Your browser is old and dusty. Try Google Chrome!

Details for sll1579

ORF sll1579
Accession NP_440550.1
Symbol cpcC2
Category Phycobilisome
Definition phycobilisome rod linker polypeptide
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -378 -364 15.0442 0.114
NP_441061.1_2 Forward -173 -159 4.62115 0.146
NP_440557.1_1 Reverse -184 -203 -2.36049 0.286
NP_440815.1_5 Reverse -165 -184 5.80098 0.275
NP_441453.1_4 Reverse -165 -173 3.85433 0.284
NP_442151.1_1 Forward -83 -64 3.04771 0.294
NP_441818.1_1 Reverse -166 -177 13.0378 0.0905
NP_441818.1_9 Forward -309 -290 -10.3253 0.292
NP_442752.1_4 Forward -174 -167 7.90559 0.144
NP_442752.1_4 Reverse -165 -172 5.25066 0.256
NP_442752.1_4 Reverse -265 -272 4.26735 0.293
NP_443027.1_4 Reverse -163 -173 9.22315 0.172
NP_443027.1_4 Reverse -263 -273 7.05986 0.248
NP_440061.1_9 Reverse -335 -349 7.27547 0.213
NP_440061.1_9 Reverse -163 -177 5.89884 0.266
NP_442062.1_8 Reverse -165 -175 10.6981 0.0493
NP_442762.1_10 Forward -100 -81 -1.27885 0.164
NP_439918.1_2 Reverse -148 -167 -4.72043 0.283
NP_441935.1_1 Reverse -166 -185 6.88262 0.26
NP_441208.1_9 Reverse -334 -348 7.07942 0.227
NP_442276.1_2 Forward -316 -297 4.42435 0.299
NP_440330.1_2 Reverse -153 -172 10.3242 0.297
NP_441083.1_5 Reverse -165 -175 0.963343 0.218
NP_441083.1_5 Forward -174 -164 -0.609952 0.272
NP_441083.1_5 Reverse -337 -347 -1.00328 0.289
NP_441434.1_7 Forward -272 -258 4.71948 0.225
NP_441558.1_5 Forward -348 -329 14.1591 0.0522
NP_440209.1_1 Forward -274 -266 2.08437 0.286
NP_440056.1_1 Forward -174 -155 21.0423 0.0319
NP_441713.1_1 Forward -352 -333 -16.8151 0.286
NP_442445.1_1 Reverse -223 -242 11.4058 0.271
NP_442111.1_4 Forward -379 -365 6.6861 0.117
NP_440747.1_10 Reverse -162 -174 -11.8591 0.161
NP_440747.1_10 Forward -177 -165 -12.0557 0.199
NP_440747.1_10 Forward -349 -337 -12.1541 0.227
NP_442634.1_4 Forward -176 -162 -4.81863 0.22
NP_442848.1_5 Reverse -164 -182 0.314141 0.276
NP_442848.1_9 Forward -345 -326 2.65439 0.248
NP_441634.1_8 Reverse -163 -177 -1.37704 0.288
NP_440376.1_1 Reverse -165 -174 7.07956 0.0869
NP_440376.1_1 Forward -174 -165 6.39124 0.1
NP_442687.1_7 Forward -347 -337 5.68323 0.189
NP_442687.1_7 Reverse -164 -174 5.19158 0.217
NP_441077.1_6 Forward -81 -65 3.18749 0.271
NP_441846.1_10 Reverse -228 -247 -22.5183 0.261
NP_440550.1_1 Forward -159 -140 23.4022 0.0257
NP_440550.1_2 Forward -132 -113 31.2687 0.0000384
NP_440550.1_3 Forward -306 -287 33.432 0.00000997
