Your browser is old and dusty. Try Google Chrome!

Details for sll1562

ORF sll1562
Accession NP_441688.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -348 -362 -0.393733 0.228
NP_440557.1_1 Forward -342 -323 -0.983855 0.27
NP_441418.1_6 Reverse -347 -366 -2.55715 0.0195
NP_441418.1_6 Forward -368 -349 -29.7948 0.238
NP_440815.1_5 Reverse -347 -366 5.70265 0.275
NP_441453.1_4 Reverse -347 -355 7.29591 0.0589
NP_441453.1_4 Forward -356 -348 6.70593 0.121
NP_441818.1_9 Forward -313 -294 1.57275 0.191
NP_441818.1_9 Reverse -353 -372 -6.29373 0.263
NP_441818.1_9 Reverse -359 -378 -6.58872 0.264
NP_440259.1_4 Reverse -172 -186 12.4921 0.254
NP_442623.1_3 Reverse -348 -367 -18.0934 0.263
NP_442744.1_9 Forward -394 -380 14.7744 0.266
NP_442173.1_1 Forward -355 -347 7.59091 0.163
NP_442173.1_1 Reverse -348 -356 5.82095 0.2
NP_442752.1_4 Forward -356 -349 13.8055 0.0199
NP_442752.1_4 Reverse -359 -366 10.5605 0.1
NP_443027.1_4 Reverse -345 -355 7.05986 0.248
NP_441812.1_1 Forward -232 -218 11.897 0.256
NP_440784.1_7 Reverse -348 -355 6.23397 0.241
NP_440784.1_7 Forward -355 -348 6.13563 0.241
NP_440110.1_4 Reverse -336 -355 15.8307 0.0777
NP_442062.1_8 Reverse -347 -357 5.48657 0.168
NP_441859.1_3 Reverse -346 -365 12.7816 0.0902
NP_440304.1_4 Forward -358 -348 8.1415 0.0859
NP_442242.1_4 Forward -355 -348 12.4288 0.0393
NP_441781.1_7 Forward -330 -311 0.786102 0.241
NP_441208.1_1 Reverse -335 -354 -6.78538 0.296
NP_441208.1_9 Forward -359 -345 5.50613 0.267
NP_441594.1_6 Reverse -69 -88 4.71934 0.214
NP_441925.1_4 Forward -378 -359 -15.2425 0.263
NP_441083.1_5 Forward -208 -198 1.25834 0.213
NP_441083.1_5 Reverse -347 -357 0.865012 0.218
NP_441738.1_2 Reverse -349 -356 15.28 0.0102
NP_441558.1_5 Forward -358 -339 6.19431 0.225
NP_440209.1_1 Forward -356 -348 14.8674 0.012
NP_440447.1_6 Forward -364 -346 9.45892 0.135
NP_441713.1_1 Forward -362 -343 -3.44213 0.113
NP_440178.1_7 Forward -330 -311 -23.2067 0.298
NP_441716.1_1 Reverse -359 -373 6.58777 0.195
NP_442111.1_4 Reverse -346 -360 8.94771 0.0661
NP_440906.1_5 Forward -355 -348 12.0355 0.0724
NP_440906.1_5 Reverse -348 -355 12.0355 0.0724
NP_440747.1_10 Forward -359 -347 -11.8591 0.161
NP_441130.1_10 Forward -358 -344 6.09611 0.202
NP_440944.1_2 Forward -388 -369 1.27776 0.255
NP_442634.1_4 Forward -358 -344 3.24451 0.115
NP_442634.1_4 Reverse -345 -359 -5.50694 0.258
NP_441265.1_3 Forward -362 -348 5.30946 0.181
NP_442848.1_4 Reverse -17 -31 8.75105 0.282
