Your browser is old and dusty. Try Google Chrome!

Details for sll1570

ORF sll1570
Accession NP_440564.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -205 -186 -23.6983 0.197
NP_440815.1_5 Forward -222 -203 8.94757 0.228
NP_442291.1_5 Reverse -212 -228 11.1699 0.0407
NP_440897.1_6 Forward -244 -225 -4.22953 0.27
NP_441453.1_4 Forward -222 -214 7.29591 0.0589
NP_441453.1_4 Reverse -213 -221 6.70593 0.121
NP_441453.1_4 Forward -393 -385 5.13263 0.179
NP_441453.1_4 Forward -47 -39 4.34598 0.257
NP_441623.1_1 Reverse -189 -207 5.03403 0.177
NP_442151.1_1 Forward -119 -100 3.53937 0.287
NP_441818.1_9 Reverse -213 -232 -11.0136 0.3
NP_440226.1_1 Reverse -213 -232 6.39097 0.129
NP_443002.1_5 Forward -356 -338 7.98318 0.299
NP_442173.1_1 Reverse -214 -222 7.59091 0.163
NP_442173.1_1 Forward -221 -213 5.82095 0.2
NP_442752.1_4 Reverse -213 -220 13.8055 0.0199
NP_443027.1_4 Forward -49 -39 7.15819 0.244
NP_443027.1_4 Forward -224 -214 5.78156 0.298
NP_442975.1_10 Forward -226 -212 10.422 0.0553
NP_442975.1_10 Reverse -380 -394 10.3237 0.056
NP_440784.1_7 Forward -221 -214 6.23397 0.241
NP_440784.1_7 Reverse -214 -221 6.13563 0.241
NP_440061.1_9 Reverse -36 -50 10.3237 0.126
NP_441054.1_2 Forward -76 -57 10.9142 0.277
NP_442062.1_8 Reverse -213 -223 7.55152 0.0946
NP_442062.1_8 Forward -222 -212 5.19158 0.181
NP_442242.1_4 Reverse -214 -221 12.4288 0.0393
NP_440044.1_8 Reverse -39 -58 2.55606 0.149
NP_442097.1_7 Forward -235 -216 7.66927 0.159
NP_439918.1_2 Forward -129 -110 -1.47551 0.24
NP_440893.1_3 Reverse -47 -66 3.14526 0.273
NP_441594.1_6 Forward -237 -218 3.93269 0.224
NP_442110.1_7 Reverse -342 -356 0.196253 0.266
NP_441082.1_10 Forward -197 -184 9.55739 0.242
NP_441925.1_4 Reverse -49 -68 -8.16275 0.207
NP_440856.1_7 Forward -205 -186 -6.68705 0.246
NP_441083.1_5 Forward -222 -212 1.84832 0.198
NP_441083.1_5 Reverse -213 -223 0.865012 0.218
NP_441738.1_2 Forward -220 -213 15.28 0.0102
NP_441738.1_2 Reverse -263 -270 8.29857 0.176
NP_440209.1_1 Reverse -213 -221 14.8674 0.012
NP_440178.1_7 Reverse -212 -231 -15.2418 0.159
NP_441716.1_1 Reverse -303 -317 5.21113 0.239
NP_442111.1_4 Forward -223 -209 1.67122 0.296
NP_441163.1_9 Reverse -93 -112 17.699 0.112
NP_440343.1_3 Reverse -49 -67 4.93494 0.266
NP_440906.1_5 Forward -221 -214 12.0355 0.0724
NP_440906.1_5 Reverse -214 -221 12.0355 0.0724
NP_440906.1_5 Forward -392 -385 8.20058 0.19
NP_440747.1_10 Reverse -210 -222 5.05386 0.019
NP_440747.1_10 Forward -225 -213 -11.9574 0.178
NP_441486.1_1 Forward -225 -211 12.4876 0.0116
NP_441486.1_1 Reverse -210 -224 3.73617 0.0553
NP_441486.1_1 Reverse -35 -49 0.982901 0.122
NP_441486.1_1 Forward -50 -36 -6.39192 0.294
NP_442330.1_4 Forward -297 -278 14.8485 0.263
NP_442634.1_4 Forward -395 -381 -1.8687 0.149
NP_441014.1_10 Reverse -212 -231 -3.24622 0.297
NP_442848.1_1 Forward -228 -214 -4.62196 0.298
NP_442848.1_5 Reverse -55 -73 3.46073 0.276
NP_443018.1_3 Forward -46 -39 12.5271 0.0523
NP_443018.1_3 Reverse -39 -46 12.5271 0.0523
NP_443018.1_3 Forward -221 -214 5.34899 0.212
NP_443018.1_3 Reverse -214 -221 5.34899 0.212