NP_440550.1_4 Forward -201 -182 35.3003 0.0000192
NP_440550.1_5 Forward -353 -334 23.6972 0.0229
NP_440550.1_6 Forward -228 -209 35.0053 0.0000163
NP_440550.1_7 Forward -252 -233 31.6611 0.0000455
NP_440550.1_8 Forward -282 -263 31.2687 0.000136
NP_440550.1_9 Forward -379 -360 26.9421 0.00183
NP_440550.1_10 Forward -332 -313 28.4171 0.000277
NP_441950.1_7 Reverse -223 -242 -8.06369 0.283
NP_440141.1_4 Forward -171 -152 -11.8003 0.298
NP_442782.1_2 Forward -393 -379 2.16287 0.277
NP_442496.1_5 Reverse -221 -239 9.36059 0.225
NP_441958.1_5 Forward -347 -337 -1.29827 0.236
NP_441127.1_1 Reverse -327 -341 9.2427 0.278
NP_439905.1_1 Forward -398 -385 8.67241 0.232
NP_442911.1_2 Reverse -155 -174 4.42435 0.0386
NP_443055.1_6 Forward -182 -164 2.37835 0.212
NP_440138.1_6 Forward -131 -112 5.80018 0.227
NP_440138.1_6 Forward -173 -154 1.96529 0.273
NP_442995.1_5 Forward -141 -122 11.6025 0.211
NP_442002.1_9 Reverse -264 -271 10.7572 0.185
NP_442438.1_10 Forward -179 -165 4.91614 0.142
NP_441674.1_6 Reverse -166 -185 7.57094 0.205
NP_440147.1_4 Reverse -163 -176 0.805932 0.244
NP_441916.1_7 Forward -174 -164 5.87989 0.116
NP_441041.1_4 Forward -174 -155 -13.3736 0.285
NP_442004.1_6 Forward -174 -160 5.50613 0.19
NP_440703.1_9 Forward -399 -386 9.06515 0.226
NP_439966.1_7 Reverse -163 -173 5.09279 0.243
NP_439966.1_9 Forward -267 -258 4.42462 0.253
NP_442941.1_3 Reverse -166 -176 -1.10161 0.284
NP_442281.1_1 Reverse -160 -174 5.50552 0.155
NP_440177.1_1 Reverse -290 -308 2.67408 0.295
NP_441644.1_6 Reverse -165 -175 5.87944 0.174
NP_441644.1_6 Reverse -337 -347 4.10949 0.249
NP_441644.1_6 Forward -168 -158 4.01116 0.253
NP_443049.1_6 Reverse -264 -274 12.812 0.231
NP_442933.1_10 Forward -174 -165 4.42462 0.246
NP_441310.1_10 Forward -371 -361 16.6663 0.0807
NP_442554.1_8 Forward -345 -335 10.3048 0.0476
NP_442554.1_8 Reverse -166 -176 7.55152 0.0893
NP_442554.1_8 Forward -173 -163 2.92996 0.249
NP_442142.1_4 Reverse -162 -175 7.19687 0.144
NP_442142.1_4 Forward -177 -164 3.7553 0.246
NP_442142.1_4 Reverse -262 -275 3.16532 0.265
NP_442292.1_1 Reverse -166 -175 6.19458 0.109
NP_442292.1_1 Forward -345 -336 2.75299 0.216
NP_443009.1_5 Forward -175 -164 7.33466 0.132
NP_442301.1_2 Forward -343 -324 10.0284 0.2
NP_441468.1_1 Forward -173 -166 3.97235 0.277
NP_441618.1_3 Forward -101 -82 1.37609 0.235
NP_441020.2_6 Forward -176 -159 9.67528 0.165
NP_441015.1_10 Reverse -325 -344 -10.6203 0.286