NP_441012.1_4 Forward -238 -225 6.70579 0.276
NP_443018.1_3 Forward -355 -348 5.34899 0.212
NP_443018.1_3 Reverse -348 -355 5.34899 0.212
NP_440376.1_1 Reverse -347 -356 -0.000272808 0.285
NP_440376.1_1 Forward -356 -347 -0.0986038 0.285
NP_440376.1_1 Forward -146 -137 -0.786921 0.293
NP_442687.1_7 Forward -357 -347 16.008 0.0125
NP_442958.1_3 Reverse -336 -355 2.16274 0.267
NP_440642.1_10 Reverse -171 -185 2.06395 0.284
NP_441763.1_5 Forward -366 -347 5.89931 0.082
NP_442658.1_1 Reverse -345 -355 11.6809 0.0768
NP_442658.1_1 Forward -358 -348 7.84605 0.205
NP_440141.1_4 Reverse -350 -369 -1.96717 0.296
NP_442782.1_2 Forward -342 -328 3.44117 0.265
NP_442782.1_2 Forward -356 -342 0.294584 0.291
NP_442205.1_9 Reverse -341 -357 -3.57971 0.287
NP_439968.1_8 Forward -224 -208 12.6449 0.292
NP_441958.1_5 Forward -357 -347 9.7148 0.018
NP_441958.1_5 Reverse -346 -356 1.74999 0.0765
NP_442486.1_6 Forward -377 -358 8.16093 0.249
NP_440203.1_5 Reverse -350 -360 13.6475 0.112
NP_442911.1_2 Forward -366 -347 -2.95047 0.105
NP_440153.1_5 Forward -355 -341 4.71948 0.197
NP_440858.1_1 Reverse -209 -228 -2.65548 0.27
NP_440993.1_2 Reverse -342 -358 16.2831 0.0621
NP_442210.1_7 Reverse -348 -367 22.5172 0.0676
NP_441099.1_5 Forward -366 -347 -1.86883 0.115
NP_442002.1_9 Forward -357 -350 14.1004 0.074
NP_441294.1_7 Reverse -343 -357 8.86667 0.274
NP_441646.1_1 Forward -363 -344 -0.0988766 0.259
NP_442438.1_10 Reverse -342 -356 2.65453 0.17
NP_442431.1_10 Reverse -356 -374 11.5239 0.0969
NP_441398.1_9 Forward -361 -342 11.11 0.288
NP_440879.1_6 Reverse -342 -361 -2.95047 0.279
NP_442771.1_1 Forward -358 -340 -6.27403 0.168
NP_442771.1_1 Reverse -345 -363 -7.25734 0.17
NP_440147.1_4 Forward -390 -377 5.23083 0.132
NP_440147.1_4 Reverse -345 -358 1.59258 0.224
NP_440147.1_4 Forward -358 -345 1.29759 0.233
NP_441175.1_7 Forward -174 -155 4.81767 0.296
NP_441550.1_8 Forward -358 -348 10.501 0.066
NP_441550.1_8 Forward -155 -145 5.87944 0.224
NP_441331.1_5 Reverse -355 -374 14.1583 0.294
NP_441916.1_7 Reverse -347 -357 8.04317 0.0513
NP_441916.1_7 Forward -356 -346 7.05986 0.0779
NP_440465.1_10 Reverse -344 -363 2.94938 0.253
NP_441041.1_7 Forward -359 -347 5.57123 0.25
NP_442004.1_6 Forward -356 -342 2.5562 0.263
NP_441725.1_5 Reverse -348 -358 9.02648 0.0553
NP_439966.1_9 Forward -358 -349 0.983037 0.253
NP_442281.1_1 Forward -361 -347 5.50552 0.155
NP_442281.1_2 Forward -371 -352 14.9458 0.198
