Your browser is old and dusty. Try Google Chrome!

Details for sll1573

ORF sll1573
Accession NP_440557.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -93 -107 5.30946 0.138
NP_441061.1_2 Reverse -377 -391 -2.06536 0.281
NP_440557.1_1 Forward -273 -254 19.2723 0.038
NP_440557.1_1 Reverse -151 -170 1.27776 0.261
NP_440557.1_5 Forward -116 -97 18.289 0.283
NP_440557.1_6 Forward -34 -15 28.4171 0.000896
NP_440557.1_7 Forward -147 -135 21.5735 0.0839
NP_441453.1_4 Forward -101 -93 5.42762 0.135
NP_442151.1_6 Reverse -92 -106 8.75105 0.164
NP_440561.1_4 Reverse -90 -109 13.5996 0.229
NP_440150.1_6 Forward -394 -375 0.687771 0.296
NP_442287.1_3 Reverse -84 -101 12.4278 0.3
NP_442173.1_5 Reverse -210 -220 15.2464 0.287
NP_443027.1_4 Forward -98 -88 6.8632 0.262
NP_442972.1_2 Reverse -250 -264 11.7003 0.267
NP_440304.1_4 Forward -103 -93 7.45319 0.113
NP_440370.1_10 Forward -110 -91 15.4374 0.0845
NP_441738.1_2 Forward -358 -351 6.72528 0.236
NP_441738.1_2 Reverse -370 -377 6.03696 0.295
NP_441770.1_4 Reverse -125 -144 -11.9969 0.29
NP_440747.1_10 Reverse -72 -84 -12.1541 0.227
NP_441130.1_10 Forward -103 -89 11.3077 0.107
NP_440842.1_3 Forward -384 -365 9.63589 0.288
NP_443018.1_3 Forward -100 -93 10.6589 0.0967
NP_443018.1_3 Reverse -93 -100 4.16902 0.278
NP_441316.1_7 Forward -103 -88 5.48643 0.121
NP_440376.1_1 Forward -84 -75 0.589713 0.267
NP_441077.1_6 Reverse -252 -268 1.9342 0.293
NP_442485.1_3 Reverse -87 -106 -5.9004 0.296
NP_441846.1_10 Reverse -341 -360 -14.6519 0.235
NP_440642.1_10 Forward -363 -349 1.76896 0.289
NP_441013.1_2 Forward -396 -378 -4.01242 0.295
NP_442658.1_1 Forward -393 -383 9.12434 0.167
NP_442782.1_2 Forward -220 -206 4.42448 0.254
NP_442496.1_5 Forward -173 -155 9.0656 0.24
NP_441256.1_1 Forward -394 -375 -8.752 0.264
NP_441958.1_5 Reverse -91 -101 -0.708283 0.221
NP_440203.1_5 Forward -358 -348 11.2876 0.2
NP_442816.1_7 Forward -269 -250 4.72643 0.269
NP_439905.1_2 Reverse -371 -385 11.111 0.208
NP_439905.1_2 Reverse -93 -107 10.816 0.208
NP_439990.1_5 Reverse -377 -390 17.2272 0.0266
NP_443055.1_6 Reverse -368 -386 3.16499 0.2
NP_442002.1_9 Forward -378 -371 11.4455 0.185
NP_440411.1_2 Forward -324 -305 4.20736 0.263
NP_441000.1_6 Reverse -371 -385 -4.52363 0.245
NP_440147.1_4 Forward -67 -54 2.47756 0.208
NP_440147.1_4 Reverse -23 -36 0.60927 0.249
NP_441550.1_8 Reverse -90 -100 9.81266 0.0836
NP_441550.1_8 Forward -103 -93 4.69947 0.291