NP_441015.1_10 Forward -173 -154 -10.817 0.288
NP_441673.1_1 Forward -174 -165 1.27803 0.155
NP_441673.1_1 Reverse -165 -174 1.27803 0.155
NP_441764.1_8 Reverse -377 -387 13.5119 0.284
NP_442868.1_6 Forward -176 -166 4.79825 0.165
NP_442719.1_2 Reverse -65 -83 -2.63651 0.191
NP_441612.1_2 Reverse -165 -175 7.38753 0.255
NP_442808.1_1 Reverse -164 -174 13.3526 0.0481
NP_441315.1_2 Forward -199 -181 16.3407 0.214
NP_440145.1_3 Forward -184 -165 -5.99873 0.286
NP_442718.1_2 Reverse -124 -143 -0.885524 0.231
NP_440558.1_2 Forward -178 -159 -0.688862 0.204
NP_440558.1_2 Reverse -162 -181 -1.96717 0.22
NP_440558.1_2 Forward -172 -153 -4.72043 0.248
NP_441878.1_6 Forward -175 -165 1.55333 0.0937
NP_441878.1_6 Forward -347 -337 -0.216628 0.169
NP_441878.1_6 Reverse -164 -174 -0.314959 0.174
NP_441036.1_8 Reverse -164 -174 7.15819 0.208
NP_441557.1_5 Forward -174 -165 0.393051 0.166
NP_441557.1_5 Reverse -165 -174 0.393051 0.166
NP_441445.1_1 Forward -183 -164 6.4893 0.148
NP_442066.2_9 Reverse -261 -274 10.934 0.154
NP_442777.1_1 Forward -235 -216 4.12856 0.3
NP_441914.1_2 Forward -183 -165 14.1788 0.28
NP_441458.1_10 Reverse -156 -175 6.09597 0.204
NP_442830.1_7 Reverse -116 -135 9.14423 0.215
NP_442183.1_1 Forward -174 -160 6.98109 0.153
NP_442170.1_5 Reverse -265 -284 2.45773 0.178
NP_442347.1_2 Forward -273 -264 13.1761 0.056
NP_442347.1_2 Reverse -370 -379 8.06287 0.116
NP_442347.1_2 Forward -173 -164 4.62128 0.274
NP_442645.1_2 Forward -282 -263 -22.9117 0.299
NP_441037.1_4 Forward -176 -166 6.05075 0.283
NP_442998.1_10 Forward -272 -265 5.93897 0.206
NP_441799.1_1 Reverse -161 -175 3.63724 0.289
NP_441559.1_8 Forward -269 -255 -6.78525 0.279
NP_441559.1_8 Reverse -364 -378 -6.88358 0.281
NP_441559.1_8 Forward -179 -165 -7.57189 0.295
NP_440915.1_6 Forward -178 -164 7.86607 0.0637
NP_440915.1_6 Forward -350 -336 2.16287 0.124
NP_440915.1_6 Reverse -123 -137 -1.37704 0.233
NP_440748.1_5 Forward -397 -378 -1.18052 0.267
NP_442993.1_1 Forward -346 -330 -11.6429 0.255
NP_442993.1_1 Forward -174 -158 -12.8228 0.281
NP_440677.1_6 Reverse -156 -175 12.2908 0.196
NP_442386.1_9 Reverse -164 -173 12.684 0.0544
NP_442386.1_9 Forward -175 -166 9.04574 0.175
NP_441750.1_1 Reverse -321 -340 -13.3736 0.3
NP_440161.1_2 Forward -249 -230 18.2882 0.263
NP_440586.1_8 Reverse -266 -273 12.6251 0.0546
NP_440586.1_8 Forward -135 -128 10.7568 0.128
NP_442251.1_6 Forward -143 -136 7.11894 0.274
NP_440192.1_4 Reverse -163 -182 14.7337 0.169
NP_440192.1_5 Forward -301 -282 9.14423 0.195
NP_440027.1_3 Reverse -165 -183 4.83661 0.25
NP_439937.1_9 Reverse -164 -181 -0.355176 0.119
NP_440439.1_1 Reverse -162 -175 -0.472371 0.221
NP_441803.1_2 Reverse -160 -179 15.5357 0.039
NP_441803.1_10 Reverse -227 -241 13.0776 0.295
NP_441572.1_7 Forward -352 -333 -6.29373 0.288
NP_442384.1_10 Forward -174 -161 11.1307 0.0383
NP_442384.1_10 Reverse -337 -350 8.18076 0.0685
NP_442790.1_4 Reverse -256 -275 -4.13045 0.13
NP_442790.1_4 Forward -355 -336 -15.5368 0.294
NP_441689.1_5 Forward -254 -244 5.19112 0.282
NP_440163.1_10 Reverse -162 -172 12.9597 0.14
NP_440344.1_10 Reverse -158 -175 -1.53445 0.0547
NP_440344.1_10 Forward -181 -164 -4.77938 0.1
NP_440282.1_2 Reverse -337 -356 5.60432 0.295
NP_440282.1_10 Reverse -155 -174 -0.688862 0.21
NP_442910.1_1 Reverse -220 -239 -0.39387 0.199
NP_441335.1_4 Forward -185 -166 12.7825 0.26
NP_441965.1_10 Forward -177 -161 15.9882 0.0533
NP_440297.1_9 Forward -173 -163 -0.806614 0.297
NP_440937.1_5 Forward -271 -252 8.84924 0.278
NP_442067.1_4 Reverse -154 -173 4.32602 0.257
NP_440999.1_9 Reverse -161 -175 0.0979218 0.193
NP_440888.1_2 Reverse -165 -179 16.2235 0.00758
NP_442147.1_7 Forward -183 -164 7.66927 0.295
NP_442948.1_2 Forward -379 -360 15.2408 0.106
NP_441787.1_7 Forward -198 -179 27.1388 0.00316
NP_441787.1_8 Forward -252 -233 22.7575 0.039
NP_442871.1_7 Forward -265 -246 9.83255 0.299
NP_441543.1_2 Forward -135 -126 8.25953 0.104
NP_441543.1_2 Reverse -166 -175 4.91628 0.213
NP_442845.1_2 Forward -180 -166 9.14437 0.18
NP_441918.1_7 Forward -169 -150 -1.7705 0.297
NP_441469.1_8 Reverse -164 -173 5.50626 0.265
NP_441469.1_8 Forward -175 -166 5.11294 0.289
NP_442337.1_8 Forward -102 -83 -2.26216 0.297
NP_442578.1_5 Reverse -81 -100 4.22769 0.257
NP_442578.1_7 Reverse -266 -273 12.6255 0.0418
NP_441462.1_2 Reverse -265 -275 -1.10161 0.281
NP_441462.1_2 Forward -346 -336 -1.10161 0.281
NP_443062.1_1 Forward -174 -156 9.521 0.133
NP_440519.1_8 Forward -270 -254 2.41848 0.262
NP_441351.1_1 Reverse -181 -200 8.84924 0.259
NP_442487.1_5 Reverse -336 -355 2.85027 0.294
NP_440516.1_8 Reverse -265 -274 0.786375 0.133
NP_442428.1_5 Forward -173 -166 10.6589 0.0727
NP_442120.1_10 Forward -345 -326 -4.03212 0.199
NP_440673.1_3 Forward -272 -265 10.1672 0.149
NP_440865.1_9 Reverse -331 -350 -8.752 0.269
NP_441052.1_2 Reverse -165 -175 7.45319 0.0712
NP_441052.1_2 Forward -174 -164 5.48657 0.116
NP_442219.1_8 Reverse -245 -264 6.23444 0.3
NP_440436.1_4 Forward -173 -164 5.70251 0.186
NP_440436.1_4 Reverse -166 -175 4.52254 0.256
NP_442086.1_3 Reverse -266 -285 7.37428 0.272
NP_441719.1_4 Reverse -266 -273 3.77569 0.285
NP_441733.1_10 Forward -177 -164 8.67241 0.138
NP_441004.1_1 Reverse -129 -148 -10.817 0.226
NP_441004.1_1 Reverse -222 -241 -17.6018 0.292
NP_442206.1_10 Forward -174 -159 2.73316 0.198
NP_443054.1_2 Reverse -163 -177 2.06454 0.245
NP_441851.1_10 Forward -175 -165 12.4681 0.0501
NP_441851.1_10 Reverse -164 -174 4.89658 0.24
NP_441195.1_3 Forward -348 -329 23.5989 0.00181
NP_441195.1_6 Forward -318 -299 14.4541 0.111
NP_441046.1_2 Reverse -325 -344 1.37609 0.256
NP_440588.1_2 Reverse -156 -175 -4.52377 0.22
NP_442006.1_2 Reverse -234 -251 -7.33598 0.171
NP_441003.1_3 Forward -201 -182 16.6174 0.245
NP_441570.1_1 Forward -300 -282 -16.3038 0.242
NP_441078.1_4 Forward -174 -165 14.8477 0.00707
NP_441078.1_4 Reverse -165 -174 0.589713 0.174
NP_441078.1_4 Reverse -337 -346 -2.06522 0.295
NP_440526.1_3 Reverse -166 -177 10.2846 0.0646
NP_441432.1_8 Forward -175 -166 4.42462 0.213
NP_441732.1_2 Reverse -161 -177 -16.7561 0.195
NP_441945.1_10 Reverse -117 -136 9.83255 0.258
NP_441057.1_4 Forward -304 -286 -0.275845 0.26
NP_442010.1_9 Reverse -356 -370 13.8636 0.175
NP_440713.1_4 Forward -184 -165 4.32602 0.231
NP_442489.1_7 Forward -174 -165 8.06287 0.0371
NP_442489.1_7 Reverse -165 -174 0.589713 0.17
NP_442489.1_7 Reverse -337 -346 -1.57357 0.213
NP_441659.2_8 Reverse -165 -175 6.37155 0.0774
NP_441800.1_7 Reverse -286 -304 -2.0458 0.259
NP_440779.1_5 Forward -252 -235 -5.66436 0.152
NP_442346.1_5 Forward -175 -165 6.27322 0.208
NP_440545.1_2 Forward -101 -82 13.0954 0.296
NP_440545.1_3 Forward -178 -161 1.21881 0.123
NP_440545.1_3 Reverse -333 -350 -0.0594896 0.147
NP_440459.1_7 Reverse -125 -139 18.1442 0.0994
NP_440010.1_4 Reverse -158 -177 -0.197979 0.25
NP_440847.1_3 Forward -251 -237 16.6169 0.119
NP_442603.1_7 Reverse -369 -383 9.83206 0.139
NP_442828.1_7 Reverse -132 -151 -6.09707 0.293
NP_443015.1_4 Forward -188 -169 17.994 0.203
NP_442045.1_5 Reverse -78 -97 -2.45882 0.294
NP_442199.1_5 Reverse -157 -176 -6.58872 0.277
NP_440875.1_9 Forward -272 -262 12.5575 0.113
NP_440875.1_9 Reverse -89 -99 7.10665 0.283
NP_441813.1_3 Reverse -30 -49 12.9769 0.296
NP_441813.1_5 Reverse -263 -273 -0.0199663 0.227
NP_440590.1_4 Reverse -166 -179 2.08423 0.101
NP_440821.1_4 Reverse -163 -173 6.07655 0.1
NP_441239.1_9 Reverse -163 -175 10.0687 0.0888
NP_441239.1_9 Reverse -335 -347 3.08724 0.296
NP_441009.1_4 Forward -174 -155 17.109 0.14
NP_441727.1_3 Reverse -236 -255 3.14605 0.292
NP_441892.1_1 Forward -145 -128 -4.97604 0.271
NP_440604.1_6 Forward -174 -155 -1.18052 0.197
NP_442044.1_1 Reverse -160 -179 -12.2919 0.271
NP_442629.1_3 Forward -308 -289 1.27776 0.284
NP_442083.1_2 Reverse -227 -246 3.6377 0.259
NP_440392.1_4 Forward -393 -375 14.8663 0.283
NP_440546.1_6 Reverse -320 -339 7.37428 0.273
NP_440462.1_6 Reverse -263 -273 4.3066 0.205
NP_440462.1_6 Reverse -163 -173 3.81494 0.228
NP_442611.1_1 Reverse -337 -356 11.0125 0.0782
NP_440868.1_4 Forward -278 -266 5.34885 0.101
NP_442402.1_4 Reverse -361 -380 -6.3928 0.257
NP_440653.1_10 Reverse -112 -131 3.44104 0.273
NP_442409.1_10 Forward -241 -227 14.5519 0.293
NP_442837.1_3 Forward -273 -266 9.87221 0.106
NP_442053.1_1 Reverse -165 -174 5.21127 0.203
NP_442053.1_1 Forward -274 -265 4.42462 0.249
NP_442255.1_5 Reverse -248 -267 11.0125 0.227
NP_440914.1_1 Reverse -319 -329 7.5416 0.232
NP_440914.1_1 Forward -174 -164 6.85846 0.263
NP_441011.1_8 Forward -173 -164 9.83282 0.117
NP_442533.1_6 Forward -174 -165 15.536 0.00533
NP_442533.1_6 Reverse -165 -174 7.76787 0.0883
NP_442533.1_6 Reverse -337 -346 4.32629 0.184
NP_440263.1_2 Forward -242 -223 12.3883 0.293
NP_442322.1_4 Forward -244 -227 -9.30325 0.29
NP_441482.1_7 Forward -352 -338 -11.1118 0.237
NP_441028.1_6 Forward -234 -224 5.97777 0.234
NP_441028.1_6 Reverse -360 -370 5.78111 0.243
NP_441527.1_7 Forward -233 -214 8.06178 0.284
NP_440007.1_9 Reverse -381 -395 0.687908 0.292
NP_443045.1_9 Forward -237 -219 7.09821 0.279
NP_440429.1_2 Reverse -166 -185 10.4225 0.267
NP_441286.1_1 Forward -175 -163 -5.07423 0.188
NP_442674.1_1 Forward -348 -329 12.3088 0.222
NP_442477.1_5 Reverse -51 -70 10.8159 0.143
NP_440886.1_7 Reverse -164 -174 7.74772 0.0843
NP_440886.1_7 Reverse -264 -274 6.27276 0.134
NP_440886.1_7 Reverse -290 -300 5.87944 0.158
NP_440886.1_7 Forward -340 -330 5.78111 0.163
NP_442614.1_2 Reverse -165 -179 7.86607 0.262
NP_441427.1_5 Reverse -247 -266 8.55425 0.277
NP_441962.1_4 Forward -179 -160 -12.3902 0.256
NP_440387.1_1 Reverse -330 -346 -5.93965 0.258
NP_441206.1_6 Forward -288 -269 14.2574 0.278
NP_441237.1_9 Reverse -166 -176 13.943 0.0577
NP_440457.1_1 Forward -350 -338 0.333971 0.25