NP_441334.1_7 Reverse -345 -364 -10.0303 0.12
NP_442012.1_1 Forward -362 -343 5.99764 0.138
NP_441556.1_4 Forward -368 -349 14.9218 0.161
NP_441644.1_6 Forward -356 -346 5.28945 0.199
NP_441644.1_6 Reverse -347 -357 4.50281 0.235
NP_442215.1_2 Reverse -204 -220 -3.38305 0.214
NP_442933.1_1 Forward -110 -91 7.87766 0.253
NP_442933.1_1 Reverse -179 -198 7.30471 0.253
NP_442933.1_10 Forward -356 -347 13.9627 0.0192
NP_442933.1_10 Reverse -347 -356 8.1612 0.0885
NP_441751.2_8 Reverse -348 -362 -3.63866 0.152
NP_442926.1_3 Reverse -348 -367 1.86774 0.298
NP_442554.1_8 Reverse -348 -358 7.25653 0.0955
NP_441762.1_7 Reverse -346 -358 -5.27089 0.195
NP_441762.1_7 Forward -357 -345 -6.15587 0.276
NP_442142.1_4 Forward -371 -358 14.4733 0.0311
NP_442142.1_4 Forward -365 -352 3.06699 0.268
NP_442142.1_4 Forward -359 -346 2.47701 0.29
NP_442292.1_1 Reverse -348 -357 -0.196935 0.239
NP_441525.1_1 Reverse -343 -356 16.0472 0.206
NP_442381.1_8 Reverse -356 -375 -14.7502 0.284
NP_443009.1_5 Reverse -346 -357 10.0879 0.0818
NP_443009.1_5 Forward -357 -346 5.85971 0.185
NP_440405.1_6 Reverse -180 -198 6.80398 0.26
NP_441448.1_7 Forward -371 -352 8.84924 0.242
NP_442076.1_5 Forward -247 -228 15.3391 0.186
NP_441198.1_8 Reverse -345 -355 10.3415 0.28
NP_441468.1_1 Reverse -348 -355 6.13563 0.209
NP_441468.1_1 Forward -355 -348 6.0373 0.223
NP_441020.2_6 Reverse -345 -362 12.9202 0.0824
NP_441673.1_1 Reverse -347 -356 1.37636 0.114
NP_441673.1_1 Forward -356 -347 1.1797 0.163
NP_441016.2_6 Forward -377 -358 8.55343 0.222
NP_441956.1_9 Reverse -352 -371 5.70265 0.274
NP_441826.1_2 Forward -362 -348 1.96621 0.137
NP_442490.1_9 Forward -368 -349 -5.80207 0.273
NP_441764.1_8 Forward -178 -168 11.7892 0.284
NP_442868.1_6 Forward -358 -348 6.96153 0.0919
NP_442227.1_2 Forward -372 -353 -1.7705 0.266
NP_441944.1_3 Forward -366 -347 14.4541 0.142
NP_441101.1_10 Forward -360 -341 -5.50708 0.285
NP_442050.1_5 Reverse -345 -355 6.96107 0.27
NP_440346.1_6 Reverse -328 -338 15.3134 0.228
NP_441878.1_6 Forward -357 -347 0.57002 0.14
NP_441036.1_8 Reverse -346 -356 13.8447 0.0353
NP_441557.1_5 Forward -356 -347 8.84951 0.0343
NP_441557.1_5 Reverse -347 -356 0.786375 0.106
NP_441557.1_8 Reverse -305 -315 13.5492 0.216
NP_442183.1_1 Reverse -347 -361 6.19444 0.184
NP_441574.1_1 Reverse -347 -366 -1.57384 0.22
NP_442347.1_2 Reverse -321 -330 4.42462 0.284
NP_442888.1_9 Reverse -347 -366 16.6174 0.171
NP_441037.1_4 Forward -358 -348 17.8431 0.0127