NP_441634.1_8 Reverse -36 -50 -4.62196 0.295
NP_440376.1_1 Reverse -108 -117 5.60459 0.125
NP_440376.1_1 Forward -222 -213 -0.000272808 0.285
NP_440376.1_1 Reverse -213 -222 -0.0986038 0.285
NP_441588.1_4 Forward -220 -210 9.02648 0.14
NP_442687.1_7 Reverse -212 -222 6.37155 0.171
NP_442687.1_7 Forward -32 -22 4.0116 0.271
NP_442687.1_7 Reverse -107 -117 3.71661 0.292
NP_442485.1_3 Forward -77 -58 -5.99873 0.297
NP_441846.1_10 Forward -67 -48 -23.01 0.275
NP_441846.1_10 Forward -76 -57 -23.305 0.282
NP_442530.1_2 Reverse -148 -158 14.1397 0.207
NP_440642.1_10 Reverse -36 -50 1.67063 0.29
NP_441013.1_2 Reverse -202 -220 1.49411 0.248
NP_441422.1_7 Reverse -100 -117 -8.41762 0.27
NP_442658.1_1 Reverse -55 -65 5.09279 0.284
NP_441855.2_4 Reverse -253 -272 9.13744 0.287
NP_442782.1_2 Forward -128 -114 0.294584 0.291
NP_440656.1_8 Reverse -373 -392 -7.08038 0.249
NP_442544.1_2 Reverse -205 -219 -1.47537 0.287
NP_441414.1_9 Reverse -108 -127 -0.983855 0.0964
NP_441487.1_9 Reverse -294 -313 -1.67217 0.285
NP_442937.1_5 Reverse -208 -227 6.98095 0.265
NP_441958.1_5 Reverse -212 -222 1.455 0.0956
NP_441958.1_5 Forward -394 -384 0.471689 0.143
NP_440318.1_1 Reverse -197 -216 0.196116 0.297
NP_442836.1_5 Forward -53 -34 2.0644 0.269
NP_440203.1_5 Forward -219 -209 14.2375 0.0886
NP_440203.1_5 Reverse -263 -273 8.63269 0.29
NP_439905.1_1 Reverse -385 -398 9.06573 0.224
NP_440995.1_8 Reverse -28 -47 3.93269 0.264
NP_440984.1_7 Forward -398 -384 15.4376 0.0548
NP_439990.1_5 Reverse -208 -221 18.7022 0.0112
NP_441338.2_5 Forward -50 -31 16.8141 0.0773
NP_442911.1_2 Reverse -12 -31 -5.99873 0.172
NP_440153.1_8 Reverse -38 -51 4.24752 0.202
NP_443055.1_3 Reverse -204 -223 10.4542 0.289
NP_441099.1_5 Forward -232 -213 -9.14533 0.214
NP_441654.1_7 Reverse -116 -135 15.8248 0.155
NP_442598.1_2 Forward -85 -76 14.2577 0.252
NP_441294.1_7 Reverse -104 -118 11.8423 0.124
NP_441294.1_7 Forward -226 -212 9.4426 0.244
NP_441646.1_1 Reverse -296 -315 -1.08219 0.278
NP_442771.1_1 Forward -314 -296 -8.83064 0.208
NP_440147.1_4 Forward -119 -106 -0.0790467 0.271
NP_440147.1_4 Reverse -211 -224 -0.177378 0.276
NP_441550.1_8 Reverse -211 -221 5.28945 0.255
NP_441916.1_7 Forward -393 -383 4.3066 0.182
NP_441916.1_7 Forward -222 -212 1.455 0.285
NP_441916.1_10 Forward -230 -211 9.0459 0.163
NP_441041.1_4 Forward -222 -203 4.03102 0.0602
NP_441041.1_7 Forward -208 -196 4.79381 0.295
NP_440569.1_10 Reverse -310 -329 2.91208 0.28
NP_441725.1_5 Reverse -23 -33 0.275027 0.192
NP_439966.1_9 Forward -195 -186 14.2577 0.0863
NP_442941.1_3 Reverse -214 -224 7.55152 0.0711
NP_442941.1_3 Forward -221 -211 1.35667 0.15
NP_442941.1_3 Reverse -385 -395 -0.41329 0.259
NP_442281.1_1 Forward -227 -213 9.14375 0.0736
NP_441334.1_7 Forward -224 -205 -20.4534 0.276
NP_442049.1_6 Reverse -205 -224 3.73603 0.259
NP_440723.1_4 Forward -196 -177 -3.14714 0.272
NP_441644.1_6 Forward -47 -37 9.12434 0.084
NP_441644.1_6 Forward -222 -212 6.17443 0.165
NP_441644.1_6 Reverse -213 -223 3.61784 0.272
NP_440587.1_6 Reverse -18 -37 15.9291 0.115
NP_442215.1_2 Forward -116 -100 -5.34967 0.249
