Your browser is old and dusty. Try Google Chrome!

Details for sll1598

ORF sll1598
Accession NP_441239.1
Symbol mntC
Category Mn transporter MntC
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -367 -374 8.39725 0.213
NP_440694.1_6 Forward -372 -353 4.62101 0.279
NP_440897.1_6 Reverse -366 -385 -1.47628 0.19
NP_441453.1_4 Forward -205 -197 5.32929 0.147
NP_441453.1_4 Reverse -220 -228 4.34598 0.257
NP_441453.1_8 Reverse -189 -206 12.5269 0.205
NP_441098.1_3 Forward -87 -68 2.78143 0.25
NP_442752.1_4 Reverse -196 -203 4.56234 0.265
NP_443027.1_4 Reverse -218 -228 5.87989 0.294
NP_440393.1_7 Reverse -95 -114 17.5024 0.0677
NP_441492.1_5 Forward -88 -69 4.31709 0.25
NP_441594.1_6 Forward -172 -153 4.81767 0.211
NP_441083.1_5 Forward -205 -195 0.275027 0.237
NP_441738.1_2 Forward -203 -196 11.7401 0.0647
NP_441770.1_5 Reverse -289 -308 1.37609 0.238
NP_440048.1_8 Forward -23 -4 12.0942 0.279
NP_440747.1_10 Reverse -363 -375 -12.4491 0.282
NP_441486.1_1 Reverse -193 -207 3.04785 0.0689
NP_442145.1_4 Forward -87 -68 9.11906 0.175
NP_442145.1_4 Forward -86 -67 5.1084 0.261
NP_442145.1_4 Reverse -67 -86 4.72643 0.274
NP_442145.1_4 Reverse -66 -85 2.33913 0.299
NP_440842.1_4 Reverse -68 -87 8.26883 0.115
NP_443018.1_3 Forward -228 -221 12.5271 0.0523
NP_443018.1_3 Reverse -221 -228 12.5271 0.0523
NP_440376.1_1 Reverse -155 -164 2.35967 0.224
NP_442687.1_7 Forward -376 -366 7.45319 0.132
NP_441077.1_6 Forward -91 -75 4.34438 0.255
NP_442530.1_2 Reverse -243 -253 11.6814 0.282
NP_440642.1_10 Reverse -31 -45 2.65393 0.277
NP_442658.1_1 Reverse -218 -228 5.97777 0.242
NP_439959.1_6 Reverse -367 -386 5.89931 0.274
NP_441958.1_5 Reverse -195 -205 -0.708283 0.221
NP_439905.1_1 Reverse -221 -234 13.1956 0.177
NP_439905.1_1 Forward -228 -215 7.00078 0.269
NP_440984.1_7 Forward -234 -220 6.29277 0.219
NP_442690.1_1 Reverse -69 -88 -16.1268 0.283
NP_442438.1_10 Reverse -226 -240 0.0979218 0.239
NP_441550.1_8 Forward -207 -197 4.89613 0.281
NP_440206.1_4 Forward -168 -149 1.27698 0.289
NP_440345.1_5 Forward -93 -79 13.8565 0.276
NP_441725.1_5 Reverse -221 -231 -1.29827 0.299
NP_442941.1_3 Forward -204 -194 0.57002 0.199
NP_441678.1_6 Reverse -159 -178 13.3725 0.235
NP_441079.1_7 Reverse -70 -89 -0.39464 0.199
NP_443030.1_1 Forward -88 -71 14.5918 0.132
NP_441644.1_6 Reverse -220 -230 7.45273 0.124
NP_441644.1_6 Forward -205 -195 5.38779 0.194
NP_442554.1_8 Reverse -221 -231 9.61647 0.0576
NP_442554.1_8 Forward -228 -218 2.33998 0.274
NP_442476.1_6 Reverse -221 -235 0.0979218 0.274
NP_441758.1_10 Forward -88 -69 2.75194 0.189
NP_441468.1_1 Reverse -221 -228 3.97235 0.277
NP_441468.1_1 Forward -228 -221 3.97235 0.277