NP_440136.1_2 Reverse -348 -355 6.23397 0.171
NP_440136.1_2 Forward -355 -348 6.13563 0.193
NP_442998.1_5 Reverse -219 -229 14.6313 0.149
NP_442998.1_5 Forward -177 -167 8.1415 0.271
NP_442998.1_5 Forward -211 -201 7.55152 0.289
NP_442998.1_5 Reverse -376 -386 7.25653 0.298
NP_442998.1_10 Reverse -349 -356 15.5754 0.0102
NP_442998.1_10 Reverse -381 -388 9.28223 0.117
NP_440899.1_2 Reverse -323 -342 10.0284 0.172
NP_440899.1_5 Reverse -294 -313 6.58763 0.242
NP_440299.1_1 Forward -360 -347 14.8666 0.0215
NP_441007.1_10 Forward -361 -348 6.60746 0.161
NP_442333.2_5 Reverse -323 -342 -7.37537 0.23
NP_441362.1_2 Forward -186 -167 5.55684 0.243
NP_441512.1_4 Reverse -343 -362 7.86593 0.269
NP_440915.1_6 Forward -360 -346 5.99778 0.0871
NP_440915.1_6 Reverse -355 -369 -0.492064 0.197
NP_440915.1_6 Reverse -343 -357 -0.983719 0.217
NP_442866.1_1 Reverse -342 -361 8.65258 0.101
NP_442031.1_5 Forward -370 -351 4.42435 0.298
NP_441939.1_3 Reverse -348 -367 5.99764 0.255
NP_441939.1_3 Forward -355 -336 5.80098 0.263
NP_441199.1_6 Reverse -343 -362 0.491109 0.242
NP_441340.1_5 Forward -355 -348 6.13563 0.175
NP_441340.1_5 Reverse -348 -355 5.93897 0.198
NP_441340.1_9 Forward -178 -168 8.15881 0.256
NP_442240.1_1 Forward -364 -345 6.39016 0.256
NP_440586.1_8 Forward -355 -348 11.4451 0.0645
NP_442251.1_6 Reverse -348 -355 12.0355 0.0627
NP_442251.1_6 Reverse -380 -387 6.43063 0.298
NP_441262.1_3 Forward -356 -349 14.7888 0.0223
NP_443051.1_1 Forward -357 -348 8.45619 0.0316
NP_443051.1_1 Reverse -346 -355 0.491382 0.151
NP_439937.1_9 Forward -354 -337 -13.3348 0.285
NP_439937.1_9 Reverse -346 -363 -17.268 0.296
NP_440439.1_1 Reverse -344 -357 2.57589 0.131
NP_440439.1_1 Forward -359 -346 -0.472371 0.221
NP_442239.1_8 Reverse -355 -374 9.0459 0.249
NP_440372.1_2 Forward -355 -348 6.72562 0.0929
NP_440372.1_2 Reverse -348 -355 6.62729 0.151
NP_440139.1_1 Reverse -341 -360 0.883656 0.279
NP_440267.1_2 Forward -22 -8 10.3237 0.141
NP_442384.1_10 Reverse -347 -360 7.98409 0.0711
NP_442384.1_10 Reverse -304 -317 1.10092 0.268
NP_441877.1_5 Forward -234 -215 -1.57384 0.287
NP_440344.1_10 Reverse -131 -148 -13.1375 0.276
NP_440344.1_10 Forward -363 -346 -13.4325 0.285
NP_442529.1_4 Forward -365 -346 11.2092 0.199
NP_440297.1_9 Reverse -348 -358 -0.216628 0.282
NP_442147.1_3 Reverse -205 -224 20.7473 0.144
NP_442277.1_4 Reverse -338 -357 8.16011 0.131
NP_442845.1_2 Reverse -341 -355 6.48943 0.209
NP_442315.1_2 Forward -318 -306 10.4621 0.291