NP_442247.1_8 Forward -177 -163 13.3726 0.247
NP_440253.1_2 Reverse -213 -231 -3.52077 0.294
NP_442933.1_10 Reverse -213 -222 13.9627 0.0192
NP_442933.1_10 Forward -222 -213 8.1612 0.0885
NP_442933.1_10 Reverse -384 -393 4.12963 0.28
NP_441751.2_8 Reverse -214 -228 -4.32697 0.17
NP_442554.1_8 Forward -46 -36 9.81313 0.0545
NP_442554.1_8 Reverse -39 -49 6.27322 0.123
NP_442554.1_8 Forward -221 -211 5.5849 0.145
NP_441762.1_7 Forward -223 -211 -7.53251 0.293
NP_442142.1_4 Forward -225 -212 7.59019 0.135
NP_442292.1_1 Forward -221 -212 8.75118 0.0306
NP_442292.1_1 Forward -46 -37 5.21127 0.152
NP_442292.1_1 Reverse -214 -223 -0.295266 0.24
NP_442292.1_5 Forward -209 -190 -1.08219 0.257
NP_440919.1_1 Forward -198 -179 -6.39206 0.258
NP_440919.1_2 Forward -185 -166 -2.36049 0.274
NP_440895.1_6 Reverse -207 -220 11.3273 0.202
NP_440895.1_10 Reverse -227 -244 -5.86102 0.3
NP_440421.1_1 Forward -195 -181 13.7659 0.295
NP_441523.1_6 Reverse -100 -119 5.30933 0.239
NP_442301.1_5 Reverse -57 -76 13.3716 0.268
NP_440730.1_4 Forward -117 -98 15.5357 0.0954
NP_441468.1_1 Forward -221 -214 6.13563 0.209
NP_441468.1_1 Reverse -214 -221 6.0373 0.223
NP_441468.1_1 Reverse -39 -46 3.97235 0.277
NP_441468.1_1 Forward -46 -39 3.97235 0.277
NP_441673.1_1 Forward -222 -213 1.37636 0.114
NP_441673.1_1 Reverse -213 -222 1.1797 0.163
NP_441826.1_2 Forward -53 -39 1.37622 0.154
NP_441826.1_2 Forward -199 -185 -2.26202 0.269
NP_442490.1_9 Forward -307 -288 -8.85033 0.295
NP_442868.1_6 Reverse -106 -116 5.09324 0.158
NP_442868.1_6 Reverse -211 -221 -0.0199663 0.255
NP_442719.1_2 Reverse -23 -41 -1.75153 0.178
NP_441056.1_1 Reverse -213 -232 -8.94866 0.286
NP_442361.1_3 Reverse -207 -220 8.77074 0.285
NP_442808.1_1 Reverse -55 -65 11.4843 0.0481
NP_441101.1_5 Reverse -197 -215 14.7562 0.284
NP_442820.1_3 Reverse -41 -51 11.9759 0.3
NP_440385.1_2 Reverse -144 -158 18.4858 0.255
NP_440558.1_2 Reverse -300 -319 -2.95047 0.232
NP_440558.1_2 Reverse -193 -212 -6.1954 0.272
NP_441878.1_6 Reverse -302 -312 0.0783647 0.152
NP_441036.1_3 Forward -33 -14 -5.40875 0.286
NP_441036.1_8 Forward -223 -213 6.46988 0.229
NP_441557.1_5 Reverse -213 -222 8.84951 0.0343
NP_441557.1_5 Forward -222 -213 0.786375 0.106
NP_441557.1_5 Forward -393 -384 -0.786921 0.239
NP_441445.1_1 Reverse -29 -48 6.68596 0.144
NP_441445.1_1 Reverse -204 -223 2.45773 0.233
NP_441445.1_8 Forward -106 -87 -4.52377 0.277
NP_440101.1_6 Reverse -293 -312 11.6025 0.256
NP_442830.1_5 Reverse -56 -70 15.3386 0.168
NP_442212.1_7 Reverse -315 -334 15.7324 0.161
NP_442347.1_2 Forward -221 -212 3.93297 0.284
NP_442645.1_2 Forward -230 -211 -16.3235 0.23
NP_442645.1_2 Forward -55 -36 -21.1417 0.29
NP_441037.1_4 Reverse -211 -221 6.92787 0.237
NP_442594.1_10 Forward -125 -106 14.5516 0.129
NP_440136.1_2 Forward -221 -214 6.23397 0.171
NP_440136.1_2 Reverse -214 -221 6.13563 0.193
NP_442590.1_9 Reverse -293 -312 3.93269 0.28
NP_442998.1_5 Forward -76 -66 10.5998 0.207
NP_442998.1_5 Reverse -148 -158 10.0098 0.231
NP_442998.1_5 Reverse -173 -183 9.51814 0.238
NP_442998.1_5 Forward -33 -23 9.32148 0.243