NP_441020.2_6 Reverse -152 -169 6.52869 0.262
NP_441020.2_6 Reverse -194 -211 6.43035 0.262
NP_441731.1_7 Reverse -212 -231 0.884433 0.298
NP_441339.1_4 Reverse -341 -360 -5.40875 0.28
NP_441826.1_5 Reverse -306 -325 2.45773 0.276
NP_442719.1_2 Forward -395 -377 -8.92966 0.258
NP_441612.1_2 Forward -219 -209 6.61303 0.283
NP_442227.1_2 Forward -244 -225 -3.24547 0.29
NP_442808.1_1 Forward -376 -366 5.09279 0.173
NP_441101.1_10 Reverse -163 -182 -7.76869 0.292
NP_442050.1_1 Reverse -147 -166 10.2259 0.243
NP_442050.1_5 Forward -207 -197 8.73102 0.217
NP_442050.1_6 Reverse -270 -289 13.5691 0.222
NP_441878.1_6 Forward -230 -220 0.57002 0.14
NP_441878.1_6 Reverse -386 -396 -7.59145 0.245
NP_441557.1_5 Reverse -196 -205 -0.491928 0.193
NP_441914.1_5 Forward -356 -337 8.65258 0.298
NP_441458.1_8 Reverse -70 -89 4.9832 0.265
NP_441458.1_10 Reverse -211 -230 2.65439 0.269
NP_441238.1_5 Reverse -32 -51 19.7631 0.0733
NP_441238.1_7 Reverse -15 -34 14.5621 0.24
NP_442347.1_2 Reverse -172 -181 4.0313 0.284
NP_440563.1_6 Reverse -346 -359 21.4554 0.0582
NP_442998.1_5 Reverse -243 -253 9.91146 0.232
NP_442998.1_5 Reverse -377 -387 7.84651 0.28
NP_442998.1_10 Forward -203 -196 6.0373 0.205
NP_440899.1_8 Reverse -29 -48 -11.1119 0.296
NP_440256.1_1 Reverse -193 -212 -7.86702 0.247
NP_441559.1_8 Forward -169 -155 -5.80194 0.27
NP_441179.1_9 Forward -377 -367 14.1392 0.246
NP_441179.1_9 Reverse -218 -228 13.6475 0.246
NP_440748.1_5 Forward -372 -353 -3.04881 0.289
NP_440695.1_6 Reverse -295 -309 9.73265 0.276
NP_442386.1_9 Reverse -219 -228 13.1756 0.0406
NP_440570.1_5 Reverse -356 -375 2.65439 0.234
NP_441340.1_5 Reverse -221 -228 4.07068 0.239
NP_441340.1_5 Reverse -197 -204 4.07068 0.239
NP_441340.1_5 Forward -228 -221 4.07068 0.239
NP_440586.1_8 Forward -228 -221 7.61025 0.227
NP_440586.1_8 Reverse -221 -228 7.61025 0.227
NP_441262.1_3 Reverse -196 -203 5.34899 0.181
NP_443051.1_5 Forward -141 -122 9.43923 0.235
NP_440926.1_5 Forward -374 -355 11.9958 0.23
NP_440408.1_7 Reverse -360 -379 7.7676 0.284
NP_440372.1_2 Reverse -197 -204 4.36568 0.205
NP_440171.1_3 Reverse -278 -297 6.98095 0.259
NP_440819.1_5 Reverse -242 -250 7.98423 0.228
NP_441877.1_9 Reverse -67 -84 3.77542 0.284
NP_440476.1_2 Forward -257 -238 11.995 0.284
NP_441018.1_7 Forward -361 -342 7.37428 0.272
NP_442262.1_10 Forward -228 -221 10.4622 0.145
NP_442262.1_10 Reverse -221 -228 10.4622 0.145
NP_440344.1_10 Forward -382 -365 -6.84433 0.115
NP_440282.1_10 Forward -379 -360 -1.86883 0.224
NP_440531.1_6 Forward -237 -218 -3.14714 0.262
NP_441640.1_1 Reverse -151 -170 -2.95047 0.287
NP_440297.1_9 Reverse -221 -231 9.91146 0.0917
NP_441679.1_5 Reverse -155 -174 9.73422 0.21
