Your browser is old and dusty. Try Google Chrome!

Details for sll1596

ORF sll1596
Accession NP_441241.1
Symbol kaiB2
Category Other
Definition circadian clock protein KaiB homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -242 -228 -1.27871 0.255
NP_440795.1_7 Forward -242 -235 14.6904 0.0123
NP_440795.1_7 Reverse -235 -242 14.6904 0.0123
NP_441453.1_4 Reverse -234 -242 16.539 0.00633
NP_441453.1_4 Forward -243 -235 16.539 0.00633
NP_442151.1_6 Forward -243 -229 17.8958 0.00866
NP_442151.1_6 Reverse -234 -248 13.4709 0.0512
NP_440226.1_1 Reverse -234 -253 15.9291 0.0222
NP_440226.1_1 Forward -243 -224 3.14605 0.237
NP_441630.1_3 Reverse -226 -245 11.8975 0.0736
NP_441630.1_3 Forward -173 -154 9.83255 0.0942
NP_442744.1_8 Forward -243 -224 -5.21209 0.297
NP_442173.1_1 Forward -242 -234 15.4574 0.00633
NP_442173.1_1 Reverse -235 -243 15.4574 0.00633
NP_442752.1_4 Forward -243 -236 13.8055 0.0199
NP_442752.1_4 Reverse -234 -241 13.8055 0.0199
NP_443027.1_4 Forward -245 -235 15.3197 0.0437
NP_441812.1_3 Reverse -233 -247 17.8958 0.0479
NP_442975.1_10 Forward -247 -233 20.3534 0.00216
NP_442975.1_10 Reverse -230 -244 1.37564 0.299
NP_440784.1_7 Forward -242 -235 15.9687 0.0123
NP_440784.1_7 Reverse -235 -242 15.9687 0.0123
NP_442000.2_6 Forward -326 -307 19.174 0.0799
NP_442062.1_8 Forward -243 -233 17.3846 0.00193
NP_442062.1_8 Reverse -234 -244 10.3048 0.0493
NP_440761.1_4 Forward -248 -229 -13.0786 0.257
NP_440304.1_4 Forward -245 -235 18.9579 0.00406
NP_440304.1_4 Reverse -232 -242 1.84832 0.299
NP_442242.1_4 Forward -242 -235 14.3954 0.0124
NP_442242.1_4 Reverse -235 -242 14.3954 0.0124
NP_440044.1_8 Reverse -235 -254 -1.37718 0.244
NP_441581.1_9 Forward -263 -244 5.29938 0.296
NP_442602.1_3 Forward -384 -365 8.45592 0.0959
NP_441620.1_3 Forward -250 -231 15.5357 0.227
NP_442359.1_6 Forward -368 -349 17.699 0.0876
NP_441208.1_9 Reverse -231 -245 9.34103 0.215
NP_441208.1_9 Reverse -214 -228 4.71948 0.291
NP_441594.1_6 Forward -377 -358 1.17943 0.272
NP_442110.1_7 Reverse -234 -248 9.14437 0.0755
NP_441083.1_5 Forward -243 -233 20.3345 0.00053
NP_441083.1_5 Reverse -234 -244 11.2881 0.0159
NP_442827.1_8 Reverse -226 -245 12.7816 0.0438
NP_441149.1_7 Reverse -146 -165 3.73603 0.267
NP_441434.1_7 Reverse -236 -250 5.99778 0.225
NP_441738.1_2 Forward -241 -234 15.28 0.0102
NP_441738.1_2 Reverse -236 -243 15.28 0.0102
NP_441558.1_5 Forward -245 -226 13.0775 0.0626
NP_440209.1_1 Reverse -234 -242 18.1123 0.00295
NP_440209.1_1 Forward -243 -235 18.1123 0.00295
NP_440655.1_2 Reverse -235 -254 8.16093 0.274
NP_442889.1_8 Forward -246 -232 18.7801 0.0097
NP_440178.1_7 Reverse -233 -252 15.6341 0.00521
NP_440178.1_7 Reverse -216 -235 -19.8634 0.181
NP_440178.1_7 Forward -244 -225 -22.8133 0.279
NP_441716.1_1 Reverse -366 -380 6.6861 0.191
NP_441327.1_1 Forward -122 -103 3.15617 0.277
NP_441598.1_1 Forward -29 -10 7.17762 0.295
NP_442111.1_4 Reverse -233 -247 3.8345 0.229
NP_440906.1_5 Forward -242 -235 15.8704 0.0124
NP_440906.1_5 Reverse -235 -242 15.8704 0.0124
NP_440747.1_10 Reverse -231 -243 14.887 0.00223
NP_440747.1_10 Forward -246 -234 -1.92764 0.0192
NP_441130.1_10 Reverse -232 -246 6.6861 0.181
NP_441486.1_1 Forward -246 -232 6.29277 0.0344
NP_441486.1_1 Reverse -231 -245 -2.55701 0.175
NP_441880.2_10 Reverse -235 -253 14.8671 0.111
NP_442634.1_4 Reverse -232 -246 -3.34366 0.161
NP_442634.1_4 Forward -245 -231 -3.44199 0.161
NP_440403.1_4 Forward -235 -216 -8.752 0.26
NP_441014.1_10 Reverse -365 -384 -3.14789 0.294
NP_442848.1_1 Forward -249 -235 5.30946 0.0854
NP_442848.1_9 Forward -374 -355 12.3892 0.144
NP_443018.1_3 Forward -242 -235 14.8871 0.0123
NP_443018.1_3 Reverse -235 -242 14.8871 0.0123