NP_442998.1_10 Forward -220 -213 15.5754 0.0102
NP_440299.1_1 Reverse -209 -222 18.6032 0.00369
NP_441559.1_8 Reverse -192 -206 1.96621 0.151
NP_441559.1_8 Forward -197 -183 -7.76856 0.299
NP_440915.1_6 Reverse -162 -176 6.78443 0.0791
NP_442158.1_4 Forward -83 -73 13.943 0.21
NP_441704.1_8 Reverse -202 -221 10.4217 0.16
NP_442069.1_4 Forward -286 -267 4.71934 0.254
NP_440134.1_2 Reverse -164 -183 -0.688862 0.298
NP_442993.1_1 Reverse -213 -229 -6.13632 0.146
NP_442993.1_1 Forward -393 -377 -8.79125 0.176
NP_442993.1_1 Reverse -190 -206 -12.5278 0.274
NP_442386.1_9 Forward -48 -39 11.3073 0.0971
NP_442386.1_9 Reverse -37 -46 9.04574 0.175
NP_442386.1_9 Reverse -56 -65 7.07914 0.219
NP_442386.1_9 Reverse -183 -192 5.50585 0.25
NP_442386.1_9 Forward -223 -214 5.21086 0.262
NP_441340.1_5 Reverse -214 -221 6.13563 0.175
NP_441340.1_5 Forward -221 -214 5.93897 0.198
NP_441340.1_5 Reverse -39 -46 4.07068 0.239
NP_441340.1_5 Forward -46 -39 4.07068 0.239
NP_441947.1_10 Reverse -217 -235 0.510803 0.276
NP_442474.1_8 Forward -361 -342 12.9791 0.256
NP_442240.1_1 Reverse -188 -207 5.2102 0.264
NP_440586.1_1 Forward -121 -102 -0.590531 0.237
NP_440586.1_8 Reverse -214 -221 11.4451 0.0645
NP_440586.1_8 Forward -46 -39 7.61025 0.227
NP_440586.1_8 Reverse -39 -46 7.61025 0.227
NP_442251.1_6 Forward -221 -214 12.0355 0.0627
NP_441262.1_3 Reverse -213 -220 14.7888 0.0223
NP_440027.1_3 Forward -57 -39 3.26332 0.275
NP_443051.1_1 Reverse -212 -221 0.786375 0.125
NP_443051.1_1 Forward -394 -385 0.0980582 0.226
NP_439937.1_9 Reverse -365 -382 -1.24015 0.122
NP_439937.1_9 Reverse -63 -80 -1.7318 0.129
NP_440439.1_1 Forward -396 -383 1.59258 0.148
NP_440372.1_2 Reverse -214 -221 6.72562 0.0929
NP_440372.1_2 Forward -221 -214 6.62729 0.151
NP_440755.1_8 Forward -350 -336 19.1735 0.296
NP_440770.1_3 Forward -142 -128 14.2576 0.28
NP_440819.1_5 Reverse -172 -180 7.8859 0.266
NP_439977.1_7 Forward -233 -214 11.2084 0.263
NP_440139.1_1 Forward -228 -209 2.9486 0.219
NP_442384.1_10 Forward -222 -209 13.4906 0.0197
NP_440364.1_3 Forward -150 -131 23.7955 0.0133
NP_441604.1_4 Forward -125 -106 -5.99873 0.287
NP_442262.1_10 Forward -46 -39 10.4622 0.145
NP_442262.1_10 Reverse -39 -46 10.4622 0.145
NP_441689.1_5 Forward -224 -214 8.3377 0.132
NP_440344.1_10 Reverse -206 -223 -12.6459 0.261
NP_440282.1_10 Forward -316 -297 -7.76869 0.253
NP_441060.1_4 Forward -338 -320 7.39397 0.222
NP_440297.1_9 Reverse -23 -33 4.69992 0.223
NP_440297.1_9 Forward -46 -36 0.176696 0.282
NP_442280.1_10 Reverse -28 -46 12.3699 0.182
NP_440888.1_2 Forward -175 -161 7.3738 0.198
NP_440491.1_1 Reverse -105 -124 10.328 0.191
NP_442033.1_5 Reverse -283 -302 17.3057 0.147
NP_441543.1_2 Forward -221 -212 7.17789 0.131
NP_441543.1_2 Reverse -385 -394 4.91628 0.213
NP_441543.1_2 Reverse -214 -223 4.42462 0.246
NP_442845.1_2 Forward -53 -39 6.88276 0.201
NP_442845.1_2 Forward -228 -214 3.63784 0.282
NP_442710.1_1 Forward -254 -235 10.1275 0.18
NP_443064.1_6 Forward -222 -212 8.6886 0.276
NP_442337.1_8 Reverse -97 -116 3.44104 0.216
NP_442578.1_7 Reverse -214 -221 5.93897 0.183