NP_440206.1_4 Forward -106 -87 16.7149 0.0844
NP_441041.1_4 Forward -107 -88 -11.7019 0.251
NP_441725.1_4 Forward -70 -56 2.16228 0.291
NP_441725.1_5 Reverse -93 -103 8.73149 0.0585
NP_440983.1_5 Forward -397 -378 -8.06369 0.294
NP_440260.1_8 Forward -87 -69 -3.6191 0.253
NP_442281.1_1 Forward -106 -92 12.6836 0.035
NP_441334.1_7 Reverse -90 -109 -13.4719 0.213
NP_441079.1_7 Forward -280 -261 7.57013 0.114
NP_440437.1_1 Reverse -149 -168 -2.45882 0.219
NP_442500.1_8 Reverse -187 -201 9.31072 0.285
NP_442012.1_2 Reverse -380 -399 5.50599 0.211
NP_441860.1_1 Reverse -78 -92 16.422 0.276
NP_441556.1_4 Reverse -343 -362 9.81228 0.293
NP_441644.1_6 Forward -101 -91 14.6309 0.0117
NP_440867.1_3 Reverse -89 -108 8.65258 0.262
NP_440867.1_10 Reverse -367 -386 5.30933 0.271
NP_442029.1_1 Reverse -380 -399 -19.8634 0.297
NP_440929.1_8 Forward -101 -92 4.91628 0.162
NP_442554.1_8 Reverse -93 -103 11.3864 0.0365
NP_442554.1_8 Forward -100 -90 4.89658 0.168
NP_442554.1_9 Forward -277 -258 14.313 0.264
NP_442142.1_4 Forward -394 -381 7.98351 0.125
NP_442142.1_4 Reverse -208 -221 7.68852 0.132
NP_442250.1_5 Forward -65 -54 18.3477 0.108
NP_440620.1_4 Reverse -188 -202 13.5715 0.281
NP_440015.1_9 Forward -69 -51 4.73903 0.152
NP_441468.1_1 Forward -100 -93 3.97235 0.277
NP_441020.2_6 Forward -379 -362 6.92201 0.249
NP_441015.1_10 Reverse -377 -396 -8.16202 0.272
NP_442811.1_2 Reverse -380 -399 -0.688862 0.252
NP_442745.1_5 Forward -267 -248 14.3558 0.189
NP_441637.1_9 Forward -205 -187 -2.73412 0.292
NP_442719.1_2 Forward -132 -114 -3.22649 0.2
NP_442719.1_2 Forward -302 -284 -10.8963 0.284
NP_441056.1_1 Reverse -92 -111 2.0644 0.137
NP_441612.1_2 Forward -142 -132 18.4242 0.172
NP_441911.1_7 Reverse -199 -218 -19.0774 0.275
NP_441882.1_6 Reverse -374 -393 -0.787193 0.232
NP_440145.1_3 Forward -111 -92 -3.24547 0.192
NP_442542.1_2 Forward -393 -380 5.13249 0.281
NP_442050.1_5 Reverse -366 -376 7.15773 0.27
NP_441114.1_3 Forward -359 -350 7.27622 0.247
NP_440558.1_5 Reverse -93 -107 16.0275 0.239
NP_441498.1_3 Reverse -130 -148 7.68819 0.251
NP_442789.1_4 Forward -101 -82 -8.06369 0.299
NP_440093.1_8 Reverse -75 -94 18.6823 0.205
NP_441878.1_6 Forward -102 -92 1.65166 0.0795
NP_441878.1_6 Reverse -375 -385 -0.118297 0.167
NP_441878.1_6 Forward -43 -33 -7.19813 0.21
NP_441445.1_1 Forward -93 -74 2.3594 0.235
NP_441445.1_1 Reverse -342 -361 -0.39387 0.291
NP_442066.2_9 Reverse -364 -377 7.29578 0.237