NP_440999.1_9 Forward -379 -365 2.45787 0.149
NP_440888.1_2 Forward -205 -191 11.4053 0.0681
NP_440888.1_2 Reverse -155 -169 5.30886 0.284
NP_442454.1_2 Forward -86 -67 11.1244 0.259
NP_441771.1_4 Reverse -66 -85 -4.91709 0.295
NP_441949.1_5 Forward -87 -68 19.2602 0.0465
NP_442710.1_7 Forward -142 -123 -7.7994 0.299
NP_441469.1_8 Forward -230 -221 11.3078 0.173
NP_441469.1_8 Reverse -219 -228 5.60459 0.258
NP_441462.1_2 Reverse -196 -206 8.33817 0.0374
NP_443062.1_1 Forward -229 -211 5.13317 0.238
NP_442780.1_1 Forward -83 -64 10.0292 0.195
NP_440516.1_8 Reverse -196 -205 -0.000272808 0.156
NP_442428.1_5 Forward -228 -221 4.36568 0.271
NP_442428.1_5 Reverse -221 -228 4.36568 0.271
NP_440603.1_3 Reverse -149 -168 5.89931 0.265
NP_441052.1_2 Forward -375 -365 5.68323 0.107
NP_441052.1_2 Forward -169 -159 -0.314959 0.273
NP_442219.1_9 Forward -204 -195 5.01461 0.193
NP_440436.1_4 Forward -228 -219 4.42421 0.265
NP_441884.1_2 Reverse -245 -259 15.6723 0.239
NP_441086.1_8 Forward -297 -284 18.7789 0.128
NP_441851.1_10 Forward -230 -220 5.78156 0.2
NP_441851.1_10 Reverse -195 -205 4.79825 0.247
NP_441668.1_4 Reverse -345 -364 7.07928 0.151
NP_441273.1_9 Forward -88 -69 12.926 0.279
NP_442515.1_1 Forward -220 -206 -2.85201 0.281
NP_441540.1_4 Forward -93 -74 19.5258 0.0796
NP_441409.1_6 Reverse -14 -33 -1.47551 0.0765
NP_441409.1_6 Forward -381 -362 -5.99873 0.118
NP_440432.1_9 Reverse -197 -212 -4.93665 0.228
NP_439960.1_8 Reverse -220 -239 10.2259 0.264
NP_440588.1_2 Forward -384 -365 -3.93378 0.2
NP_441031.1_1 Forward -89 -70 4.12335 0.292
NP_442906.1_3 Forward -237 -218 10.1275 0.157
NP_441432.1_8 Reverse -365 -374 9.73449 0.0754
NP_441432.1_8 Reverse -195 -204 4.62128 0.201
NP_441432.1_9 Reverse -75 -88 10.3436 0.252
NP_440199.1_10 Reverse -193 -203 7.35486 0.231
NP_441945.1_10 Reverse -359 -378 7.17762 0.286
NP_442489.1_2 Reverse -185 -204 12.8808 0.137
NP_441706.1_1 Reverse -112 -131 -1.7705 0.237
NP_440559.1_1 Reverse -197 -206 5.21127 0.145
NP_441659.2_8 Forward -205 -195 3.22496 0.169
NP_441659.2_8 Reverse -220 -230 1.94665 0.22
NP_441022.1_1 Reverse -123 -132 11.1625 0.284
NP_441807.1_10 Forward -170 -151 22.3206 0.013
NP_440779.1_5 Forward -205 -188 -14.8091 0.274
NP_442346.1_5 Forward -230 -220 6.07655 0.216
NP_440459.1_2 Reverse -218 -235 7.61033 0.285
NP_441329.1_6 Reverse -281 -300 0.524783 0.253
NP_441895.1_1 Reverse -144 -163 21.3373 0.0000809
NP_441895.1_7 Reverse -180 -199 20.2556 0.00037
NP_442162.1_9 Reverse -197 -204 3.4807 0.246
NP_442162.1_9 Forward -204 -197 3.38237 0.276
NP_442140.1_1 Forward -384 -365 17.8136 0.192
NP_442140.1_3 Forward -228 -218 9.12481 0.111
NP_442140.1_3 Reverse -221 -231 7.74818 0.13