NP_443064.1_6 Reverse -347 -357 9.94905 0.187
NP_442578.1_7 Forward -355 -348 5.93897 0.183
NP_441462.1_2 Forward -356 -346 9.81313 0.0143
NP_441462.1_2 Reverse -347 -357 0.668351 0.135
NP_441621.1_7 Forward -358 -344 -5.31028 0.25
NP_443062.1_1 Reverse -8 -26 5.42569 0.229
NP_442204.1_1 Reverse -355 -366 10.6784 0.0697
NP_442204.1_1 Forward -360 -349 2.51695 0.266
NP_442204.1_2 Reverse -349 -368 9.24257 0.225
NP_441560.1_3 Forward -304 -286 12.1139 0.227
NP_440516.1_8 Forward -356 -347 8.1612 0.0417
NP_442428.1_5 Reverse -348 -355 6.13563 0.209
NP_442428.1_5 Forward -355 -348 6.0373 0.212
NP_440673.1_3 Reverse -349 -356 12.4288 0.0426
NP_440865.1_9 Reverse -341 -360 0.196116 0.143
NP_440436.1_4 Reverse -348 -357 12.684 0.034
NP_440436.1_4 Forward -355 -346 4.7192 0.244
NP_441719.1_4 Forward -355 -348 6.72562 0.093
NP_441719.1_4 Reverse -348 -355 6.62729 0.151
NP_442813.1_4 Forward -347 -328 -2.95047 0.287
NP_440129.1_10 Forward -363 -349 16.4209 0.0373
NP_443054.1_2 Reverse -135 -149 3.8345 0.24
NP_441851.1_10 Forward -357 -347 8.92815 0.114
NP_440593.1_3 Reverse -342 -361 -4.13045 0.245
NP_442689.1_8 Reverse -47 -64 -4.18939 0.263
NP_441349.1_10 Reverse -337 -356 -2.16383 0.114
NP_440432.1_9 Reverse -348 -363 -1.29841 0.167
NP_440431.1_3 Reverse -346 -365 -9.63698 0.252
NP_440588.1_2 Reverse -338 -357 2.55606 0.117
NP_440943.1_1 Reverse -36 -55 9.24257 0.29
NP_442006.1_3 Forward -362 -344 -7.15901 0.298
NP_440483.1_1 Reverse -354 -373 -3.44213 0.215
NP_440483.1_1 Reverse -329 -348 -7.57203 0.266
NP_441570.1_1 Forward -329 -311 -9.71562 0.146
NP_440078.1_10 Reverse -78 -97 4.62101 0.246
NP_441078.1_4 Reverse -347 -356 0.196389 0.205
NP_441078.1_4 Forward -356 -347 -0.000272808 0.205
NP_442443.1_1 Reverse -205 -224 -6.29373 0.294
NP_440526.1_3 Reverse -348 -359 15.5944 0.0646
NP_442320.1_8 Reverse -373 -387 -4.91696 0.192
NP_441732.1_2 Forward -360 -344 -16.0677 0.164
NP_441945.1_10 Forward -264 -245 7.86593 0.282
NP_442489.1_7 Reverse -347 -356 0.884706 0.145
NP_442489.1_7 Forward -356 -347 0.491382 0.178
NP_442079.1_7 Reverse -348 -367 0.687771 0.275
NP_440559.1_1 Reverse -348 -357 14.0611 0.0342
NP_441659.2_8 Forward -356 -346 7.94484 0.052
NP_441659.2_8 Reverse -347 -357 7.55152 0.0593
NP_442776.1_6 Reverse -345 -364 9.83255 0.217
NP_440779.1_5 Reverse -347 -364 -5.86102 0.152
NP_442346.1_5 Forward -357 -347 16.1063 0.00309
NP_442346.1_5 Reverse -346 -356 4.40493 0.29