NP_440710.1_1 Reverse -100 -118 -7.749 0.244
NP_441462.1_2 Reverse -213 -223 1.16001 0.0976
NP_441462.1_2 Forward -393 -383 -0.216628 0.192
NP_443062.1_1 Reverse -213 -231 13.1288 0.0663
NP_441601.1_4 Reverse -281 -300 -3.83545 0.293
NP_442204.1_1 Reverse -209 -220 8.7118 0.0852
NP_440516.1_8 Reverse -213 -222 8.1612 0.0417
NP_442428.1_5 Forward -221 -214 6.13563 0.209
NP_442428.1_5 Reverse -214 -221 6.0373 0.212
NP_442428.1_5 Forward -46 -39 4.36568 0.271
NP_442428.1_5 Reverse -39 -46 4.36568 0.271
NP_441443.1_7 Reverse -137 -156 -2.95047 0.281
NP_442120.1_10 Reverse -213 -232 -0.4922 0.167
NP_442120.1_10 Forward -393 -374 -14.0619 0.288
NP_442823.1_8 Forward -312 -293 9.83255 0.299
NP_440673.1_2 Reverse -28 -47 12.7308 0.139
NP_440673.1_2 Forward -57 -38 11.2676 0.181
NP_440673.1_3 Forward -220 -213 12.4288 0.0426
NP_440673.1_3 Forward -355 -348 7.80726 0.244
NP_441052.1_2 Forward -222 -212 1.74999 0.229
NP_441052.1_2 Reverse -213 -223 0.471689 0.257
NP_442219.1_9 Reverse -214 -223 8.65285 0.0681
NP_442219.1_9 Forward -221 -212 8.06287 0.0696
NP_440436.1_4 Forward -221 -212 13.9623 0.0193
NP_440436.1_4 Reverse -214 -223 12.684 0.034
NP_441884.1_9 Forward -208 -189 -22.42 0.278
NP_441719.1_4 Reverse -214 -221 6.72562 0.093
NP_441719.1_4 Forward -221 -214 6.62729 0.151
NP_441719.1_6 Reverse -54 -73 5.89851 0.288
NP_441733.1_10 Reverse -163 -176 3.5592 0.295
NP_442366.1_3 Reverse -212 -230 0.707465 0.166
NP_442366.1_3 Forward -142 -124 -1.35749 0.211
NP_442366.1_5 Reverse -210 -220 14.0409 0.0497
NP_442366.1_5 Forward -155 -145 11.3859 0.189
NP_439949.1_7 Forward -189 -175 14.1593 0.228
NP_440328.1_8 Reverse -15 -34 16.1097 0.28
NP_441851.1_10 Reverse -212 -222 7.25653 0.144
NP_441851.1_10 Reverse -37 -47 4.10993 0.287
NP_442622.1_1 Forward -394 -375 -11.8003 0.257
NP_442515.1_1 Reverse -107 -121 9.73436 0.0603
NP_442689.1_8 Reverse -23 -40 -1.63279 0.22
NP_441409.1_6 Reverse -207 -226 -10.6203 0.209
NP_440432.1_9 Forward -392 -377 -6.21495 0.29
NP_442843.1_1 Forward -46 -27 -11.8986 0.295
NP_442843.1_1 Forward -191 -172 -12.0953 0.298
NP_440474.1_8 Reverse -349 -363 11.1104 0.118
NP_440474.1_8 Reverse -229 -243 10.2254 0.143
NP_440431.1_3 Forward -358 -339 -10.7186 0.276
NP_440431.1_4 Reverse -79 -98 0.620274 0.164
NP_440954.1_1 Forward -393 -374 -2.0655 0.224
NP_442006.1_2 Forward -216 -199 -16.6774 0.261
NP_442006.1_2 Forward -300 -283 -17.8574 0.283
NP_441450.1_3 Reverse -24 -43 10.0284 0.163
NP_441570.1_1 Forward -222 -204 -8.73231 0.12
NP_441570.1_1 Reverse -213 -231 -17.1888 0.267
NP_441570.1_1 Forward -117 -99 -17.3854 0.273
NP_441570.1_1 Forward -393 -375 -17.5821 0.283
NP_441078.1_4 Forward -222 -213 0.196389 0.205
NP_441078.1_4 Reverse -213 -222 -0.000272808 0.205
NP_441078.1_4 Forward -117 -108 -0.68859 0.206
NP_441078.1_4 Reverse -384 -393 -1.47524 0.266
NP_441078.1_4 Reverse -108 -117 -1.6719 0.266
NP_442348.1_2 Forward -186 -177 14.7494 0.146
NP_442348.1_2 Forward -67 -58 11.7011 0.225
NP_442348.1_2 Forward -270 -261 7.76787 0.28
NP_442443.1_1 Forward -314 -295 -6.88371 0.299
NP_440526.1_3 Forward -221 -210 5.17139 0.253