NP_442166.1_3 Forward -168 -149 -10.0303 0.264
NP_440861.1_3 Forward -112 -94 14.7688 0.186
NP_442347.1_2 Reverse -16 -25 3.63797 0.284
NP_441037.1_8 Forward -54 -35 18.6823 0.208
NP_442594.1_8 Forward -87 -68 4.916 0.254
NP_441633.1_3 Forward -188 -175 -6.47056 0.253
NP_442590.1_9 Reverse -375 -394 3.53937 0.285
NP_441728.2_5 Reverse -368 -387 13.3725 0.269
NP_441007.1_10 Reverse -87 -100 1.78924 0.203
NP_440256.1_1 Reverse -379 -398 -2.0655 0.112
NP_440256.1_1 Reverse -267 -286 -10.0303 0.293
NP_441362.1_4 Forward -203 -185 7.68896 0.292
NP_442158.1_4 Reverse -47 -57 10.4031 0.297
NP_442866.1_1 Reverse -87 -106 10.0292 0.0832
NP_441464.1_10 Reverse -231 -245 12.8809 0.201
NP_440677.1_6 Forward -111 -92 8.25926 0.277
NP_442386.1_3 Forward -57 -38 12.6841 0.279
NP_441340.1_5 Reverse -93 -100 11.3472 0.0526
NP_441340.1_9 Forward -341 -331 7.19474 0.29
NP_441676.1_9 Forward -251 -234 11.9361 0.253
NP_440586.1_8 Forward -100 -93 5.74197 0.283
NP_440027.1_3 Forward -391 -373 2.77167 0.286
NP_443051.1_1 Reverse -91 -100 4.71961 0.111
NP_443051.1_5 Reverse -252 -271 5.60432 0.256
NP_441138.1_5 Forward -214 -201 3.97694 0.297
NP_440819.1_5 Forward -144 -136 6.41093 0.285
NP_439977.1_5 Reverse -86 -105 5.40766 0.15
NP_441572.1_7 Forward -397 -378 -6.1954 0.284
NP_440221.1_4 Reverse -45 -64 15.0441 0.161
NP_441018.1_7 Reverse -88 -107 11.8975 0.173
NP_441018.1_7 Reverse -378 -397 9.3409 0.227
NP_442262.1_10 Forward -100 -93 12.0355 0.062
NP_442262.1_10 Reverse -57 -64 7.6106 0.274
NP_440531.1_8 Forward -88 -69 12.4875 0.136
NP_440297.1_9 Reverse -93 -103 9.61647 0.0917
NP_440350.1_5 Forward -269 -250 -4.03212 0.273
NP_440999.1_9 Forward -395 -381 -1.08205 0.226
NP_442033.1_10 Forward -393 -374 -5.99873 0.182
NP_442033.1_10 Reverse -54 -73 -12.7836 0.277
NP_441123.1_7 Forward -50 -31 21.0423 0.115
NP_442845.1_2 Reverse -92 -106 10.0294 0.161
NP_442845.1_2 Reverse -227 -241 4.81781 0.251
NP_442845.1_2 Reverse -86 -100 3.73617 0.279
NP_441178.1_5 Reverse -80 -99 8.55425 0.3
NP_441178.1_6 Forward -394 -375 3.9319 0.269
NP_441469.1_8 Forward -43 -34 8.35786 0.227
NP_441462.1_2 Reverse -92 -102 -1.29827 0.299
NP_443062.1_1 Reverse -87 -105 3.86557 0.282
NP_442204.1_1 Forward -105 -94 1.33697 0.274
NP_440544.1_5 Reverse -135 -142 14.5681 0.264
NP_440454.1_2 Reverse -255 -269 11.6616 0.272
NP_440516.1_6 Reverse -156 -170 7.66879 0.269
NP_442428.1_5 Forward -100 -93 4.36568 0.271
