Your browser is old and dusty. Try Google Chrome!

Details for sll1575

ORF sll1575
Accession NP_440555.1
Symbol spkA
Category a part of spkA: serine/threonine protein kinase, regulates cellular motility ( disrupted by frameshift mutation)
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_4 Forward -27 -13 16.9119 0.295
NP_440795.1_7 Reverse -339 -346 9.77388 0.169
NP_440795.1_7 Reverse -293 -300 9.77388 0.169
NP_440795.1_7 Forward -319 -312 8.39725 0.213
NP_441480.1_10 Forward -169 -150 10.8159 0.19
NP_442291.1_5 Reverse -375 -391 14.6115 0.0235
NP_441453.1_4 Reverse -236 -244 9.85252 0.0466
NP_441453.1_4 Forward -283 -275 5.23096 0.157
NP_441453.1_7 Forward -210 -203 12.9205 0.23
NP_441623.1_1 Forward -244 -226 -1.75081 0.241
NP_441623.1_1 Reverse -203 -221 -4.70074 0.275
NP_441818.1_1 Forward -282 -271 8.61296 0.288
NP_442173.1_1 Reverse -275 -283 9.45919 0.0825
NP_442752.1_4 Reverse -154 -161 5.44732 0.202
NP_442752.1_4 Forward -385 -378 5.34899 0.221
NP_443027.1_4 Forward -387 -377 6.8632 0.262
NP_440061.1_9 Reverse -374 -388 9.83206 0.137
NP_442062.1_8 Forward -385 -375 8.82982 0.0709
NP_442062.1_8 Reverse -274 -284 4.10993 0.232
NP_441802.1_1 Forward -21 -2 5.89931 0.269
NP_441802.1_1 Forward -109 -90 4.22769 0.296
NP_440304.1_4 Reverse -42 -52 3.81494 0.292
NP_440908.1_5 Reverse -156 -173 13.5102 0.161
NP_441208.1_1 Forward -397 -378 -4.13045 0.262
NP_441208.1_9 Forward -76 -62 5.70279 0.262
NP_441925.1_4 Reverse -237 -256 -15.3409 0.263
NP_441925.1_4 Reverse -247 -266 -16.6192 0.284
NP_440330.1_2 Forward -212 -193 8.65258 0.297
NP_441083.1_5 Forward -283 -273 -0.511621 0.269
NP_441738.1_2 Forward -161 -154 10.2652 0.101
NP_441738.1_2 Forward -281 -274 10.0685 0.125
NP_441738.1_2 Reverse -378 -385 8.00357 0.235
NP_442111.1_4 Reverse -281 -295 3.14618 0.253
NP_440851.1_6 Forward -324 -307 2.49712 0.288
NP_441130.1_7 Forward -309 -295 15.9285 0.287
NP_441486.1_1 Reverse -271 -285 2.85119 0.074
NP_441486.1_1 Reverse -373 -387 -5.70361 0.254
NP_440842.1_10 Reverse -310 -324 1.17956 0.294
NP_441014.1_8 Reverse -237 -256 -9.83364 0.299
NP_442848.1_1 Reverse -370 -384 -4.52363 0.294
NP_441634.1_8 Reverse -53 -67 -3.44199 0.295
NP_440376.1_1 Reverse -274 -283 2.55633 0.218
NP_442687.1_7 Forward -302 -292 8.23984 0.11
NP_442687.1_7 Forward -284 -274 7.84651 0.123
NP_442687.1_7 Reverse -310 -320 3.91327 0.278
NP_442191.1_4 Reverse -11 -25 13.514 0.144
NP_441846.1_10 Reverse -301 -320 -22.3217 0.259
NP_441846.1_10 Reverse -294 -313 -22.3217 0.259
NP_441846.1_10 Reverse -155 -174 -22.6167 0.264
NP_441846.1_10 Forward -264 -245 -22.715 0.264
NP_441846.1_10 Reverse -285 -304 -23.4033 0.285
NP_440642.1_10 Reverse -49 -63 2.5556 0.277