NP_440526.1_3 Reverse -310 -321 4.28642 0.267
NP_441432.1_8 Reverse -212 -221 7.17789 0.102
NP_442320.1_8 Forward -228 -214 1.67122 0.0817
NP_440313.1_5 Reverse -188 -206 11.2281 0.28
NP_441805.1_1 Reverse -73 -92 6.29264 0.082
NP_442510.1_9 Reverse -162 -176 16.4209 0.268
NP_440713.1_4 Reverse -203 -222 4.42435 0.23
NP_442489.1_7 Forward -222 -213 0.884706 0.145
NP_442489.1_7 Reverse -213 -222 0.491382 0.178
NP_442489.1_7 Forward -117 -108 -1.6719 0.235
NP_440565.1_7 Forward -64 -45 4.71934 0.246
NP_442079.1_7 Forward -392 -373 -0.000545616 0.287
NP_440559.1_1 Forward -221 -212 14.1594 0.0317
NP_440559.1_1 Reverse -214 -223 8.06287 0.0656
NP_441659.2_8 Forward -222 -212 6.37155 0.0774
NP_441659.2_8 Reverse -384 -394 5.78156 0.0979
NP_441659.2_8 Reverse -213 -223 5.19158 0.113
NP_441659.2_8 Forward -47 -37 0.766681 0.258
NP_442913.1_10 Forward -56 -37 -2.36049 0.184
NP_442913.1_10 Forward -126 -107 -4.42544 0.237
NP_442913.1_10 Forward -327 -308 -5.31042 0.262
NP_439956.1_7 Forward -77 -58 0.884433 0.294
NP_440779.1_5 Forward -47 -30 -14.8091 0.274
NP_442346.1_5 Reverse -212 -222 14.828 0.00967
NP_442346.1_5 Forward -48 -38 11.2881 0.0706
NP_442346.1_5 Reverse -383 -393 9.02648 0.118
NP_442346.1_5 Reverse -347 -357 5.87989 0.225
NP_442346.1_5 Forward -223 -213 4.79825 0.272
NP_442346.1_5 Reverse -37 -47 4.79825 0.272
NP_440352.1_5 Forward -52 -33 10.5143 0.272
NP_440545.1_3 Forward -355 -338 -1.73112 0.173
NP_440545.1_3 Forward -308 -291 -5.46769 0.25
NP_440025.1_3 Reverse -53 -67 12.3534 0.269
NP_441653.1_2 Reverse -337 -356 3.91615 0.264
NP_441653.1_2 Forward -204 -185 3.91615 0.264
NP_441943.1_8 Reverse -187 -206 -13.4719 0.274
NP_440449.1_6 Reverse -290 -308 19.052 0.065
NP_441047.1_2 Forward -221 -202 -1.08219 0.267
NP_441833.1_4 Forward -221 -214 14.1004 0.0258
NP_441833.1_4 Reverse -214 -221 6.13563 0.198
NP_442699.1_8 Reverse -166 -185 -11.9969 0.238
NP_442162.1_8 Forward -59 -40 1.96607 0.263
NP_442162.1_9 Forward -221 -214 6.62729 0.142
NP_442162.1_9 Reverse -214 -221 6.52896 0.178
NP_440671.1_4 Forward -243 -229 5.89945 0.27
NP_440671.1_4 Forward -228 -214 5.50613 0.281
NP_440772.1_8 Forward -228 -209 8.84924 0.253
NP_441915.1_4 Forward -76 -57 9.24175 0.28
NP_442140.1_3 Forward -46 -36 8.4365 0.119
NP_442140.1_3 Reverse -39 -49 8.4365 0.119
NP_441813.1_5 Forward -224 -214 5.5849 0.118
NP_441813.1_7 Forward -301 -287 8.75042 0.278
NP_442028.1_1 Forward -92 -79 8.94252 0.269
NP_440590.1_4 Forward -221 -208 10.049 0.0314
NP_440567.1_4 Forward -69 -50 11.7008 0.133
NP_442497.1_10 Forward -221 -212 0.688044 0.141
NP_440821.1_4 Forward -224 -214 -0.216628 0.244
NP_440821.1_4 Reverse -211 -221 -0.41329 0.257
NP_441727.1_3 Reverse -31 -50 3.04771 0.293
NP_441892.1_1 Reverse -204 -221 2.39878 0.14
NP_441892.1_1 Reverse -29 -46 0.825489 0.161
NP_441892.1_4 Reverse -37 -56 3.73603 0.205
NP_442193.1_1 Forward -88 -70 12.8022 0.223
NP_440833.1_6 Reverse -175 -189 12.782 0.18
NP_442216.1_4 Reverse -199 -207 8.08217 0.255
NP_441782.1_5 Reverse -205 -224 7.07928 0.287
NP_440546.1_4 Reverse -213 -223 9.65817 0.126