NP_440545.1_3 Reverse -343 -360 9.97027 0.0362
NP_440545.1_3 Forward -360 -343 7.41366 0.0499
NP_441653.1_2 Forward -367 -348 10.0041 0.137
NP_441653.1_2 Reverse -348 -367 2.65991 0.289
NP_440010.1_4 Forward -372 -353 5.89851 0.199
NP_440847.1_3 Forward -375 -361 11.5037 0.263
NP_441050.1_5 Forward -238 -220 -3.42244 0.293
NP_442070.1_1 Forward -345 -326 11.0125 0.288
NP_441833.1_4 Reverse -348 -355 14.1004 0.0258
NP_441833.1_4 Forward -355 -348 6.13563 0.198
NP_443040.1_1 Forward -184 -170 10.0873 0.291
NP_442162.1_9 Reverse -348 -355 6.62729 0.142
NP_442162.1_9 Forward -355 -348 6.52896 0.178
NP_442140.1_3 Forward -355 -345 6.17489 0.184
NP_442140.1_3 Reverse -348 -358 5.38824 0.211
NP_442914.1_2 Forward -380 -361 19.0842 0.203
NP_441609.1_1 Forward -172 -153 -2.0655 0.278
NP_440875.1_9 Reverse -349 -359 9.24806 0.233
NP_441813.1_9 Reverse -46 -65 13.4708 0.225
NP_440594.1_8 Forward -355 -342 8.86849 0.21
NP_440590.1_4 Reverse -348 -361 -5.48725 0.28
NP_440567.1_1 Forward -355 -341 10.1277 0.0394
NP_440567.1_1 Reverse -348 -362 5.1128 0.107
NP_442497.1_10 Reverse -348 -357 10.1278 0.0166
NP_442497.1_10 Forward -355 -346 5.89959 0.109
NP_440821.1_4 Forward -358 -348 9.7148 0.0274
NP_441239.1_9 Reverse -345 -357 7.61046 0.154
NP_440156.1_4 Reverse -166 -176 15.2208 0.176
NP_441727.1_3 Forward -363 -344 6.29264 0.244
NP_441892.1_1 Forward -365 -348 -2.02611 0.217
NP_440665.1_1 Reverse -350 -369 -9.93197 0.244
NP_440665.1_1 Reverse -347 -366 -16.5201 0.291
NP_442044.1_1 Reverse -342 -361 -11.6036 0.271
NP_442052.1_7 Reverse -357 -371 18.0925 0.153
NP_440546.1_4 Forward -356 -346 13.1486 0.0572
NP_441883.1_1 Forward -146 -127 6.98095 0.16
NP_440675.1_3 Reverse -359 -378 5.80098 0.277
NP_440462.1_6 Reverse -345 -355 9.22315 0.049
NP_440705.1_4 Forward -346 -327 6.4893 0.296
NP_440868.1_2 Reverse -310 -324 19.9132 0.0967
NP_440868.1_4 Reverse -343 -355 -0.157684 0.248
NP_442499.1_3 Reverse -295 -313 12.5072 0.199
NP_441848.1_4 Forward -62 -46 12.5162 0.202
NP_441848.1_7 Reverse -221 -240 -4.62285 0.296
NP_442023.1_2 Forward -28 -9 5.60432 0.285
NP_442829.1_2 Reverse -267 -283 8.33436 0.287
NP_442829.1_2 Forward -231 -215 8.04446 0.287
NP_442837.1_3 Reverse -348 -355 6.13563 0.25
NP_442837.1_3 Forward -355 -348 5.93897 0.265
NP_440505.1_3 Forward -358 -348 6.56821 0.176
NP_440505.1_7 Forward -317 -298 6.68596 0.162
NP_441252.1_6 Reverse -218 -225 11.6422 0.288
NP_441203.1_1 Forward -355 -336 -14.8485 0.205