NP_439959.1_6 Forward -115 -96 8.84924 0.209
NP_442937.1_5 Forward -262 -243 5.89931 0.295
NP_441958.1_5 Forward -284 -274 -0.314959 0.198
NP_441127.1_1 Reverse -292 -306 11.3077 0.23
NP_440993.1_3 Forward -308 -289 -1.8696 0.292
NP_442431.1_10 Reverse -289 -307 4.34571 0.206
NP_441292.1_2 Reverse -263 -282 -7.96535 0.263
NP_441550.1_8 Forward -285 -275 7.15773 0.174
NP_441550.1_8 Reverse -217 -227 5.19112 0.26
NP_441725.1_4 Reverse -263 -277 2.65393 0.283
NP_441725.1_5 Reverse -275 -285 0.471689 0.173
NP_439966.1_9 Reverse -152 -161 5.3096 0.253
NP_442941.1_3 Forward -384 -374 5.38824 0.115
NP_440289.1_2 Reverse -308 -321 0.215946 0.173
NP_441678.1_9 Forward -396 -377 -0.197208 0.225
NP_441644.1_6 Reverse -338 -348 5.38779 0.194
NP_441810.1_9 Forward -308 -289 5.80098 0.174
NP_442029.1_1 Forward -265 -246 -9.34199 0.192
NP_442933.1_10 Reverse -376 -385 5.3096 0.203
NP_441751.2_8 Reverse -377 -391 -5.70361 0.231
NP_442554.1_8 Reverse -275 -285 2.63497 0.265
NP_442970.1_1 Forward -365 -351 9.46532 0.272
NP_441762.1_7 Forward -344 -332 -5.86088 0.246
NP_442142.1_4 Reverse -331 -344 4.34528 0.223
NP_441711.1_2 Forward -310 -291 19.5664 0.077
NP_441198.1_8 Forward -35 -25 11.3181 0.211
NP_441015.1_10 Reverse -293 -312 -1.7705 0.176
NP_441015.1_10 Forward -265 -246 -5.31042 0.221
NP_441826.1_2 Reverse -305 -319 3.34284 0.111
NP_441826.1_2 Forward -283 -269 -4.81863 0.3
NP_441612.1_2 Forward -19 -9 7.19391 0.26
NP_442427.1_3 Forward -58 -40 9.55725 0.16
NP_441101.1_10 Reverse -60 -79 -4.6221 0.281
NP_442542.1_2 Forward -285 -272 5.32916 0.272
NP_442050.1_5 Reverse -374 -384 8.63269 0.223
NP_441114.1_3 Forward -169 -160 6.5879 0.262
NP_442789.1_4 Reverse -275 -294 -2.26216 0.233
NP_441878.1_6 Forward -321 -311 -7.59145 0.245
NP_441036.1_8 Reverse -333 -343 9.32148 0.174
NP_441557.1_5 Forward -283 -274 -0.885252 0.26
NP_442066.2_4 Forward -347 -328 -2.75381 0.215
NP_441458.1_10 Forward -304 -285 2.0644 0.274
NP_442183.1_1 Forward -254 -240 6.48943 0.171
NP_442347.1_2 Reverse -377 -386 5.99792 0.201
NP_442347.1_2 Forward -162 -153 4.42462 0.284
NP_440547.1_1 Reverse -186 -205 7.07848 0.294
NP_442594.1_8 Forward -268 -249 9.53756 0.187
NP_442317.1_6 Forward -325 -306 5.70265 0.24
NP_440136.1_2 Forward -384 -377 3.97235 0.288
NP_442998.1_5 Forward -105 -95 8.82982 0.261
NP_440299.1_1 Reverse -232 -245 2.37867 0.291
NP_441799.1_1 Forward -287 -273 8.65209 0.109
NP_442334.1_2 Reverse -301 -318 11.6419 0.128
NP_441743.1_8 Forward -33 -14 15.1424 0.185
NP_441559.1_8 Forward -175 -161 -5.70361 0.27
NP_441559.1_8 Forward -192 -178 -6.29359 0.276
NP_441559.1_8 Reverse -39 -53 -6.78525 0.279
NP_441559.1_8 Reverse -189 -203 -7.47356 0.294