NP_440546.1_4 Reverse -384 -394 9.07643 0.156
NP_440546.1_6 Forward -81 -62 13.3725 0.198
NP_440675.1_1 Forward -120 -101 4.32602 0.238
NP_442340.1_3 Forward -115 -96 -1.7705 0.188
NP_440868.1_4 Forward -397 -385 0.628964 0.206
NP_442499.1_4 Forward -49 -35 10.4227 0.265
NP_441848.1_4 Forward -38 -22 11.0839 0.232
NP_440696.1_3 Forward -57 -39 -3.6191 0.287
NP_440843.1_8 Reverse -213 -232 15.6341 0.268
NP_440825.1_6 Forward -272 -253 8.65258 0.285
NP_442837.1_3 Forward -221 -214 6.13563 0.25
NP_442837.1_3 Reverse -214 -221 5.93897 0.265
NP_440505.1_3 Reverse -211 -221 7.94484 0.147
NP_440505.1_3 Forward -395 -385 5.97822 0.202
NP_442360.1_5 Forward -64 -54 13.7464 0.258
NP_441701.1_3 Forward -56 -39 8.69197 0.247
NP_440520.1_1 Forward -67 -48 -3.14714 0.208
NP_440914.1_1 Forward -222 -212 14.7634 0.00997
NP_442533.1_6 Reverse -213 -222 5.3096 0.145
NP_442533.1_6 Reverse -38 -47 4.62128 0.179
NP_442533.1_6 Reverse -298 -307 2.06468 0.275
NP_442541.1_10 Reverse -38 -52 11.1104 0.186
NP_442541.1_10 Forward -117 -103 1.37564 0.287
NP_442232.1_3 Forward -381 -362 -8.55534 0.228
NP_439944.1_9 Reverse -214 -224 15.418 0.0198
NP_439944.1_9 Reverse -39 -49 5.38824 0.254
NP_442202.1_6 Reverse -167 -186 -1.57384 0.276
NP_440116.1_8 Reverse -39 -58 -7.17871 0.223
NP_441527.1_4 Forward -38 -19 -8.83343 0.251
NP_441527.1_4 Reverse -79 -98 -12.9396 0.296
NP_441527.1_4 Reverse -78 -97 -13.0351 0.298
NP_440115.1_6 Reverse -210 -220 9.32148 0.115
NP_441972.1_3 Forward -68 -49 12.3892 0.278
NP_441106.1_1 Forward -394 -385 5.60459 0.141
NP_441106.1_1 Forward -223 -214 5.40793 0.151
NP_441825.1_4 Forward -67 -57 9.22315 0.28
NP_441869.1_2 Reverse -199 -218 9.63589 0.274
NP_439903.1_6 Forward -225 -206 -0.787962 0.285
NP_442928.1_3 Forward -307 -288 11.5502 0.293
NP_441286.1_1 Reverse -212 -224 9.57708 0.0228
NP_441286.1_1 Forward -223 -211 -5.95921 0.235
NP_442674.1_1 Reverse -164 -183 12.6972 0.218
NP_440670.1_8 Forward -222 -213 6.98123 0.0882
NP_441705.1_3 Forward -47 -28 -1.27885 0.279
NP_441930.1_2 Forward -66 -56 11.6814 0.278
NP_440886.1_4 Reverse -138 -157 16.8141 0.183
NP_440799.1_10 Reverse -79 -98 11.0125 0.267
NP_441808.1_8 Forward -378 -359 5.99764 0.294
NP_441808.1_8 Forward -312 -293 5.89931 0.294
NP_442264.1_2 Forward -226 -209 6.72535 0.25
NP_441021.1_1 Forward -356 -337 -5.40875 0.177
NP_441021.1_1 Reverse -214 -233 -10.522 0.24
NP_442842.1_9 Reverse -156 -175 10.1275 0.221
NP_441626.1_2 Forward -221 -214 6.0373 0.212
NP_441626.1_2 Reverse -214 -221 6.0373 0.212
NP_441460.1_2 Reverse -224 -237 14.4733 0.234
NP_442794.1_1 Reverse -209 -221 12.1337 0.0721
NP_441962.1_4 Reverse -343 -362 -3.3438 0.146
NP_441962.1_4 Reverse -103 -122 -11.8003 0.245
NP_441962.1_4 Forward -52 -33 -14.3569 0.286
NP_440387.1_1 Forward -117 -101 -6.23465 0.273
NP_441431.1_2 Forward -50 -36 5.99717 0.281
NP_441836.1_2 Reverse -96 -115 -5.01543 0.269
NP_440634.1_6 Reverse -107 -121 15.0442 0.28
NP_440287.1_5 Reverse -198 -217 9.43841 0.286
NP_441272.1_4 Forward -120 -101 7.57094 0.189
NP_440766.1_5 Reverse -171 -183 11.9529 0.25
NP_440422.1_10 Forward -97 -78 6.62858 0.245