NP_441609.1_1 Reverse -82 -101 -2.0655 0.278
NP_441813.1_5 Forward -207 -197 2.63497 0.182
NP_442497.1_10 Reverse -197 -206 -1.18024 0.256
NP_441239.1_1 Forward -51 -32 30.0887 0.000201
NP_441239.1_1 Forward -33 -14 19.6656 0.0183
NP_441239.1_7 Forward -34 -15 18.1907 0.0791
NP_441239.1_9 Reverse -218 -230 12.1337 0.0494
NP_441239.1_9 Forward -231 -219 11.1504 0.0648
NP_441951.1_9 Reverse -161 -180 1.0811 0.254
NP_442627.1_4 Forward -48 -30 19.5778 0.067
NP_440624.1_5 Reverse -72 -90 6.70333 0.298
NP_440945.1_1 Reverse -171 -190 8.55425 0.232
NP_441874.1_1 Reverse -54 -68 8.55439 0.298
NP_442216.1_4 Forward -72 -64 8.08217 0.255
NP_442052.1_3 Reverse -264 -283 9.73422 0.265
NP_441249.1_1 Forward -397 -378 1.47442 0.257
NP_442402.1_4 Reverse -174 -193 -7.96609 0.278
NP_441084.1_6 Forward -231 -217 9.15021 0.292
NP_441843.2_9 Forward -319 -301 9.71393 0.27
NP_442923.1_6 Forward -89 -75 12.5211 0.203
NP_442039.1_7 Reverse -192 -202 9.32148 0.257
NP_442696.1_6 Forward -121 -102 -13.1769 0.265
NP_442053.1_1 Forward -205 -196 3.83464 0.285
NP_440505.1_3 Reverse -194 -204 5.28991 0.236
NP_442532.1_2 Forward -89 -70 7.30471 0.201
NP_441011.1_8 Reverse -197 -206 8.55452 0.144
NP_441011.1_8 Forward -228 -219 5.01461 0.289
NP_442533.1_1 Reverse -151 -170 -10.817 0.235
NP_442533.1_6 Forward -229 -220 4.62128 0.179
NP_442541.1_10 Forward -357 -343 11.897 0.182
NP_440854.1_1 Forward -52 -33 9.11906 0.152
NP_439944.1_9 Forward -204 -194 6.76487 0.168
NP_440816.1_2 Forward -93 -74 11.1788 0.202
NP_440816.1_7 Forward -379 -360 10.0292 0.252
NP_441028.1_6 Forward -383 -373 7.74772 0.218
NP_442202.1_10 Forward -230 -216 4.62115 0.256
NP_441527.1_4 Reverse -380 -399 -3.29489 0.164
NP_441527.1_4 Reverse -58 -77 -11.7937 0.284
NP_441527.1_4 Forward -90 -71 -12.4621 0.288
NP_441106.1_1 Reverse -219 -228 4.32629 0.227
NP_440480.1_8 Reverse -222 -235 15.7522 0.29
NP_441286.1_1 Reverse -195 -207 -4.18925 0.152
NP_442674.1_2 Forward -93 -74 20.354 0.0819
NP_441021.1_1 Forward -374 -355 -9.047 0.206
NP_441463.1_3 Reverse -145 -164 -7.17871 0.255
NP_441401.1_1 Forward -91 -72 11.7992 0.201
NP_441836.1_2 Reverse -214 -233 -3.04881 0.233
NP_440358.1_8 Forward -224 -205 -1.96717 0.29
NP_440114.1_10 Reverse -220 -234 7.17775 0.243
NP_440293.1_9 Reverse -343 -357 15.6928 0.159
NP_439910.1_2 Forward -213 -196 -22.0856 0.207
NP_442680.1_5 Forward -149 -130 -1.00237 0.297
NP_442680.1_5 Forward -49 -30 -1.19775 0.299
NP_442680.1_7 Reverse -260 -279 -6.49039 0.265
NP_442582.1_3 Forward -88 -74 15.1948 0.196
YP_003858595.1_5 Forward -155 -136 15.0441 0.0144
NP_441159.1_8 Reverse -24 -43 0.293673 0.236
NP_440554.1_4 Forward -228 -218 5.87989 0.129