NP_440915.1_6 Forward -249 -235 -1.8687 0.251
NP_440717.1_1 Reverse -195 -214 5.01433 0.284
NP_440702.1_2 Forward -268 -249 -5.21209 0.257
NP_441340.1_5 Reverse -275 -282 3.97235 0.274
NP_439976.1_4 Forward -304 -285 5.99684 0.278
NP_442950.1_1 Forward -223 -204 1.76941 0.206
NP_440586.1_4 Forward -267 -249 12.8022 0.25
NP_441262.1_3 Reverse -274 -281 10.6589 0.0722
NP_440027.1_3 Reverse -282 -300 4.83661 0.25
NP_439937.1_8 Reverse -290 -309 3.73603 0.204
NP_439937.1_9 Forward -126 -109 -15.0064 0.287
NP_439937.1_9 Reverse -103 -120 -15.9897 0.287
NP_439937.1_9 Reverse -190 -207 -17.3663 0.298
NP_440439.1_1 Reverse -331 -344 -2.04567 0.293
NP_440819.1_5 Forward -106 -98 7.68924 0.266
NP_442790.1_4 Forward -310 -291 -13.7669 0.268
NP_441689.1_5 Reverse -374 -384 12.4676 0.132
NP_441689.1_5 Reverse -272 -282 5.19112 0.282
NP_440344.1_10 Reverse -327 -344 -12.4492 0.254
NP_440531.1_6 Reverse -266 -285 -0.197208 0.205
NP_441640.1_8 Reverse -149 -168 -0.688862 0.198
NP_441592.1_4 Reverse -188 -207 -3.24547 0.279
NP_441103.1_9 Reverse -12 -22 12.4895 0.291
NP_440894.1_10 Forward -208 -189 3.04771 0.279
NP_442067.1_4 Forward -306 -287 2.65439 0.289
NP_440999.1_9 Forward -305 -291 2.35953 0.151
NP_440888.1_2 Forward -301 -287 7.66879 0.186
NP_441543.1_2 Forward -276 -267 9.4395 0.0818
NP_442845.1_2 Reverse -268 -282 8.94771 0.183
NP_441469.1_8 Reverse -291 -300 9.93116 0.227
NP_443064.1_6 Reverse -195 -205 9.3673 0.226
NP_441462.1_2 Reverse -274 -284 -1.19994 0.291
NP_443062.1_1 Forward -163 -145 5.23067 0.235
NP_441410.1_4 Reverse -6 -25 7.27514 0.297
NP_440673.1_3 Forward -373 -366 9.08556 0.202
NP_440673.1_3 Forward -338 -331 8.20058 0.234
NP_441052.1_2 Forward -320 -310 1.55333 0.238
NP_441052.1_2 Forward -277 -267 1.35667 0.248
NP_442219.1_9 Reverse -377 -386 5.70292 0.135
NP_441884.1_8 Reverse -333 -352 -9.53865 0.268
NP_440314.1_9 Reverse -237 -256 -7.86702 0.243
NP_441719.1_4 Forward -384 -377 3.77569 0.285
NP_441733.1_10 Reverse -151 -164 4.05085 0.276
NP_442873.1_5 Reverse -73 -92 7.27514 0.278
NP_440508.1_4 Reverse -268 -287 11.7008 0.256
NP_441668.1_4 Reverse -163 -182 4.12936 0.183
NP_441668.1_4 Reverse -226 -245 -2.45882 0.288
NP_442515.1_1 Forward -284 -270 -4.32697 0.298
NP_441982.1_6 Forward -362 -353 13.8222 0.274
NP_441982.1_6 Forward -108 -99 11.3395 0.288
NP_441349.1_10 Forward -395 -376 -2.0655 0.114
NP_441661.1_3 Forward -61 -44 -4.18939 0.226
NP_442843.1_1 Reverse -293 -312 -5.80207 0.244
NP_442843.1_1 Reverse -275 -294 -9.93197 0.272
NP_440431.1_3 Forward -369 -350 -4.03212 0.178
NP_440588.1_2 Reverse -20 -39 -3.73712 0.195
NP_442006.1_2 Forward -68 -51 -18.3491 0.29
NP_440707.1_9 Reverse -293 -312 0.0977854 0.293
NP_440793.1_1 Reverse -47 -61 8.75042 0.295
NP_442320.1_8 Reverse -148 -162 -5.31028 0.217
NP_440629.1_4 Reverse -105 -124 12.5858 0.217
NP_442003.1_9 Reverse -45 -64 2.85105 0.291
NP_440199.1_10 Forward -280 -270 6.76487 0.269
NP_441057.1_4 Forward -93 -75 -3.52077 0.29
NP_442489.1_7 Reverse -274 -283 -1.86856 0.259
NP_440559.1_1 Forward -384 -375 4.71961 0.217
NP_440559.1_1 Reverse -275 -284 4.71961 0.217
NP_440559.1_1 Forward -282 -273 4.62128 0.24
NP_442749.1_5 Reverse -339 -356 7.83807 0.255
NP_441040.1_2 Reverse -183 -202 -3.54046 0.146
NP_442849.1_1 Forward -108 -94 8.25939 0.282
NP_442346.1_5 Forward -321 -311 6.27322 0.208
NP_442346.1_5 Forward -201 -191 4.99491 0.267
NP_442346.1_5 Forward -284 -274 4.89658 0.269
NP_441629.1_3 Reverse -237 -256 -1.96793 0.268
NP_440555.1_4 Forward -148 -129 17.3057 0.123
NP_440555.1_6 Forward -335 -316 17.699 0.117
NP_440555.1_7 Forward -216 -197 16.2241 0.267
NP_440486.1_6 Forward -75 -56 9.3409 0.231
NP_440010.1_4 Reverse -288 -307 -0.689632 0.26
NP_442137.1_8 Reverse -155 -173 17.352 0.227
NP_442900.1_1 Forward -261 -242 -8.16202 0.276
NP_441888.1_7 Forward -306 -292 0.491246 0.295
NP_441948.1_4 Forward -91 -73 -0.275845 0.139
NP_441948.1_4 Reverse -285 -303 -4.11075 0.217
NP_441112.1_8 Reverse -349 -368 3.44104 0.232
NP_442162.1_4 Forward -119 -100 13.7658 0.261
NP_442162.1_9 Reverse -275 -282 9.28223 0.0694
NP_441973.1_1 Reverse -13 -28 1.35653 0.235
NP_442199.1_5 Reverse -158 -177 -7.08038 0.286
NP_442140.1_3 Reverse -237 -247 5.09324 0.227
NP_442140.1_3 Forward -342 -332 4.40493 0.243
NP_440590.1_4 Forward -342 -329 -4.50394 0.262
NP_440590.1_4 Reverse -332 -345 -5.68391 0.286
NP_440590.1_4 Forward -384 -371 -5.68391 0.286
NP_442497.1_10 Reverse -275 -284 0.29472 0.199
NP_440227.1_2 Reverse -349 -365 12.0549 0.271
NP_441239.1_9 Forward -285 -273 3.48056 0.285
NP_441017.1_8 Reverse -40 -55 8.2397 0.25
NP_440354.1_7 Reverse -268 -286 6.31233 0.284
NP_440546.1_4 Forward -245 -235 12.4699 0.0679
NP_440546.1_4 Reverse -236 -246 8.20381 0.199
NP_440546.1_6 Reverse -109 -128 8.84924 0.253
NP_443033.1_7 Reverse -166 -185 10.7175 0.293
NP_440462.1_4 Forward -45 -31 6.48943 0.28
NP_440462.1_6 Forward -387 -377 3.91327 0.224
NP_440462.1_6 Reverse -152 -162 3.12662 0.26
NP_442499.1_1 Reverse -59 -78 6.19431 0.215
NP_442479.1_9 Reverse -154 -173 -9.24366 0.266
NP_442402.1_4 Reverse -2 -21 -10.2277 0.298
NP_442402.1_9 Forward -294 -275 12.8808 0.198
NP_440696.1_3 Forward -389 -371 -3.91409 0.293
NP_441843.2_9 Forward -161 -143 11.1729 0.221
NP_442039.1_4 Reverse -275 -282 10.8555 0.109
NP_441811.1_8 Forward -381 -367 11.111 0.219
NP_440825.1_6 Reverse -152 -171 8.35759 0.285
NP_442837.1_3 Reverse -377 -384 8.79057 0.165
NP_441011.1_8 Forward -244 -235 5.80125 0.227
NP_442533.1_1 Forward -256 -237 -5.60541 0.155
NP_442533.1_1 Forward -220 -201 -16.0285 0.262
NP_442533.1_1 Forward -400 -381 -17.7001 0.293
NP_442533.1_6 Forward -283 -274 3.63797 0.206
NP_442533.1_6 Reverse -292 -301 1.67135 0.293
NP_442232.1_3 Forward -208 -189 -6.88371 0.193
NP_442322.1_4 Reverse -130 -147 -8.61494 0.286
NP_442269.1_10 Reverse -155 -174 1.86774 0.282
NP_441028.1_6 Reverse -99 -109 17.1874 0.132
NP_441028.1_6 Reverse -100 -110 6.0761 0.232
NP_441028.1_6 Reverse -12 -22 5.38779 0.255
NP_441028.1_6 Reverse -54 -64 4.89613 0.275
NP_440116.1_8 Reverse -275 -294 -7.76869 0.237
NP_439965.1_7 Forward -308 -289 10.8063 0.294
NP_441059.1_4 Forward -64 -45 11.7008 0.143
NP_443045.1_9 Reverse -194 -212 13.293 0.201
NP_441106.1_1 Reverse -333 -342 2.35967 0.287
NP_439903.1_6 Forward -185 -166 -0.00131823 0.275
NP_440670.1_8 Reverse -274 -283 5.3096 0.167
NP_441930.1_1 Reverse -61 -80 5.80098 0.266
NP_440886.1_7 Forward -302 -292 6.66608 0.115
NP_442614.1_2 Forward -19 -5 9.63603 0.242
NP_441753.1_10 Reverse -107 -126 2.85105 0.226
NP_439967.1_3 Reverse -248 -266 16.4963 0.271
NP_440107.1_2 Reverse -166 -185 9.63589 0.299
NP_441962.1_4 Forward -205 -186 4.916 0.0974
NP_440387.1_1 Reverse -223 -239 -2.69473 0.148
NP_441431.1_3 Forward -89 -70 3.24438 0.271
NP_441836.1_2 Forward -266 -247 -2.85214 0.232
NP_440114.1_10 Reverse -274 -288 8.45605 0.202
NP_442437.1_4 Reverse -156 -175 8.16093 0.25
NP_440311.1_5 Reverse -152 -166 21.8284 0.0534
NP_441510.2_6 Reverse -376 -395 12.7816 0.268
NP_442087.1_2 Forward -368 -349 12.5342 0.289
NP_440293.1_3 Forward -397 -378 -2.75381 0.241
NP_440293.1_3 Forward -212 -193 -4.72043 0.264
NP_440766.1_4 Reverse -330 -344 2.85119 0.167
NP_441237.1_9 Reverse -275 -285 11.5831 0.17
NP_441237.1_9 Reverse -155 -165 11.1898 0.196
NP_441979.1_5 Forward -307 -288 -10.817 0.228
NP_442743.1_1 Forward -185 -166 6.68515 0.268
NP_442942.1_3 Reverse -191 -210 2.65439 0.283
NP_442930.1_1 Forward -357 -347 12.7626 0.239
NP_440502.1_3 Forward -178 -168 14.6665 0.209
NP_440801.1_10 Reverse -288 -307 11.2092 0.272
NP_441332.1_6 Forward -305 -295 13.583 0.184
NP_442509.1_9 Reverse -67 -77 8.3377 0.192
NP_441885.1_5 Forward -283 -273 0.668351 0.133
NP_442341.1_7 Forward -204 -190 3.63784 0.217
NP_442341.1_7 Forward -305 -291 1.17956 0.297
NP_441173.1_9 Reverse -100 -108 11.3271 0.226
NP_443000.1_3 Reverse -291 -310 14.4312 0.228
NP_443059.1_10 Reverse -75 -94 5.50519 0.194
NP_441842.1_7 Forward -187 -168 10.0284 0.261
NP_440275.1_3 Reverse -332 -342 3.61828 0.219