NP_441443.1_1 Reverse -350 -369 -5.50708 0.298
NP_441443.1_7 Reverse -379 -398 -1.47551 0.258
NP_441443.1_7 Forward -223 -204 -2.36049 0.268
NP_440673.1_3 Reverse -62 -69 8.20058 0.234
NP_441733.1_10 Reverse -89 -102 5.03416 0.231
NP_442694.1_4 Forward -85 -76 16.126 0.164
NP_443054.1_2 Forward -103 -89 3.34284 0.24
NP_441851.1_10 Forward -102 -92 5.97822 0.19
NP_442622.1_1 Reverse -367 -386 -5.31042 0.257
NP_441668.1_4 Forward -87 -68 1.57275 0.212
NP_442515.1_1 Reverse -74 -88 -2.65535 0.277
NP_441396.1_5 Reverse -386 -395 7.37455 0.279
NP_440593.1_9 Reverse -95 -109 7.57108 0.284
NP_441982.1_6 Reverse -247 -256 14.9681 0.274
NP_441046.1_2 Reverse -113 -132 5.99764 0.221
NP_442843.1_1 Reverse -108 -127 -10.3253 0.277
NP_440474.1_8 Forward -100 -86 6.68548 0.22
NP_442450.1_3 Reverse -254 -272 6.01657 0.245
NP_441031.1_8 Forward -101 -82 -4.03212 0.248
NP_441570.1_1 Forward -101 -83 -17.2871 0.269
NP_442729.1_5 Reverse -123 -133 8.1415 0.248
NP_442729.1_5 Reverse -381 -391 7.84651 0.261
NP_440539.1_9 Forward -393 -374 1.47442 0.278
NP_441528.1_2 Forward -87 -68 6.78348 0.297
NP_442348.1_2 Forward -208 -199 7.17789 0.285
NP_440526.1_3 Reverse -212 -223 5.46638 0.247
NP_440526.1_3 Forward -64 -53 0.156538 0.297
NP_441432.1_9 Forward -266 -253 8.40445 0.289
NP_441432.1_9 Forward -265 -252 7.91967 0.298
NP_441945.1_10 Forward -227 -208 8.45592 0.273
NP_442400.1_10 Reverse -189 -202 7.89211 0.281
NP_442489.1_7 Forward -101 -92 -1.47524 0.203
NP_440559.1_1 Reverse -93 -102 4.91628 0.175
NP_441659.2_8 Forward -101 -91 4.69992 0.127
NP_439956.1_7 Reverse -168 -187 3.53937 0.257
NP_440335.1_9 Reverse -252 -270 10.8356 0.28
NP_440779.1_5 Forward -65 -48 -15.0058 0.3
NP_442346.1_5 Forward -102 -92 6.07655 0.216
NP_440545.1_3 Forward -105 -88 -4.38605 0.224
NP_440545.1_3 Reverse -88 -105 -6.451 0.28
NP_441856.1_1 Reverse -380 -399 4.71934 0.298
NP_440459.1_2 Forward -67 -50 10.9536 0.185
NP_440459.1_2 Reverse -41 -58 7.70866 0.283
NP_440847.1_3 Forward -359 -345 10.3237 0.298
NP_441329.1_6 Reverse -250 -269 5.87233 0.191
NP_441329.1_6 Reverse -252 -271 1.76618 0.231
NP_441895.1_2 Reverse -106 -125 -17.6018 0.234
NP_440671.1_4 Forward -107 -93 16.2242 0.0318
NP_442404.1_9 Reverse -202 -216 12.3887 0.263
NP_442140.1_3 Forward -100 -90 5.87989 0.194
NP_441692.1_2 Forward -179 -160 5.99764 0.14
NP_440875.1_9 Forward -99 -89 15.0883 0.0332
NP_441813.1_5 Forward -103 -93 3.22496 0.173