NP_441885.1_5 Reverse -196 -206 -1.59326 0.273
NP_442310.1_5 Forward -324 -305 10.3242 0.237
NP_442341.1_7 Forward -220 -206 1.86788 0.278
NP_441756.1_5 Forward -109 -90 -2.26216 0.272
NP_441173.1_9 Reverse -85 -93 14.0803 0.17
NP_440191.1_4 Forward -382 -372 12.5664 0.291
NP_442638.1_2 Forward -34 -15 23.5989 0.0136
NP_441207.1_7 Reverse -245 -259 13.1279 0.229
NP_441207.1_7 Reverse -244 -258 11.1917 0.245
NP_440175.1_4 Forward -365 -346 -12.8819 0.237
NP_442214.1_1 Forward -161 -142 6.88262 0.298
NP_441105.1_3 Reverse -349 -368 -6.98204 0.243
NP_441105.1_3 Reverse -361 -380 -8.26035 0.269
NP_440216.1_1 Reverse -155 -169 -12.2918 0.256
NP_440216.1_9 Reverse -222 -231 5.89959 0.289
NP_442371.1_1 Reverse -242 -252 17.0891 0.086
NP_442371.1_1 Reverse -289 -299 16.5975 0.137
NP_441226.1_7 Reverse -197 -204 9.77352 0.131
NP_441111.1_7 Forward -204 -196 -0.668896 0.274
NP_441430.1_2 Forward -250 -231 1.67108 0.14
NP_440261.1_5 Reverse -221 -234 -4.50394 0.151
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTACGACCATTGACCTTTTTTCCACCGTCATAGCCAGGTTCTTGGCCAGTTCAAGCCCTTTTGAGTGACTGTGAATCTAAACAACCGGCACTAGGGTGAGTATTTCTTCCAGCTTTGAGCCGAACTTTCTCACGGAAGATACGGTTTAATTTTTTCCAGGTACCATCTTCGTGCCATGGCTGGAAATAACCATAGACCGTTCGCCATTTAGGAAAATCGTGGGGTACAAGTCGCCAGGCACACCCCGTTCTGAGCATGTAAAAAGCAGAAAGTTTTAGTGGTCAGAAAAAGCCCACGAGCTTACCAGTTGGTAAAAGTTAAGAAATTTTAACTCCCCGTTTTCACTGCAATTATGAGAAGATAATGAAAAATGAGATGATCATGAAAGACCATTATCACT

CDS

ATGGCAACATCATTTGCTTCCCGGGGAGGACTGCTGGCGTCTGGTTTGGCGATCGCCTTTTGGCTGACCGGTTGTGGCACGGCGGAAGTCACGACATCCAATGCTCCCAGCGAAGAAGTGACAGCCGTAACCACAGAAGTCCAGGGGGAAACAGAGGAGAAAAAGAAGGTTTTAACCACCTTCACCGTATTGGCCGACATGGTCCAGAATGTTGCCGGAGACAAGTTAGTGGTGGAATCCATCACTCGCATTGGTGCAGAGATCCACGGTTATGAGCCGACTCCCAGTGACATTGTCAAGGCTCAGGACGCAGACTTAATCCTTTACAACGGCATGAACCTAGAGCGTTGGTTCGAGCAATTTTTGGGCAACGTGAAGGATGTGCCCTCTGTGGTGCTAACGGAAGGCATCGAACCGATTCCGATCGCCGACGGCCCCTATACCGATAAGCCCAATCCCCACGCCTGGATGTCGCCCCGTAATGCCCTGGTCTATGTGGAAAATATCCGCCAAGCCTTCGTCGAACTTGACCCGGACAATGCCAAATATTACAACGCCAATGCAGCAGTCTACAGCGAGCAGTTAAAGGCGATCGATCGCCAACTGGGAGCGGATTTGGAACAAGTGCCCGCCAACCAGCGGTTTTTGGTGAGTTGCGAAGGAGCGTTTTCCTATTTGGCCAGAGATTACGGTATGGAGGAGATTTACATGTGGCCAATTAATGCCGAACAGCAGTTTACCCCCAAGCAAGTGCAAACCGTGATTGAGGAGGTGAAAACCAATAATGTACCAACAATCTTTTGTGAAAGTACCGTCAGCGATAAGGGGCAAAAACAGGTAGCCCAGGCCACCGGCGCTCGCTTTGGCGGCAATCTCTATGTTGACTCCCTTTCCACAGAGGAAGGCCCTGTGCCCACCTTTTTAGATTTGCTGGAATATGATGCCCGGGTGATTACCAACGGTCTTTTGGCCGGTACCAATGCCCAGCAATGA

Protein

MATSFASRGGLLASGLAIAFWLTGCGTAEVTTSNAPSEEVTAVTTEVQGETEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKDVPSVVLTEGIEPIPIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARFGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLLAGTNAQQ