.52568 0.289
NP_440473.1_9 Forward -376 -357 -5.80207 0.22
NP_442509.1_9 Reverse -356 -366 14.7292 0.0242
NP_442582.1_3 Forward -101 -87 14.3354 0.235
NP_440554.1_4 Reverse -357 -367 8.04317 0.0851
NP_441885.1_5 Forward -365 -355 11.0914 0.00874
NP_441885.1_5 Reverse -356 -366 2.33998 0.0799
NP_440628.1_1 Forward -244 -234 14.6456 0.248
NP_442341.1_9 Forward -367 -353 5.1122 0.279
NP_441756.1_5 Forward -309 -290 8.06259 0.145
NP_441756.1_7 Forward -208 -189 21.0423 0.0722
NP_441173.1_9 Forward -180 -172 11.7204 0.226
NP_441173.1_9 Forward -86 -78 9.75379 0.284
NP_442395.2_4 Reverse -204 -223 2.16195 0.224
NP_440191.1_4 Forward -157 -147 15.0872 0.254
NP_440423.1_6 Reverse -348 -367 -20.5517 0.261
NP_443000.1_7 Reverse -354 -364 10.3048 0.0345
NP_440507.2_3 Forward -374 -355 7.37347 0.281
NP_441842.1_10 Reverse -349 -363 9.34103 0.192
NP_440275.1_3 Reverse -354 -364 8.04317 0.0602
NP_440091.1_1 Forward -369 -357 2.10393 0.197
NP_440091.1_1 Reverse -352 -364 -0.452677 0.273
NP_442275.1_1 Reverse -287 -306 7.7676 0.253
NP_442451.1_2 Reverse -331 -350 -7.76869 0.239
NP_441122.1_1 Reverse -97 -112 2.8315 0.294
NP_440258.1_3 Forward -91 -72 -3.14714 0.225
NP_440149.1_8 Forward -365 -346 -4.52377 0.21
NP_441875.1_7 Forward -351 -341 15.9097 0.227
NP_441105.1_3 Forward -317 -298 1.76941 0.11
NP_440216.1_1 Reverse -356 -370 -4.4253 0.111
NP_440216.1_1 Forward -365 -351 -12.5868 0.288
NP_440216.1_9 Forward -82 -73 6.39124 0.289
NP_440172.1_1 Reverse -356 -366 9.7148 0.0586
NP_440172.1_1 Forward -365 -355 5.19158 0.149
NP_442015.1_10 Reverse -293 -306 5.82081 0.132
NP_442015.1_10 Forward -310 -297 0.117615 0.241
NP_441226.1_7 Forward -364 -357 14.4934 0.0123
NP_441226.1_7 Reverse -357 -364 14.4934 0.0123
NP_441111.1_7 Forward -364 -356 18.7023 0.00294
NP_441111.1_7 Reverse -357 -365 8.96754 0.0463
NP_441766.1_2 Forward -365 -356 18.2893 0.00297
NP_441766.1_2 Reverse -356 -365 9.14451 0.0337
NP_442417.1_5 Reverse -356 -370 12.1926 0.0981
NP_440416.1_9 Forward -313 -294 -16.7168 0.22
NP_443052.1_8 Forward -375 -356 -2.16383 0.0871
NP_443052.1_9 Reverse -374 -393 -2.36049 0.238
NP_441974.1_4 Forward -138 -119 14.1583 0.273
NP_442154.1_1 Reverse -348 -366 -17.2871 0.251
NP_442564.1_10 Reverse -100 -114 10.816 0.271
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGAAAGTCTAGAGCGGGTGGGCATGGTGAAATACCGCGATCGCCAAATTGGGGAACTTTCCGGCGGTCAAAAGAAGCGGGCATTTTTGGCCCGGGCCTTGGCCCAGGAAGGCAAGGTAATTCTGTTAGATGAGCCTTTTACCGGGGTTGATGTGAAAACAGAAAAAGGCATGATTGATTTACTCATGGAACTGCGGGATGAGGGGCACACCATTCTGATTTCTACCCATGATTTGGCCTCCATTTCCACCTTTTGTGACCACACCATTCTGCTCAACCGCACTATTTTGGCCCAGGGTAAAACTGAAGAAACCTTCACCAAAGAAAATTTGGAACTGACTTTTGGTGGGCTACCAATGCTGAGTCTGAATCAGATGTTTGAATCGACAGAGGTAGATGC

CDS

GTGAATCAGTTAGTGGTGGCCTTTCCCTTTTGGCATTGGTTAGTGGAGCCTTTGCAATATGAATTTTTAATCCGGGCAATTTGGGTGAGCGCCTTTGTGGGACTAGTGTGTGCGGTGCTCTCTTGCTACATCACTCTCAAAGGTTGGTCCTTAATGGGGGATGCCATTTCCCATGCAGTGGTCCCCGGTGTAGTGCTGGCCTATGCCTTGAATATTCCCTTTGCCATTGGAGCTTTTACCTTTGGCTTTGGGGCAACGGTGGCGATCGGTTACGTCAAGTCTAAAACCCGGTTAAAGGAGGATGCAGTCATTGGCATTGTCTTTACGGGATTTTTTGCCCTTGGATTAGTGTTGGTGACCAAAATTCCTAGTAATGTTGACCTATTCCATATTCTGTTTGGCAATGTGCTGGGCATTTCTCAACAAGACATCATCCAAACCTTGATTGCTGGCTCCATTACCCTAATCGTGATTTTGTTGCGCCGCAAGGACCTGCTCTTGTTTTGTTTTGATCCAAACCATGCCAAGGCGATCGGTCTACGCACCCAAGTGATGTATTACACGCTGTTGTCGGTTCTGGCCCTCACCATTGTGGCGGCTTTACAAACAGCGGGCATTATTTTAGTAATTTCCATGCTGGTCACTCCAGGATCCATTGGCTATCTGCTCAGCGATCGCTTTGATCATATGCTTTGGTACTCGGTCGTCAGCAGTGTACTGTCCTGTGTGCTTGGCACCTATTTGAGCTATCACTTTGATGTTTCGACCGGGGGCATGATTGTGGTTATCCTGACAACGCTATTCGTAATAGCCATGATTGGTGCACCCAAGTATGGCATTTTGGCCCAGGAATGGCGCAAACGCTCGGGGCCAAATCCGGAAGACGATGAAAATCAGACTGTGGTGGTAGATCAAGTCTAG

Protein

MNQLVVAFPFWHWLVEPLQYEFLIRAIWVSAFVGLVCAVLSCYITLKGWSLMGDAISHAVVPGVVLAYALNIPFAIGAFTFGFGATVAIGYVKSKTRLKEDAVIGIVFTGFFALGLVLVTKIPSNVDLFHILFGNVLGISQQDIIQTLIAGSITLIVILLRRKDLLLFCFDPNHAKAIGLRTQVMYYTLLSVLALTIVAALQTAGIILVISMLVTPGSIGYLLSDRFDHMLWYSVVSSVLSCVLGTYLSYHFDVSTGGMIVVILTTLFVIAMIGAPKYGILAQEWRKRSGPNPEDDENQTVVVDQV