NP_442275.1_1 Forward -174 -155 1.47442 0.284
NP_441397.1_8 Reverse -110 -123 13.1442 0.245
NP_441902.1_3 Forward -108 -98 14.5365 0.218
NP_441902.1_3 Reverse -356 -366 13.176 0.23
NP_442495.1_5 Reverse -191 -210 6.29264 0.291
NP_442214.1_1 Reverse -149 -168 10.8159 0.25
NP_440172.1_1 Forward -283 -273 11.0914 0.0428
NP_440249.1_2 Forward -360 -350 14.3359 0.284
NP_442034.1_7 Reverse -112 -130 8.86894 0.245
NP_441766.1_2 Forward -283 -274 4.62128 0.172
NP_443052.1_9 Reverse -253 -272 1.86774 0.18
NP_442226.1_1 Reverse -159 -178 12.0942 0.281
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GACAGGGTTGAGGCTAGGGATCGATATTGATTGCTTGTTGCTCAAAAAATTAACGTCACCGCTCGTCGCTGAGATATTTGCGCTATGACCCCTGACTCCCGTCACCGCCGTCTATTGGCCAATCGCTATCAACTGGTTGAGTTGGTGGGTAGTGGAGCTATGGGTCAAGTCTACCGAGCGGAAGATAAGCTCCTTGGGGGAGTCACCGTCGCAGTCAAATTCCTTTCCCAAGCCTTGCTCAATCCCCGCATGAAGGAACGGTTTGAACGGGAAGCCACTATTTCGGCCCTACTGGGGGAAAAAAGTATCCACATTGTGCGGGTGCGGGATTACGGCCTGGACGAAAAGGAAATTCCCTTCTACGTGATGGAATACCTCCAAGGGGAAAACAATTAGTGAC

CDS

GTGATTAAATACCGTCCCCTCAAAGTAGAGCGCTTTTTAAAAATAGCTAGGCAAATTTGCTTTGGCTTGGATTGTGCCCATAAAGGAATTATTTACCAAGGGGAAGCCTGCCCCGTTGTCCACCGGGATATCAAGCCCAGCAACGTACTGTTGGTGGAAGACCCCGCCCTGGGGGAACTGGTTAAAATTCTCGATTTTGGTATCGCCAAATTAGTACAAGCAGCAGAGGAGTCGAAAACCCAAGCTTTTATGGGTACCCTTGCCTATTGTTCCCCAGAGCAAATGGAGGGCAAAGAGTTAGATAGCCGTTCGGACATTTACAGTCTGGGGGTGATGATGTACGAAATGCTAACGGGGGAAATGCCCCTGTTCCCAGACAATTCTTCCTTTGGGGGTTGGTATGAAGCCCATCATCACACTAAGCCCCATCCCTTTTCCGCCCGTTATAAAATCCCCGCTTCCCTCGAAGCCTTGGTGATGAACTGCCTGGCCAAAAGCCCCAAAGGTCGTCCCCAATCGGTGGATGTGATTATCCGGGCGATCGATGCCATTGAAGCGGAAATCAAAGCTCCCCCCATTTCCGACACCGAGAAAACCCAGATTGCTCCCCATTTACTCAACACGGATATGGAAGCAACGGTGGTGGCCCAGCGGGGCCCGGGAATCGTCCCAGAAACGCGGTTGCCGCTGGTGAGTGAACTCTGTAAGCAGTTAGAGTGGCCCTCCGATAAACCAAAACAGAAAATTGTTTTTCCCTATGTGCTCAACGCCGCTGAAGGAAAATTGGCTAGTTTGTGGGTGATGTTGAATCAAGAGGATATCCTCACCCGGATGTCCAGCATCCGCTACAACCAATTTTTACTGATGACTTCTCCCCATCCCATGGTGCTGTGGATTACGGTGCTCTACCATCGGGAATATGGTCCCCGCTGGTTGCCCTGTTATTTGGATTTAAAGACTAGGTCGGGTCAGAGTTTTGCCCAGATGTTGGGGGAATCCGGTACCTATTGGTTGCTGTTTTTTGCGTTGGAAAATCCCACTCGCTGTCAGCATATGTTGACCGCTACCGTTGCCCCCAATCAGTGTAAGTTGCTCAAGGAGTGGGCCCAAACTAGTCAATCCATGCCCGGTGGTAAACCCCAGGTGACTAAACGGTTACTTAAGCAGGAGTTAGACCGGCTTAAACCTAAAATTGAGGCGAAATTGTCCCAGGTTAAACCATCCTTTAACAAGGAGGTTTCAGGATTGTGA

Protein

MIKYRPLKVERFLKIARQICFGLDCAHKGIIYQGEACPVVHRDIKPSNVLLVEDPALGELVKILDFGIAKLVQAAEESKTQAFMGTLAYCSPEQMEGKELDSRSDIYSLGVMMYEMLTGEMPLFPDNSSFGGWYEAHHHTKPHPFSARYKIPASLEALVMNCLAKSPKGRPQSVDVIIRAIDAIEAEIKAPPISDTEKTQIAPHLLNTDMEATVVAQRGPGIVPETRLPLVSELCKQLEWPSDKPKQKIVFPYVLNAAEGKLASLWVMLNQEDILTRMSSIRYNQFLLMTSPHPMVLWITVLYHREYGPRWLPCYLDLKTRSGQSFAQMLGESGTYWLLFFALENPTRCQHMLTATVAPNQCKLLKEWAQTSQSMPGGKPQVTKRLLKQELDRLKPKIEAKLSQVKPSFNKEVSGL