NP_441316.1_7 Forward -245 -230 -0.118434 0.199
NP_441634.1_8 Reverse -232 -246 5.1128 0.114
NP_440376.1_1 Forward -243 -234 19.4693 0.000692
NP_440376.1_1 Reverse -234 -243 19.4693 0.000692
NP_440376.1_1 Forward -375 -366 3.83464 0.19
NP_440376.1_1 Forward -226 -217 1.86802 0.238
NP_441588.1_4 Forward -241 -231 15.9097 0.0369
NP_441588.1_4 Reverse -236 -246 6.66654 0.185
NP_442687.1_7 Forward -244 -234 9.02648 0.0994
NP_442687.1_7 Reverse -233 -243 8.92815 0.0994
NP_442687.1_7 Forward -227 -217 8.33817 0.109
NP_442530.1_2 Reverse -68 -78 12.1731 0.28
NP_441422.1_7 Reverse -232 -249 -3.5994 0.235
NP_440533.1_6 Reverse -199 -218 12.3892 0.238
NP_442658.1_1 Forward -245 -235 15.9091 0.00966
NP_442658.1_1 Reverse -232 -242 6.76441 0.214
NP_440617.1_6 Forward -326 -307 8.16093 0.258
NP_442205.1_9 Forward -249 -233 14.9065 0.0333
NP_440656.1_8 Forward -192 -173 -9.53865 0.288
NP_441414.1_9 Forward -243 -224 17.994 0.00979
NP_441487.1_9 Reverse -233 -252 0.786102 0.217
NP_442937.1_5 Forward -248 -229 7.66927 0.244
NP_442321.1_1 Forward -245 -226 -5.9004 0.228
NP_441958.1_5 Forward -244 -234 21.2195 0.000805
NP_441958.1_5 Reverse -233 -243 12.2714 0.00183
NP_442836.1_2 Forward -223 -204 17.2074 0.225
NP_442816.1_7 Reverse -328 -347 5.29938 0.251
NP_439905.1_1 Forward -242 -229 9.16406 0.221
NP_443001.1_5 Reverse -336 -355 15.6341 0.152
NP_440984.1_7 Reverse -229 -243 20.7474 0.00322
NP_440984.1_7 Forward -248 -234 6.98109 0.192
NP_439990.1_5 Reverse -229 -242 7.59077 0.19
NP_442911.1_2 Reverse -224 -243 -0.983855 0.0804
NP_442911.1_2 Forward -253 -234 -10.3253 0.276
NP_440153.1_5 Reverse -235 -249 3.93283 0.199
NP_440858.1_1 Forward -44 -25 -1.08219 0.257
NP_442064.1_1 Reverse -229 -248 -12.7836 0.28
NP_443055.1_6 Forward -243 -225 2.67334 0.205
NP_443055.1_6 Forward -251 -233 1.5917 0.227
NP_440993.1_2 Forward -248 -232 1.82849 0.276
NP_441294.1_7 Forward -247 -233 16.1618 0.0171
NP_441646.1_1 Reverse -227 -246 3.53937 0.206
NP_442438.1_10 Forward -248 -234 2.85119 0.168
NP_441000.1_6 Reverse -233 -247 -4.81863 0.252
NP_440484.1_3 Forward -245 -231 10.4227 0.242
NP_440147.1_4 Reverse -232 -245 20.1771 0.00228
NP_440147.1_4 Forward -245 -232 3.75586 0.181
NP_441550.1_8 Forward -245 -235 17.4824 0.00754
NP_441550.1_8 Reverse -232 -242 14.6309 0.0132
NP_441916.1_7 Reverse -234 -244 18.9579 0.00144
NP_441916.1_7 Forward -243 -233 10.3048 0.0261
NP_441916.1_10 Forward -251 -232 10.2259 0.15
NP_441916.1_10 Forward -377 -358 6.58763 0.202
NP_441916.1_10 Forward -220 -201 0.982764 0.27
NP_440345.1_3 Reverse -181 -195 14.6219 0.215
NP_440465.1_10 Forward -378 -359 0.786102 0.284
NP_441041.1_4 Reverse -234 -253 -3.63879 0.124
NP_441041.1_4 Reverse -366 -385 -12.8819 0.276
NP_441041.1_7 Forward -246 -234 18.3015 0.00558
NP_442642.1_9 Forward -250 -233 6.33202 0.192
NP_442396.1_5 Reverse -230 -243 21.1604 0.00421
NP_442996.1_1 Forward -271 -252 11.0289 0.21
NP_441725.1_5 Reverse -235 -245 8.92815 0.0553
NP_441725.1_5 Forward -242 -232 2.04498 0.115
NP_441725.1_5 Reverse -367 -377 -0.609952 0.265
NP_439966.1_7 Forward -245 -235 13.8442 0.0234
NP_439966.1_7 Reverse -232 -242 7.25606 0.15
NP_439966.1_9 Forward -245 -236 0.983037 0.253
NP_442941.1_3 Forward -242 -232 11.0914 0.0116
NP_442941.1_3 Reverse -235 -245 10.9931 0.0116
NP_440289.1_2 Forward -246 -233 11.7207 0.018
NP_440260.1_8 Forward -378 -360 -6.86402 0.295
NP_440260.1_8 Reverse -225 -243 -7.35568 0.295
NP_441514.1_6 Forward -294 -287 12.7238 0.29
NP_442281.1_1 Forward -248 -234 13.9619 0.0224
NP_442281.1_1 Reverse -229 -243 8.25877 0.0832
NP_442281.1_1 Reverse -361 -375 2.5556 0.263
NP_441334.1_7 Forward -245 -226 -11.0136 0.12
NP_441079.1_7 Reverse -251 -270 -6.49113 0.278
NP_442256.1_2 Forward -245 -227 -6.96235 0.214
NP_440437.1_1 Forward -167 -148 -2.16383 0.212
NP_440647.1_9 Forward -245 -227 3.46073 0.275
NP_441457.1_7 Reverse -232 -251 -0.688862 0.293
NP_440498.1_1 Reverse -225 -243 1.00246 0.211
NP_441644.1_6 Reverse -234 -244 19.0557 0.000803
NP_441644.1_6 Forward -243 -233 17.3841 0.00127
NP_442215.1_2 Forward -245 -229 2.91013 0.107
NP_442215.1_2 Reverse -363 -379 -1.71142 0.187
NP_442029.1_10 Reverse -219 -238 3.93269 0.297
NP_440253.1_2 Reverse -234 -252 6.11567 0.0856
NP_440929.1_8 Forward -243 -234 19.2726 0.000701
NP_440929.1_8 Reverse -234 -243 19.2726 0.000701
NP_442933.1_10 Forward -243 -234 17.601 0.00325
NP_442933.1_10 Reverse -234 -243 17.601 0.00325
NP_442671.1_2 Reverse -299 -318 3.83007 0.182
NP_441751.2_8 Reverse -235 -249 2.75286 0.0759
NP_442554.1_8 Reverse -235 -245 19.1546 0.00369
NP_442554.1_8 Forward -242 -232 15.3197 0.00882
NP_442554.1_8 Reverse -367 -377 2.83163 0.253
NP_442554.1_8 Forward -374 -364 2.63497 0.265
NP_441762.1_7 Reverse -233 -245 2.59558 0.0676
NP_441762.1_7 Forward -244 -232 0.530633 0.0747
NP_442142.1_4 Forward -246 -233 11.6217 0.054
NP_442142.1_4 Reverse -231 -244 3.55864 0.251
NP_442292.1_1 Forward -242 -233 18.486 0.00229
NP_442292.1_1 Reverse -235 -244 17.5026 0.00435
NP_441024.1_7 Reverse -222 -240 13.3914 0.179
NP_442476.1_6 Forward -242 -228 4.22782 0.146
NP_442016.1_10 Reverse -190 -209 7.86593 0.259
NP_442381.1_2 Forward -301 -287 18.3875 0.212
NP_442381.1_8 Forward -246 -227 -5.01543 0.14
NP_443009.1_5 Reverse -233 -244 14.5128 0.02
NP_443009.1_5 Forward -244 -233 10.1862 0.0792
NP_443009.1_5 Reverse -365 -376 5.07306 0.218
NP_443009.1_5 Forward -376 -365 4.58141 0.239
NP_441715.1_4 Forward -242 -232 7.94484 0.107
NP_441715.1_4 Reverse -235 -245 7.25653 0.108
NP_440881.1_6 Forward -329 -310 14.1591 0.25
NP_442076.1_5 Forward -305 -286 5.211 0.293
NP_441198.1_8 Forward -245 -235 15.4199 0.0427
NP_441198.1_8 Forward -377 -367 10.4392 0.271
NP_440464.1_10 Forward -242 -232 13.0082 0.169
NP_441468.1_1 Forward -242 -235 15.8704 0.0124
NP_441468.1_1 Reverse -235 -242 15.8704 0.0124
NP_442099.1_7 Forward -252 -238 19.3708 0.253
NP_441020.2_6 Forward -245 -228 11.3469 0.123
NP_441020.2_6 Reverse -232 -249 8.69197 0.191
NP_441015.1_10 Forward -248 -229 3.14605 0.14
NP_441673.1_1 Forward -243 -234 20.8459 0.000698
NP_441673.1_1 Reverse -234 -243 20.8459 0.000698
NP_442253.1_5 Forward -378 -361 12.1336 0.0647
NP_441826.1_2 Forward -249 -235 -4.13031 0.292
NP_441393.1_2 Forward -230 -211 10.6343 0.293
NP_442868.1_6 Reverse -232 -242 9.81313 0.038
NP_442868.1_6 Forward -245 -235 8.63316 0.0555
NP_441056.1_1 Reverse -234 -253 -9.44032 0.3
NP_441612.1_2 Forward -243 -233 8.54929 0.21
NP_442427.1_8 Forward -252 -233 17.699 0.0442
NP_441911.1_7 Reverse -314 -333 -9.73604 0.194
NP_441911.1_7 Forward -53 -34 -19.0774 0.275
NP_442808.1_1 Forward -244 -234 8.73102 0.0481
NP_442808.1_1 Reverse -233 -243 8.63269 0.0481
NP_440145.1_3 Forward -253 -234 18.9773 0.00887
NP_442050.1_5 Forward -245 -235 17.1874 0.00812
NP_442050.1_5 Reverse -232 -242 7.64939 0.243
NP_442342.1_9 Reverse -364 -380 7.33503 0.207
NP_441114.1_3 Forward -373 -364 7.66954 0.231
NP_440558.1_2 Forward -378 -359 4.12936 0.152
NP_441878.1_6 Forward -376 -366 10.5014 0.0176
NP_441878.1_6 Forward -244 -234 10.5014 0.0176
NP_441878.1_6 Reverse -365 -375 10.4031 0.0176
NP_441878.1_6 Reverse -233 -243 10.4031 0.0176
NP_441036.1_8 Forward -244 -234 15.713 0.00724
NP_441036.1_8 Reverse -233 -243 8.33817 0.174
NP_441557.1_5 Forward -243 -234 19.9609 0.000699
NP_441557.1_5 Reverse -234 -243 19.9609 0.000699
NP_441445.1_1 Forward -252 -233 5.01433 0.181
NP_441445.1_1 Reverse -357 -376 0.58944 0.272
NP_442066.2_9 Reverse -230 -243 11.1307 0.154
NP_442066.2_9 Forward -247 -234 9.95071 0.158
NP_441308.1_8 Forward -245 -235 12.4681 0.218
NP_442830.1_5 Reverse -365 -379 -1.86927 0.3
NP_442183.1_1 Reverse -234 -248 15.7325 0.0187
NP_441407.1_5 Forward -253 -234 4.81767 0.238
NP_442397.1_9 Forward -243 -224 7.07928 0.246
NP_442444.1_6 Forward -251 -233 13.6944 0.237
NP_441549.1_9 Reverse -230 -248 -5.88071 0.198
NP_442170.1_5 Reverse -234 -253 5.11266 0.154
NP_442347.1_2 Forward -242 -233 12.4878 0.056
NP_442347.1_2 Reverse -235 -244 3.34298 0.284
NP_442645.1_2 Forward -251 -232 -1.47551 0.0487
NP_441037.1_4 Forward -245 -235 16.5761 0.0168
NP_441037.1_4 Reverse -232 -242 7.9999 0.237
NP_442317.1_6 Reverse -229 -248 11.1109 0.202
NP_441633.1_3 Reverse -232 -245 10.8357 0.0286
NP_440136.1_2 Forward -242 -235 15.9687 0.0123
NP_440136.1_2 Reverse -235 -242 15.9687 0.0123
NP_442998.1_5 Forward -326 -316 11.0914 0.196
NP_442998.1_10 Forward -241 -234 15.5754 0.0102
NP_442998.1_10 Reverse -236 -243 15.5754 0.0102
NP_440299.1_1 Reverse -230 -243 12.9984 0.0319
NP_441799.1_1 Reverse -230 -244 16.8135 0.0129
NP_441799.1_1 Forward -247 -233 11.5037 0.0575
NP_441799.1_1 Reverse -286 -300 3.8339 0.279
NP_441007.1_10 Forward -248 -235 14.4739 0.0499
NP_441007.1_10 Reverse -229 -242 8.57408 0.112
NP_442201.1_10 Reverse -223 -242 -12.4886 0.268
NP_440256.1_1 Reverse -231 -250 -3.73712 0.138
NP_442283.1_4 Forward -246 -227 16.5191 0.26
NP_440915.1_6 Forward -247 -233 4.52282 0.0953
NP_440915.1_6 Reverse -230 -244 2.85119 0.111
NP_440915.1_6 Forward -379 -365 -0.0987402 0.182
NP_441704.1_8 Reverse -223 -242 7.17681 0.247
NP_441464.1_8 Reverse -234 -248 10.4227 0.178
NP_442993.1_1 Reverse -234 -250 -2.00642 0.105
NP_442386.1_9 Reverse -233 -242 13.8639 0.0289
NP_442386.1_9 Forward -244 -235 6.39082 0.219
NP_441750.1_4 Reverse -216 -235 2.75272 0.245
NP_441340.1_5 Forward -242 -235 15.6737 0.0124
NP_441340.1_5 Reverse -235 -242 15.6737 0.0124
NP_440161.1_3 Reverse -70 -89 8.94757 0.262
NP_441160.1_5 Reverse -24 -43 4.81767 0.271
NP_440586.1_8 Forward -242 -235 13.2151 0.026
NP_440586.1_8 Reverse -235 -242 13.2151 0.026
NP_442251.1_6 Forward -242 -235 15.2804 0.0124
NP_442251.1_6 Reverse -235 -242 15.2804 0.0124
NP_441262.1_3 Reverse -234 -241 14.7888 0.0223
NP_441262.1_3 Forward -243 -236 14.7888 0.0223
NP_443051.1_1 Forward -244 -235 19.5676 0.00335
NP_443051.1_1 Reverse -233 -242 10.4228 0.00754
NP_440439.1_1 Forward -246 -233 3.16588 0.119
NP_440372.1_2 Forward -242 -235 16.3621 0.0124
NP_440372.1_2 Reverse -235 -242 16.3621 0.0124
NP_442384.1_10 Forward -243 -230 15.8506 0.00946
NP_442384.1_10 Reverse -366 -379 5.72248 0.121
NP_442384.1_10 Forward -78 -65 2.67422 0.216
NP_442790.1_4 Reverse -225 -244 -9.24366 0.182
NP_442262.1_10 Forward -242 -235 14.1988 0.0123
NP_442262.1_10 Reverse -235 -242 14.1988 0.0123
NP_441689.1_5 Forward -245 -235 8.43603 0.132
NP_441689.1_5 Reverse -232 -242 5.78111 0.197
NP_440344.1_10 Forward -250 -233 -7.33598 0.116
NP_440075.1_2 Forward -339 -320 6.68596 0.249
NP_440189.1_10 Reverse -223 -242 14.6508 0.13
NP_441965.1_10 Forward -246 -230 12.4482 0.105
NP_440297.1_9 Reverse -367 -377 9.22315 0.0917
NP_440297.1_9 Forward -374 -364 -0.118297 0.282
NP_440297.1_9 Forward -242 -232 -0.118297 0.282
NP_440297.1_9 Reverse -235 -245 -0.314959 0.282
NP_440350.1_5 Reverse -81 -100 -2.16383 0.221
NP_440999.1_9 Forward -247 -233 4.42448 0.116
NP_440888.1_2 Reverse -234 -248 15.5352 0.0102
NP_440888.1_2 Forward -243 -229 9.73373 0.116
NP_442454.1_1 Reverse -246 -264 14.7766 0.221
NP_440600.1_4 Reverse -226 -244 6.50899 0.0974
NP_440491.1_1 Forward -246 -227 12.2772 0.157
NP_441543.1_2 Forward -242 -233 16.9127 0.00359
NP_441543.1_2 Reverse -235 -244 15.9293 0.00518
NP_442845.1_2 Reverse -228 -242 7.66941 0.195
NP_442845.1_2 Forward -249 -235 4.32615 0.261
NP_442845.1_2 Reverse -360 -374 3.24451 0.298
NP_441469.1_8 Reverse -365 -374 10.7178 0.202
NP_441469.1_8 Forward -244 -235 6.5879 0.227
NP_441469.1_8 Reverse -233 -242 6.48957 0.227
NP_443064.1_6 Forward -243 -233 12.5669 0.0796
NP_443064.1_6 Reverse -234 -244 10.8217 0.13
NP_442578.1_7 Forward -242 -235 14.5921 0.026
NP_442578.1_7 Reverse -235 -242 14.5921 0.026
NP_440710.1_1 Reverse -226 -244 -7.749 0.244
NP_441462.1_2 Reverse -234 -244 20.2362 0.000805
NP_441462.1_2 Forward -243 -233 11.5831 0.00406
NP_441621.1_7 Reverse -232 -246 -5.31028 0.25
NP_443062.1_1 Reverse -234 -252 7.18082 0.182
NP_442204.1_5 Reverse -224 -243 6.4893 0.142
NP_442204.1_5 Reverse -356 -375 2.45773 0.212
NP_442697.1_1 Forward -251 -232 7.17762 0.288
NP_440255.1_9 Forward -109 -90 16.281 0.219
NP_440516.1_8 Forward -243 -234 16.9127 0.00442
NP_440516.1_8 Reverse -234 -243 16.9127 0.00442
NP_442428.1_4 Reverse -365 -384 7.66927 0.184
NP_442428.1_5 Forward -242 -235 15.8704 0.0124
NP_442428.1_5 Reverse -235 -242 15.8704 0.0124
NP_441443.1_2 Reverse -358 -377 -2.0655 0.26
NP_441267.1_3 Reverse -82 -100 5.91824 0.299
NP_440673.1_3 Forward -241 -234 12.4288 0.0426
NP_440673.1_3 Reverse -236 -243 12.4288 0.0426
NP_440673.1_7 Reverse -223 -242 13.1758 0.097
NP_441052.1_2 Forward -243 -233 19.9412 0.00106
NP_441052.1_2 Reverse -234 -244 10.4031 0.0285
NP_441052.1_2 Reverse -366 -376 2.33998 0.209
NP_442219.1_9 Forward -242 -233 17.7976 0.00718
NP_442219.1_9 Reverse -235 -244 8.25953 0.0681
NP_440436.1_4 Forward -242 -233 17.2072 0.00233
NP_440436.1_4 Reverse -235 -244 9.24241 0.0871
NP_441884.1_8 Reverse -348 -367 -7.4737 0.251
NP_441884.1_9 Forward -246 -227 -4.52377 0.0594
NP_440648.1_1 Reverse -234 -253 4.42435 0.226
NP_441719.1_4 Forward -242 -235 16.3621 0.0124
NP_441719.1_4 Reverse -235 -242 16.3621 0.0124
NP_441733.1_10 Forward -246 -233 8.77074 0.135
NP_441004.1_1 Reverse -26 -45 -14.9469 0.271
NP_442366.1_5 Reverse -231 -241 15.4175 0.0374
NP_440296.1_6 Reverse -255 -273 11.3655 0.295
NP_440296.1_10 Forward -246 -227 -14.5535 0.27
NP_441115.1_4 Forward -244 -226 14.0797 0.0628
NP_440328.1_4 Reverse -228 -247 4.03102 0.17
NP_443054.1_2 Reverse -232 -246 2.94952 0.24
NP_443054.1_2 Forward -377 -363 -0.000409212 0.283
NP_441851.1_10 Reverse -233 -243 15.8113 0.00552
NP_441851.1_10 Forward -244 -234 8.53483 0.114
NP_441851.1_10 Forward -376 -366 4.89658 0.24
NP_441851.1_10 Reverse -365 -375 4.3066 0.277
NP_441668.1_4 Reverse -224 -243 -2.75381 0.294
NP_442515.1_1 Reverse -233 -247 5.21113 0.107
NP_442515.1_1 Forward -244 -230 4.71948 0.107
NP_442689.1_8 Reverse -244 -261 2.59545 0.18
NP_442689.1_8 Reverse -182 -199 -4.77938 0.267
NP_441349.1_10 Reverse -224 -243 2.3594 0.075
NP_441349.1_10 Forward -168 -149 -8.06369 0.266
NP_441409.1_6 Reverse -228 -247 -9.14533 0.18
NP_440432.1_9 Reverse -235 -250 14.5329 0.014
NP_440474.1_8 Reverse -235 -249 10.0287 0.149
NP_440474.1_8 Reverse -310 -324 4.8172 0.266
NP_441596.1_7 Forward -134 -115 8.35759 0.258
NP_441124.1_5 Reverse -249 -259 12.3397 0.225
NP_442450.1_5 Reverse -232 -242 7.55152 0.13
NP_440195.1_5 Forward -249 -230 4.81767 0.268
NP_442243.1_1 Reverse -56 -74 -3.02983 0.298
NP_441570.1_1 Forward -243 -225 -6.86402 0.0823
NP_441570.1_1 Reverse -234 -252 -10.0106 0.156
NP_440078.1_10 Reverse -366 -385 3.6377 0.26
NP_441078.1_4 Forward -243 -234 19.6659 0.0007
NP_441078.1_4 Reverse -234 -243 19.6659 0.0007
NP_441078.1_4 Reverse -366 -375 5.50626 0.111
NP_441078.1_4 Forward -375 -366 -1.6719 0.266
NP_442729.1_8 Reverse -230 -243 10.639 0.125
NP_441663.1_4 Reverse -211 -230 18.3873 0.236
NP_440526.1_3 Reverse -235 -246 11.6612 0.0646
NP_440526.1_3 Forward -242 -231 1.04151 0.267
NP_441432.1_8 Reverse -233 -242 16.8143 0.00595
NP_441432.1_8 Forward -244 -235 16.8143 0.00595
NP_442320.1_8 Forward -249 -235 7.37441 0.0195
NP_442320.1_8 Reverse -228 -242 -4.62196 0.177
NP_442344.1_7 Forward -242 -223 0.491109 0.0936
NP_442344.1_7 Reverse -235 -254 -6.88371 0.172
NP_441732.1_2 Forward -247 -231 -15.3794 0.145
NP_441732.1_2 Reverse -230 -246 -16.5594 0.174
NP_440760.1_1 Reverse -234 -253 -11.3086 0.0851
NP_440760.1_1 Forward -243 -224 -12.2919 0.0927
NP_442510.1_5 Reverse -225 -244 13.4708 0.229
NP_440913.1_1 Reverse -232 -250 8.67227 0.183
NP_441072.1_2 Reverse -355 -374 8.45592 0.24
NP_442400.1_10 Forward -259 -246 8.65605 0.278
NP_442489.1_7 Forward -243 -234 20.1576 0.000695
NP_442489.1_7 Reverse -234 -243 20.1576 0.000695
NP_442489.1_7 Forward -375 -366 -1.6719 0.235
NP_442489.1_7 Reverse -366 -375 -1.77023 0.247
NP_440386.1_3 Forward -260 -241 -3.44213 0.221
NP_440559.1_1 Forward -242 -233 17.4043 0.00658
NP_440559.1_1 Reverse -235 -244 8.65285 0.0586
NP_441659.2_8 Reverse -234 -244 20.9245 0.000805
NP_441659.2_8 Forward -243 -233 18.1713 0.00133
NP_440860.1_8 Reverse -215 -234 13.1758 0.296
NP_442913.1_9 Reverse -228 -247 9.43923 0.22
NP_442913.1_10 Forward -252 -233 10.5209 0.0421
NP_442913.1_10 Reverse -225 -244 6.68596 0.058
NP_440708.1_6 Reverse -121 -140 -10.1286 0.277
NP_442776.1_6 Forward -245 -226 6.88262 0.297
NP_442346.1_5 Reverse -233 -243 16.6963 0.00248
NP_442346.1_5 Forward -244 -234 16.303 0.00248
NP_442346.1_5 Forward -376 -366 6.37155 0.205
NP_442346.1_5 Reverse -365 -375 6.37155 0.205
NP_440545.1_3 Reverse -362 -379 -1.33779 0.167
NP_440831.1_3 Reverse -225 -244 4.73683 0.298
NP_440459.1_2 Reverse -351 -368 10.4619 0.198
NP_442551.1_4 Forward -377 -362 7.94471 0.153
NP_442311.1_5 Reverse -353 -372 6.29264 0.245
NP_440847.1_9 Reverse -245 -264 20.1506 0.207
NP_442603.1_7 Forward -243 -229 10.422 0.126
NP_440946.1_6 Reverse -215 -234 2.85105 0.294
NP_440449.1_6 Reverse -226 -244 9.52025 0.174
NP_440449.1_6 Reverse -358 -376 5.04615 0.284
NP_441833.1_4 Forward -242 -235 15.9687 0.0124
NP_441833.1_4 Reverse -235 -242 15.9687 0.0124
NP_441329.1_3 Forward -194 -184 11.5325 0.295
NP_442162.1_9 Forward -242 -235 16.2637 0.0124
NP_442162.1_9 Reverse -235 -242 16.2637 0.0124
NP_440671.1_4 Forward -249 -235 4.91614 0.3
NP_442199.1_5 Forward -251 -232 -3.44213 0.206
NP_442140.1_3 Forward -242 -232 12.2714 0.0632
NP_442140.1_3 Reverse -235 -245 7.94484 0.124
NP_441671.1_10 Forward -254 -235 3.24438 0.232
NP_440875.1_9 Reverse -236 -246 16.8403 0.0145
NP_441813.1_5 Forward -245 -235 8.73149 0.0367
NP_441813.1_5 Reverse -232 -242 8.63316 0.0367
NP_440590.1_4 Forward -242 -229 7.88576 0.0493
NP_440590.1_4 Reverse -235 -248 2.87088 0.0788
NP_440567.1_1 Forward -242 -228 11.6026 0.0277
NP_440567.1_1 Reverse -235 -249 3.14618 0.151
NP_442497.1_10 Reverse -235 -244 17.601 0.00813
NP_442497.1_10 Forward -242 -233 10.4228 0.0087
NP_440821.1_4 Forward -245 -235 10.7964 0.0146
NP_440821.1_4 Reverse -232 -242 9.41981 0.0286
NP_441239.1_9 Forward -245 -233 14.887 0.0247
NP_441239.1_9 Forward -377 -365 11.5437 0.0589
NP_441239.1_9 Reverse -364 -376 4.5622 0.251
NP_441239.1_9 Reverse -232 -244 3.38223 0.285
NP_442627.1_4 Forward -100 -82 17.859 0.199
NP_441892.1_1 Forward -252 -235 4.07041 0.116
NP_441892.1_1 Reverse -357 -374 1.51381 0.152
NP_441769.1_3 Reverse -254 -273 -4.32786 0.245
NP_440876.1_5 Reverse -236 -255 5.211 0.283
NP_441617.1_6 Reverse -227 -246 -3.93378 0.265
NP_442052.1_8 Reverse -364 -374 12.5664 0.265
NP_440546.1_4 Reverse -234 -244 13.5365 0.0459
NP_440546.1_4 Forward -243 -233 10.046 0.109
NP_440546.1_4 Forward -375 -365 7.33119 0.246
NP_441230.1_5 Forward -248 -229 3.73603 0.193
NP_440462.1_6 Forward -245 -235 19.4496 0.00371
NP_440462.1_6 Reverse -232 -242 1.35667 0.294
NP_442899.1_4 Forward -270 -254 9.59593 0.232
NP_440868.1_4 Reverse -230 -242 8.10212 0.0602
NP_440868.1_4 Forward -247 -235 7.21714 0.0749
NP_441084.1_6 Forward -245 -231 15.9372 0.0707
NP_441084.1_6 Forward -170 -156 9.24716 0.29
NP_442923.1_6 Reverse -252 -266 18.919 0.114
NP_442039.1_4 Forward -242 -235 15.1821 0.0124
NP_442039.1_4 Reverse -235 -242 15.1821 0.0124
NP_441926.1_3 Reverse -234 -250 6.25339 0.17
NP_440825.1_7 Forward -242 -232 12.9096 0.152
NP_442837.1_3 Forward -242 -235 15.7721 0.0124
NP_442837.1_3 Reverse -235 -242 15.7721 0.0124
NP_442053.1_1 Forward -243 -234 18.3876 0.0007
NP_442053.1_1 Reverse -234 -243 18.3876 0.0007
NP_440505.1_3 Forward -245 -235 15.418 0.0114
NP_440505.1_3 Reverse -232 -242 9.22315 0.122
NP_442255.1_5 Reverse -148 -167 9.93088 0.244
NP_442844.1_5 Reverse -79 -98 4.42355 0.26
NP_440308.1_6 Forward -238 -219 5.89931 0.296
NP_442532.1_7 Reverse -234 -248 4.62115 0.171
NP_441408.2_7 Forward -245 -226 -4.32711 0.281
NP_440914.1_1 Forward -243 -233 17.5935 0.000537
NP_440914.1_1 Reverse -234 -244 16.3248 0.00196
NP_441011.1_8 Reverse -235 -244 16.6177 0.00602
NP_441011.1_8 Forward -242 -233 8.25953 0.144
NP_442101.1_10 Reverse -226 -245 -6.39206 0.189
NP_442533.1_6 Forward -243 -234 17.2076 0.00137
NP_442533.1_6 Reverse -234 -243 17.2076 0.00137
NP_442533.1_6 Reverse -366 -375 15.831 0.00468
NP_442533.1_6 Forward -375 -366 6.78456 0.103
NP_442533.1_6 Reverse -290 -299 2.65466 0.246
NP_442541.1_10 Forward -375 -361 0.883986 0.295
NP_441482.1_7 Forward -249 -235 -0.983719 0.0612
NP_441482.1_7 Forward -381 -367 -11.6035 0.275
NP_439944.1_9 Reverse -235 -245 17.7779 0.00341
NP_439944.1_9 Forward -242 -232 10.5014 0.0887
NP_442664.1_3 Reverse -352 -366 12.3893 0.246
NP_440116.1_8 Forward -242 -223 -0.39387 0.107
NP_441527.1_4 Forward -96 -77 5.39487 0.106
NP_441527.1_4 Forward -130 -111 -1.67153 0.148
NP_441527.1_8 Forward -248 -229 11.3075 0.182
NP_440115.1_6 Forward -246 -236 7.84651 0.146
NP_440608.1_6 Forward -242 -223 4.52188 0.26
NP_441602.1_3 Reverse -229 -248 -3.3438 0.245
NP_441170.1_4 Reverse -225 -243 5.72234 0.22
NP_441170.1_4 Reverse -351 -369 2.57575 0.285
NP_441972.1_5 Forward -242 -223 -5.50708 0.222
NP_441106.1_1 Forward -244 -235 18.486 0.0028
NP_441106.1_1 Reverse -233 -242 9.63616 0.0311
NP_439903.1_6 Forward -246 -227 5.2102 0.186
NP_442306.1_10 Reverse -229 -248 -19.6667 0.199
NP_441286.1_1 Reverse -233 -245 14.6903 0.00418
NP_441286.1_1 Forward -244 -232 3.48056 0.0467
NP_440670.1_8 Forward -243 -234 18.3876 0.000699
NP_440670.1_8 Reverse -234 -243 18.3876 0.000699
NP_441705.1_3 Forward -206 -187 -5.9004 0.291
NP_440886.1_3 Forward -225 -206 18.1907 0.289
NP_440886.1_7 Forward -244 -234 8.04271 0.0805
NP_440886.1_7 Reverse -233 -243 7.94438 0.0805
NP_442614.1_2 Forward -243 -229 8.06273 0.255
NP_442072.1_9 Reverse -233 -251 -3.71743 0.0374
NP_441427.1_6 Reverse -213 -231 8.18062 0.297
NP_440907.2_8 Reverse -235 -245 19.1541 0.00362
NP_440907.2_8 Forward -242 -232 7.64939 0.117
NP_441463.1_3 Reverse -187 -206 2.26107 0.119
NP_441626.1_2 Forward -242 -235 15.7721 0.0124
NP_441626.1_2 Reverse -235 -242 15.7721 0.0124
NP_442794.1_1 Reverse -230 -242 9.28209 0.0795
NP_442615.1_1 Reverse -225 -243 5.03403 0.0413
NP_442615.1_1 Forward -252 -234 -3.22577 0.159
NP_441962.1_4 Forward -248 -229 -8.35868 0.199
NP_440387.1_1 Forward -243 -227 13.1366 0.00945
NP_440387.1_1 Reverse -234 -250 6.45005 0.0282
NP_441431.1_2 Forward -246 -232 14.3553 0.0681
NP_442352.1_8 Reverse -320 -334 16.3219 0.242
NP_440358.1_8 Forward -353 -334 -1.86883 0.29
NP_440114.1_10 Reverse -234 -248 20.5508 0.00301
NP_440114.1_10 Forward -375 -361 9.83269 0.16
NP_442437.1_9 Reverse -215 -229 17.8958 0.268
NP_441510.2_7 Forward -212 -198 10.2254 0.281
NP_441510.2_7 Forward -78 -64 9.53707 0.281
NP_439988.1_3 Forward -379 -365 7.47274 0.276
NP_441237.1_9 Forward -242 -232 14.828 0.0242
NP_441311.1_2 Reverse -228 -242 12.9786 0.23
NP_439910.1_2 Forward -251 -234 -13.4325 0.162
NP_439910.1_2 Forward -86 -69 -14.3175 0.183
NP_442867.1_3 Reverse -234 -253 -0.688862 0.296
NP_442867.1_8 Reverse -347 -366 8.25926 0.237
NP_440457.1_1 Forward -379 -367 1.90727 0.223
NP_442940.1_2 Forward -375 -356 -0.983855 0.296
NP_440798.1_6 Reverse -235 -248 0.60927 0.254
NP_442680.1_5 Forward -101 -82 5.64058 0.22
NP_442680.1_5 Forward -125 -106 -1.10006 0.299
NP_441984.1_3 Forward -247 -229 7.4923 0.246
NP_440473.1_9 Reverse -223 -242 -8.26035 0.246
NP_442509.1_9 Forward -243 -233 8.14104 0.192
NP_442509.1_9 Reverse -234 -244 8.04271 0.192
NP_442582.1_3 Forward -41 -27 12.5211 0.286
NP_440554.1_4 Reverse -235 -245 15.418 0.0199
NP_441885.1_5 Forward -243 -233 20.9245 0.000538
NP_441885.1_5 Reverse -234 -244 11.3864 0.00668
NP_442341.1_7 Forward -244 -230 5.21113 0.165
NP_442341.1_7 Reverse -289 -303 3.63784 0.217
NP_442341.1_7 Reverse -233 -247 3.04785 0.237
NP_442369.1_7 Forward -262 -244 18.5274 0.218
NP_442534.1_7 Reverse -226 -245 16.3224 0.163
NP_440423.1_6 Forward -251 -232 -13.9635 0.224
NP_443000.1_7 Forward -245 -235 10.7964 0.0345
NP_443000.1_7 Reverse -232 -242 10.3048 0.0345
NP_441842.1_10 Reverse -227 -241 11.6026 0.126
NP_440275.1_3 Forward -245 -235 18.6629 0.0082
NP_440275.1_3 Reverse -232 -242 8.04317 0.0602
NP_440091.1_1 Forward -247 -235 10.8554 0.0429
NP_441902.1_3 Forward -103 -93 13.8563 0.226
NP_440149.1_8 Forward -243 -224 3.73603 0.0903
NP_441105.1_3 Reverse -355 -374 -7.76869 0.259
NP_440216.1_1 Reverse -234 -248 5.99778 0.0166
NP_440216.1_1 Forward -243 -229 -0.787057 0.0284
NP_440172.1_1 Reverse -234 -244 17.5813 0.00421
NP_440172.1_1 Forward -243 -233 15.0247 0.00945
NP_442015.1_10 Reverse -230 -243 1.39592 0.204
NP_441226.1_7 Forward -242 -235 14.4934 0.0123
NP_441226.1_7 Reverse -235 -242 14.4934 0.0123
NP_441226.1_7 Forward -71 -64 6.52862 0.253
NP_441111.1_7 Forward -242 -234 18.7023 0.00294
NP_441111.1_7 Reverse -235 -243 18.7023 0.00294
NP_442379.1_10 Forward -250 -233 -1.43612 0.223
NP_441766.1_2 Forward -243 -234 17.5026 0.00297
NP_441766.1_2 Reverse -234 -243 17.5026 0.00297
NP_440416.1_1 Reverse -234 -253 4.22769 0.0689
NP_443052.1_8 Forward -253 -234 2.75272 0.0539
NP_440261.1_5 Forward -242 -229 -0.865694 0.0655
NP_440261.1_5 Reverse -235 -248 -10.6988 0.203
NP_440988.1_5 Forward -45 -26 12.9585 0.28
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTATTCTCTATATTTTGAAATCTAGGGGCATGGCCCACTCCAACCAAGTGCGGGAATTCATCCTTAGTAATGATGGGGTAGATTTGATTGAAGCTTATATTGGTGAAGGGCAAGTACTAACAGGTACCCAAAGGATTAATCAAATTTTAGAAGAAGAGGCGATCGCCAAAAGGCGGCAACAGGCCCTAGAACTCAGCAAACGGAATTTTGAGCGAAAAAAGTACTTACTGCAGGCGAAGATTGATGCCCTCCAAATGAAACTAGCCAGTCAAGATGAGGAATTAGAAGTACTAATGTTAGAGGAGAAAGAATTCAAACAAACAATGTTGGCCAACCGTAATCTGATTAAAAAGTCTCGCCACATTTATCAAAACCCCTAAGTACTGAAGAGTCTTCTATT

CDS

ATGGAAAATTTAAACGCTCTATCTGGCAATCAAAACTTGGAAGTTTGGCAACTGCGTCTGTATGTAGCGGGACAAACTCCTAAATCCGTCACAGCTTTTATAAATTTAAAAAAGATTTGTGAAGAATATCTAAACGGTCAATACCAAATTGAAATCATCGATTTGACCCAACAACCTGAATTGGCGATTGAAGATAGTATTTTGGCATTGCCTACTTTAGTAAGAAAATTACCCGAACCAATCAAAAAAATTATTGGTGATTTGTCCAATACAGAAAAGGTATTAGTGGGCTTACAAATTTTACCCTCTATGGATTGGAAAATCTAG

Protein

MENLNALSGNQNLEVWQLRLYVAGQTPKSVTAFINLKKICEEYLNGQYQIEIIDLTQQPELAIEDSILALPTLVRKLPEPIKKIIGDLSNTEKVLVGLQILPSMDWKI