NP_441436.1_2 Forward -98 -79 11.6025 0.163
NP_440473.1_9 Reverse -116 -135 -10.0303 0.269
NP_441885.1_5 Reverse -165 -175 1.94665 0.0935
NP_441885.1_5 Forward -174 -164 -0.511621 0.202
NP_442341.1_7 Reverse -164 -178 8.75105 0.0848
NP_440091.1_1 Forward -178 -166 0.825626 0.227
NP_440679.1_10 Forward -172 -153 -14.6519 0.242
NP_443010.1_10 Reverse -162 -179 5.3799 0.205
NP_440149.1_8 Forward -174 -155 1.17943 0.129
NP_441105.1_3 Forward -357 -338 -7.86702 0.261
NP_440216.1_9 Forward -397 -388 7.37455 0.286
NP_440172.1_1 Reverse -337 -347 8.73149 0.0586
NP_440172.1_1 Reverse -265 -275 5.97822 0.121
NP_440416.1_9 Reverse -158 -177 -14.1602 0.173
NP_440416.1_9 Reverse -362 -381 -16.8151 0.223
NP_442116.1_2 Forward -134 -115 18.0915 0.156
NP_441430.1_6 Forward -185 -166 11.6025 0.251
NP_440261.1_5 Forward -173 -160 -12.4687 0.297
NP_440988.1_10 Forward -170 -156 5.77014 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACCCAAGGCAACAACTTTGCTGCGGATCAACGGGGTAAAGACAAGTGTGCCCGGGACATCGGCTACTACCTCCGCATCGTTACCTACTGCTTAGTTGCTGGTGGTACCGGTCCTTTGGATGAGTACTTGATCGCCGGTATTGATGAAATCAACCGCACCTTTGACCTCTCCCCCAGCTGGTATGTTGAAGCTCTGAAATACATCAAAGCTAACCACGGCTTGAGTGGCGATGCCCGTGACGAAGCTAATTCCTACCTCGATTACGCCATCAATGCTCTGAGCTAGTCAGTTTTTAATTCTAGCTGGCCTGGAAGGGTGGGAAAGTGTTAACAACTGGTTGACAATATTCCGCTTTTCCAGGTCTTGTCGTATTTATTGACACTTATCTAGGAGAACAAA

CDS

ATGACTAGTTTAGTTTCGGCCCAGCGTCTGGGCATTGTGGCCGTGGATGAGGCTATTCCCCTCGAGCTTCGTTCCCGGAGTACAGAGGAAGAGGTGGATGCCGTTATCCTGGCGGTTTACCGTCAAGTTTTGGGCAACGATCATCTCATGTCCCAGGAACGACTGACCAGTGCAGAATCTTTGCTCCGGGGCAGGGAGATTTCGGTAAGGGATTTTGTTCGGGCTGTGGCTCTGTCGGAAGTGTACCGGCAGAAGTTTTTCCATTCCAACCCACAAAATCGTTTTATCGAGCTTAATTATAAGCATTTACTGGGACGGGCTCCCTACGATCAGTCGGAAATTGCTTTCCACACCGATCTTTATCACCAGGGGGGCTATGAAGCGGAGATCAATTCCTATATTGACTCCGTAGAATACACGGAAAACTTTGGAGATTGGGTTGTACCTTATTTCCGCGGCTTTGCTACCCAGCGGAATCAAAAAACCGTTGGTTTCAGCCGTTCTTTCCAGGTGTATCGGGGCTACGCTACCAGTGATCGTTCCCAGGGAAATGGTTCCCGTTCTCGATTGACGCGGGAGTTGGCTCGCAATACAGCTTCTCCGGTGTATGCCGGTTCTACGGCCGAGAGTTTGCGGGGAACTTCGGCGGGTAGTCGTAACCAAATGTATCGTTTGCAAGTGATTCAAGGGGCGGCCCCCGGTCGTGGCACCCGAGTGCGCCGTGGTAAAGCGGAGTATCTAGTTTCCTACGATAATTTGTCTGCCAAGTTGCAACAAATCAATCGCCAAGGAGATACGGTCACAATGATTTCCCTTGCCTAG

Protein

MTSLVSAQRLGIVAVDEAIPLELRSRSTEEEVDAVILAVYRQVLGNDHLMSQERLTSAESLLRGREISVRDFVRAVALSEVYRQKFFHSNPQNRFIELNYKHLLGRAPYDQSEIAFHTDLYHQGGYEAEINSYIDSVEYTENFGDWVVPYFRGFATQRNQKTVGFSRSFQVYRGYATSDRSQGNGSRSRLTRELARNTASPVYAGSTAESLRGTSAGSRNQMYRLQVIQGAAPGRGTRVRRGKAEYLVSYDNLSAKLQQINRQGDTVTMISLA