NP_442472.1_9 Forward -284 -265 19.1731 0.107
NP_442497.1_10 Reverse -93 -102 0.29472 0.199
NP_440821.1_4 Forward -103 -93 0.275027 0.19
NP_441239.1_9 Reverse -90 -102 9.28209 0.11
NP_441239.1_9 Forward -103 -91 5.84051 0.206
NP_441892.1_1 Forward -394 -377 -3.10775 0.233
NP_441892.1_1 Reverse -72 -89 -6.15601 0.298
NP_441017.1_6 Forward -389 -375 14.6503 0.138
NP_441541.1_7 Reverse -247 -265 18.8929 0.11
NP_440833.1_6 Forward -125 -111 13.9619 0.157
NP_440391.1_7 Forward -367 -348 13.0766 0.132
NP_441230.1_5 Reverse -87 -106 10.4225 0.106
NP_440462.1_6 Forward -383 -373 2.14332 0.294
NP_440653.1_10 Forward -107 -88 3.44104 0.273
NP_439942.1_2 Reverse -185 -204 13.3758 0.259
NP_441811.1_1 Reverse -367 -386 5.70265 0.28
NP_441811.1_8 Reverse -54 -68 15.3392 0.162
NP_442679.1_1 Reverse -246 -265 -4.91709 0.286
NP_442837.1_3 Reverse -373 -380 5.74231 0.275
NP_441760.1_2 Reverse -90 -109 13.7658 0.0624
NP_440505.1_3 Forward -222 -212 10.5998 0.102
NP_440505.1_3 Reverse -380 -390 4.69992 0.272
NP_441701.1_3 Reverse -51 -68 5.84037 0.299
NP_442471.1_5 Forward -285 -266 17.4492 0.201
NP_440914.1_1 Forward -101 -91 10.9573 0.116
NP_440914.1_1 Forward -391 -381 10.3717 0.142
NP_440914.1_1 Reverse -265 -275 6.27291 0.288
NP_442533.1_6 Forward -101 -92 3.93297 0.197
NP_442533.1_6 Forward -42 -33 3.14632 0.224
NP_441482.1_7 Forward -107 -93 17.6992 0.00499
NP_441482.1_7 Reverse -362 -376 -8.5552 0.193
NP_441028.1_6 Reverse -134 -144 10.1076 0.21
NP_441527.1_4 Reverse -253 -272 -0.430137 0.146
NP_441527.1_4 Reverse -250 -269 -7.30556 0.232
NP_441527.1_4 Reverse -252 -271 -7.974 0.24
NP_441527.1_4 Reverse -254 -273 -12.6531 0.292
NP_440007.1_9 Forward -105 -91 22.4191 0.0247
NP_441680.1_4 Forward -67 -48 0.58944 0.246
NP_441972.1_5 Forward -64 -45 -9.93197 0.294
NP_441825.1_4 Forward -86 -76 16.9913 0.186
NP_439903.1_6 Reverse -89 -108 2.06362 0.233
NP_001035870.1_3 Reverse -222 -241 -1.86883 0.25
NP_441286.1_1 Reverse -65 -77 0.0389777 0.119
NP_441286.1_1 Reverse -91 -103 -6.05754 0.245
NP_442674.1_10 Forward -98 -79 13.3725 0.205
NP_440670.1_8 Reverse -92 -101 5.01461 0.175
NP_440670.1_8 Forward -101 -92 4.22796 0.202
NP_440907.2_8 Forward -100 -90 5.78111 0.188
NP_442264.1_2 Forward -111 -94 9.38028 0.196
NP_442264.1_2 Reverse -56 -73 4.56207 0.298
NP_442264.1_5 Reverse -92 -106 13.4709 0.253
NP_440841.1_1 Forward -73 -54 17.2074 0.274
NP_441463.1_2 Forward -269 -251 1.33175 0.256