NP_442532.1_1 Forward -199 -185 13.1261 0.215
NP_442532.1_2 Reverse -118 -137 2.43462 0.218
NP_441011.1_8 Forward -355 -346 8.1612 0.147
NP_441011.1_9 Reverse -166 -185 12.6841 0.272
NP_442533.1_6 Forward -356 -347 5.3096 0.145
NP_442232.1_3 Reverse -339 -358 -15.8318 0.296
NP_441482.1_7 Forward -362 -348 -1.27871 0.0666
NP_439944.1_9 Forward -355 -345 14.1397 0.0439
NP_439944.1_9 Reverse -348 -358 7.74818 0.131
NP_441749.1_7 Reverse -338 -357 11.8975 0.224
NP_440116.1_8 Reverse -348 -367 -7.08038 0.222
NP_441527.1_4 Forward -197 -178 -11.6982 0.284
NP_441527.1_4 Forward -194 -175 -12.8441 0.294
NP_440115.1_6 Forward -359 -349 19.2529 0.0106
NP_440115.1_6 Reverse -344 -354 4.99491 0.277
NP_439965.1_7 Reverse -10 -29 13.7264 0.247
NP_441680.1_4 Reverse -329 -348 -2.55715 0.268
NP_442890.1_1 Reverse -350 -369 14.8474 0.194
NP_441972.1_5 Reverse -348 -367 -3.54046 0.2
NP_441106.1_1 Reverse -346 -355 14.2577 0.0252
NP_441286.1_1 Reverse -346 -358 -4.09092 0.149
NP_441286.1_1 Forward -357 -345 -6.5492 0.267
NP_440670.1_8 Reverse -347 -356 6.98123 0.0882
NP_440767.1_7 Forward -25 -6 7.96426 0.273
NP_442072.1_9 Forward -357 -339 -11.5839 0.0789
NP_440907.2_8 Reverse -348 -358 10.1076 0.103
NP_440907.2_8 Forward -355 -345 6.66608 0.157
NP_441021.1_1 Reverse -348 -367 -9.44032 0.216
NP_441463.1_3 Forward -366 -347 -1.67217 0.145
NP_442842.1_10 Reverse -9 -28 0.950819 0.254
NP_441626.1_2 Forward -355 -348 6.0373 0.212
NP_441626.1_2 Reverse -348 -355 6.0373 0.212
NP_442615.1_1 Reverse -338 -356 0.707465 0.0979
NP_441962.1_4 Reverse -342 -361 -13.2752 0.271
NP_440387.1_1 Forward -356 -340 -1.02311 0.142
NP_441431.1_2 Forward -359 -345 5.60385 0.294
NP_441488.1_7 Forward -362 -343 0.58944 0.296
NP_441836.1_2 Reverse -341 -360 3.34271 0.156
NP_441193.1_1 Reverse -100 -119 12.9783 0.229
NP_440814.1_4 Forward -365 -346 -13.4719 0.29
NP_440467.1_3 Reverse -348 -367 14.9673 0.154
NP_440766.1_4 Forward -360 -346 2.2612 0.191
NP_441237.1_9 Reverse -348 -358 12.9597 0.0987
NP_440457.1_1 Forward -360 -348 9.38042 0.0927
NP_440798.1_6 Forward -355 -342 2.18257 0.186
NP_442680.1_5 Forward -189 -170 -1.00237 0.297
NP_442509.1_9 Reverse -347 -357 7.74772 0.205
NP_440081.1_2 Forward -182 -163 17.5736 0.262
NP_441496.1_3 Forward -334 -315 15.6332 0.266
NP_440554.1_4 Forward -355 -345 7.64985 0.101
NP_441845.1_6 Forward -368 -350 0.609134 0.274
NP_441885.1_5 Forward -356 -346 0.57002 0.137
NP_441275.1_1 Forward -281 -263 10.4422 0.0588