NP_441237.1_9 Forward -221 -211 10.5014 0.228
NP_439910.1_2 Forward -230 -213 -12.2525 0.0788
NP_439910.1_2 Reverse -376 -393 -22.2823 0.22
NP_439910.1_2 Reverse -14 -31 -22.5773 0.267
NP_442737.1_9 Reverse -214 -233 18.0953 0.199
NP_441885.1_5 Reverse -213 -223 10.1081 0.0145
NP_441885.1_5 Forward -222 -212 1.455 0.11
NP_441885.1_5 Forward -117 -107 0.373358 0.164
NP_442341.1_9 Reverse -187 -201 5.50552 0.267
NP_441756.1_3 Forward -261 -242 13.9625 0.28
NP_441756.1_5 Forward -302 -283 -0.197208 0.242
NP_441756.1_5 Reverse -294 -313 -3.63879 0.29
NP_440423.1_6 Forward -73 -54 -20.65 0.263
NP_443000.1_3 Forward -312 -293 11.3286 0.255
NP_443000.1_7 Forward -224 -214 6.66654 0.119
NP_443000.1_7 Forward -395 -385 0.865012 0.285
NP_443000.1_7 Reverse -211 -221 0.471689 0.298
NP_440507.2_3 Forward -294 -275 7.17681 0.286
NP_440275.1_3 Forward -395 -385 3.51995 0.225
NP_440091.1_1 Forward -226 -214 16.8536 0.0153
NP_440091.1_1 Forward -51 -39 0.432302 0.25
NP_442275.1_1 Forward -186 -167 3.73603 0.276
NP_441105.1_3 Reverse -337 -356 -7.57203 0.255
NP_440216.1_1 Reverse -384 -398 -11.3085 0.178
NP_440216.1_9 Forward -45 -36 16.9127 0.116
NP_440216.1_9 Forward -106 -97 11.9961 0.252
NP_440172.1_1 Reverse -213 -223 7.45319 0.0789
NP_440167.1_3 Reverse -98 -117 14.7491 0.157
NP_442015.1_10 Reverse -209 -222 7.19745 0.0941
NP_441111.1_7 Forward -221 -213 8.96754 0.0463
NP_442379.1_10 Forward -229 -212 -3.30441 0.256
NP_441766.1_2 Reverse -213 -222 8.06287 0.0691
NP_440416.1_1 Reverse -213 -232 -14.7502 0.299
NP_440416.1_9 Reverse -37 -56 -19.7651 0.278
NP_440261.1_5 Reverse -385 -398 -5.09393 0.185
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCTGCAGACGATAGCTTTTTAGGCGGCGACGTTGCAGATAAATGCCGTTGCTAGAGCCTTCATCTCGAATAAAAAACTGGTTAGGATGGTCAGGGTCCCGCCGCAGGGAACAATGGGTCTGACTCACGAGGGGATTTTGCAGTTGAATATCACAACTGGAACTGCGGCCGAGAAAATAACGATCGCCAAGGAGGGGAAATACCCGCCGGGATTGGGAATTTTTGCCCGATTCCTGCAGACGAATTTTGGCCACCCTGGAGCCTTTTTTGAGGGCTACCTTTTGGCTGTTGCCACCCTGGGAAAGGTTAGTTTGACTTTTTTTAGGGGCAGAAGGGGCTTTGCGGGAACGGGTAGCCATGGCAAATTAGGGCAAAAGCAGTCCAATTTTAGACCGATACA

CDS

GTGGTGAAATCAGAATCAGGTATTTCTATGCAGACGCATTTATTGCCAAAAAAGGTTGCCTCCTGGATTACCAGCTTGGGTCTGGCGGGGCTCTCCATTCTAGCTTTAGACCCCCTGGCCAGCCGGGCCGATAGTCCCCTGACTTCCACGGATTTAGCTGGAGCTTACTCCGACATTGCCGCCGTGGAATGGGCCCAGCAGTATCGGATTATGTCTCCCCTCATTGTAGATTTTCTCCTTGGCGATCGCCCCTTGGGGGAAAAGGCCGCAGTGATTAATGCCTTGGGCTGGAATATTGACGGCAGCAACAACGCCGAACAGTTCCTCGTGGCCCTGGCCAGAAAAAATGACAAACCCCCTACCCATATGGATTTGGGGGATTTGACCCCGGAAGAATTATTCATTGTCGGTTACCTCCTGGCCCTGGACGATTATCAAACTCTTGGCCCCCTCAGTACCCAGGGTGGCAATGACCTTTGGCGATCAACCCCAGTGCAACTAATGTCTAAGGCGGCCTACGCCCTGCCGGAGAATTTCACAGTGCAATTTGTCCGCTCCCTGGTGACGGGGCAAGCCTGGTTTGGTATTTCTTGGTGTGCCCTTTATCTAGAACCGGCCAATGTGTTGGCCAATTTTCCTCCGGAAAAGCGTAATTTACGCCCCCAAGCAGTGCAAAACGCCATGGAGTATCTCAATCTCTACGAATCCTATTGTTTAGAGGGGGATATTTAA

Protein

MVKSESGISMQTHLLPKKVASWITSLGLAGLSILALDPLASRADSPLTSTDLAGAYSDIAAVEWAQQYRIMSPLIVDFLLGDRPLGEKAAVINALGWNIDGSNNAEQFLVALARKNDKPPTHMDLGDLTPEELFIVGYLLALDDYQTLGPLSTQGGNDLWRSTPVQLMSKAAYALPENFTVQFVRSLVTGQAWFGISWCALYLEPANVLANFPPEKRNLRPQAVQNAMEYLNLYESYCLEGDI