NP_441463.1_3 Forward -284 -265 -8.752 0.273
NP_442794.1_1 Forward -105 -93 5.74217 0.209
NP_442794.1_1 Forward -395 -383 5.05386 0.236
NP_442794.1_5 Reverse -174 -188 12.291 0.275
NP_441962.1_4 Forward -106 -87 -11.3086 0.239
NP_441962.1_4 Reverse -353 -372 -14.8485 0.294
NP_441431.1_3 Forward -220 -201 8.06259 0.236
NP_442020.1_1 Reverse -189 -208 13.0766 0.0919
NP_440114.1_10 Forward -101 -87 11.5043 0.111
NP_441853.1_6 Forward -320 -301 12.7035 0.261
NP_442357.1_8 Reverse -248 -267 5.89931 0.241
NP_440422.1_10 Forward -271 -252 5.66045 0.267
NP_440457.1_1 Forward -105 -93 5.74217 0.138
NP_440987.1_4 Reverse -187 -206 6.4893 0.181
NP_441801.1_4 Forward -61 -51 3.32329 0.231
NP_440801.1_10 Reverse -378 -397 8.35759 0.272
NP_441253.1_9 Forward -183 -164 17.2946 0.295
NP_442587.1_9 Forward -211 -198 14.0806 0.184
NP_440554.1_4 Forward -100 -90 4.0116 0.205
NP_442737.1_5 Reverse -381 -400 19.2781 0.0634
NP_442737.1_5 Forward -221 -202 11.0368 0.294
NP_442703.1_9 Reverse -251 -269 3.46073 0.291
NP_442341.1_9 Reverse -90 -104 11.2087 0.129
NP_441756.1_5 Forward -395 -376 2.0644 0.213
NP_441842.1_10 Reverse -49 -63 15.9292 0.0359
NP_440275.1_3 Reverse -90 -100 6.37155 0.111
NP_442451.1_2 Forward -73 -54 -4.91709 0.215
NP_440175.1_7 Reverse -88 -106 9.26552 0.28
NP_440172.1_1 Forward -101 -91 5.28991 0.146
NP_442015.1_10 Forward -105 -92 4.93583 0.156
NP_441226.1_7 Reverse -93 -100 12.4284 0.0404
NP_440416.1_9 Reverse -365 -384 -8.16202 0.111
NP_440416.1_9 Reverse -375 -394 -19.5684 0.276
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CACTCCCCCCACAATGGCCAGGGAGCGAACTGCTGAATTTACCATTCCCCACGTAGTCCTATAAAAACTTAGAATCCAATAAAATGTCCTTATATTGTAACTTTGACTACTGTTCTAGAACAACAATGTCATTGTTTTTACTGTTTTTTGACTAGACTCCCCATCACTAAACTAAATAGTGGCAATTGTGGTGTGGATTTTTTGTGATATTTCCTGAGCTCACTGCCAGAATTAGGGACAATGGAATTGCACGGAACCGGAGAAAAACACTTTGGCCCACACTTTCCTATTGGAGCCAGGCCGATGGCATCTAGAGGGCTTTTGGCAGGAGCGCAATCAATCTCCCCTGGAAATCAAGGGAGGTGCCCTGATAGCTTGGAATCAGGAAGATTGGTTTACC

CDS

ATGGTGACCAAGTTTAGTTTTCCTGGTAGTAGTCACCAAGATATATCCTGTCAGTATCGGGGGCGTCTCAATGGCGGAGAGTCCCAATACACCTACGTTTTGCAACACAGTCAACTAGGGAGAGTAGAAGGGGAAGGCTGGCTCTCTAACCATGCCATTGTTCAGCGCTATTGGGTCCTAGGCGATCGCCAACGGCAGAGTGGCTTTGAAACCTTTTACCGCTTCAATGATCGTCGTTATTATTTAGCTAGTGGGATGCTCACCGGCCACTCCTTGACCAGTACAATGGAAGCCACCCTGGAAAGACAGGGTTGA

Protein

MVTKFSFPGSSHQDISCQYRGRLNGGESQYTYVLQHSQLGRVEGEGWLSNHAIVQRYWVLGDRQRQSGFETFYRFNDRRYYLASGMLTGHSLTSTMEATLERQG