NP_440898.1_1 Forward -224 -205 10.3242 0.252
NP_440191.1_5 Reverse -290 -309 15.5357 0.27
NP_443000.1_7 Forward -19 -9 4.20827 0.209
NP_442513.1_5 Forward -223 -204 8.06178 0.274
NP_441842.1_1 Forward -354 -341 12.9984 0.174
NP_441842.1_10 Forward -363 -349 12.0943 0.111
NP_440275.1_3 Forward -358 -348 9.91146 0.046
NP_440275.1_3 Reverse -345 -355 7.25653 0.0823
NP_440091.1_1 Reverse -343 -355 10.6587 0.044
NP_442354.1_2 Forward -309 -290 2.3594 0.299
NP_440679.1_10 Reverse -352 -371 -20.8467 0.286
NP_443010.1_10 Reverse -344 -361 3.73713 0.252
NP_442451.1_2 Reverse -339 -358 -11.2103 0.287
NP_439962.1_4 Reverse -204 -223 -2.16383 0.224
NP_441105.1_3 Reverse -214 -233 -6.98204 0.243
NP_440216.1_1 Forward -356 -342 -2.26202 0.0484
NP_440172.1_1 Forward -356 -346 10.0098 0.0572
NP_440172.1_1 Forward -388 -378 2.33998 0.279
NP_441008.1_4 Forward -371 -352 14.9603 0.295
NP_442015.1_10 Reverse -355 -368 3.75586 0.178
NP_442015.1_10 Forward -360 -347 0.412608 0.227
NP_442446.1_3 Reverse -66 -85 11.3075 0.275
NP_441111.1_7 Reverse -348 -356 8.96754 0.0463
NP_442379.1_10 Reverse -340 -357 10.1669 0.0936
NP_441766.1_2 Forward -356 -347 8.06287 0.0691
NP_440416.1_9 Reverse -352 -371 -5.40875 0.0797
NP_442403.1_9 Reverse -219 -238 5.01433 0.216
NP_442154.1_1 Reverse -360 -378 -17.2871 0.251
NP_440261.1_5 Reverse -348 -361 -1.06236 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAGTTTGAAGTAGGCAATCTTTACATCAACCGCACCATCACCGGGGCGATCGTTTCCCGCCAACCTTTTGGGGGGTTCAAAATGTCTGGGGTTGGTTCCAAAGCGGGTGGACCAGATTATTTGTTACAGTTCTTAGAACCACGCCATGTAACGGAGAATATTCAACGGCAAGGATTTGCACCAATTGAGGGGGCAGATCAGTAAATAAGTAAATGAATAAGAAAGGCAAAATTGTACAGGGTTCTTGAGTCATCGGGGTCCTGCTTCAAATTATTACGTATTATAGGGTGTTAGTTGGTTGATTGAAGTTCTCTTTAGTCGCCACTACTACATCGTAGTAATTTCAATAAAAATCCGACAAGACTTCTATTAACCGAGAGACAAGTGATCAATTAAAATT

CDS

ATGGCTTCCGTACCATTTACAGACAGAGAAATGCAGAAAGCATGGCGAAACAATCTCCAGGCATCTACTCATTGTTCACGCACTAATGCCCATAGACTTTTATTATTTTATTCAATAGAATGTGGACTCAAAGCAGTTTTGATGAAACGACAATCTGCATCCTGCACAAGCTTTTGTGATGAAATTACAGAAGCACAGCACAATATTAATAAATTGCTAGACTATTTAAGTGCAGCACCGTCTCTAAAGTTATCAGCATCTCTTCAAATGGAGCCCATTCAAATCAAAGGTAAAAAGATTGAGCGAAAGATAGATGCGGGAAAAATCAATCAGGCGTGGCGATATGGCGGATGCTTGATTGATACTGTCAATAGCAGTTCTTCATTGAGGACAATAGAAGACGATAAACTGGAAAAGCAGTTGATGTGTATATCAGAGTGGATTCGACAGGAGCTAAATTCGTAA

Protein

MASVPFTDREMQKAWRNNLQASTHCSRTNAHRLLLFYSIECGLKAVLMKRQSASCTSFCDEITEAQHNINKLLDYLSAAPSLKLSASLQMEPIQIKGKKIERKIDAGKINQAWRYGGCLIDTVNSSSSLRTIEDDKLEKQLMCISEWIRQELNS