Your browser is old and dusty. Try Google Chrome!

Details for sll1555

ORF sll1555
Accession NP_441702.1
Symbol hik42
Category two-component hybrid sensor and regulator
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -125 -139 2.16287 0.178
NP_440795.1_7 Forward -132 -125 14.6904 0.0123
NP_440795.1_7 Reverse -125 -132 14.6904 0.0123
NP_442291.1_5 Reverse -123 -139 2.02515 0.135
NP_442291.1_5 Forward -134 -118 -3.38305 0.239
NP_441453.1_4 Reverse -124 -132 16.539 0.00633
NP_441453.1_4 Forward -133 -125 16.539 0.00633
NP_442151.1_6 Forward -133 -119 6.98109 0.214
NP_440226.1_1 Forward -133 -114 21.1406 0.00783
NP_440226.1_1 Reverse -124 -143 8.25926 0.0904
NP_440259.1_4 Reverse -42 -56 10.9496 0.262
NP_442173.1_1 Forward -132 -124 15.4574 0.00633
NP_442173.1_1 Reverse -125 -133 15.4574 0.00633
NP_442752.1_4 Forward -133 -126 13.8055 0.0199
NP_442752.1_4 Reverse -124 -131 13.8055 0.0199
NP_443027.1_4 Reverse -122 -132 13.2547 0.0521
NP_441812.1_3 Forward -134 -120 9.2427 0.245
NP_442975.1_10 Reverse -120 -134 11.5037 0.0497
NP_442975.1_10 Forward -137 -123 1.47397 0.297
NP_440784.1_7 Forward -132 -125 15.9687 0.0123
NP_440784.1_7 Reverse -125 -132 15.9687 0.0123
NP_442909.1_7 Reverse -125 -139 6.98048 0.233
NP_440061.1_9 Forward -135 -121 10.2254 0.126
NP_440061.1_9 Reverse -122 -136 9.24208 0.149
NP_441054.1_4 Reverse -114 -132 5.62401 0.129
NP_442062.1_8 Reverse -124 -134 17.3846 0.00193
NP_442062.1_8 Forward -133 -123 10.3048 0.0493
NP_442972.1_1 Forward -289 -271 9.59626 0.271
NP_440304.1_4 Reverse -122 -132 10.8948 0.051
NP_440304.1_4 Forward -135 -125 1.84832 0.299
NP_442242.1_4 Forward -132 -125 14.3954 0.0124
NP_442242.1_4 Reverse -125 -132 14.3954 0.0124
NP_441619.1_8 Forward -139 -125 20.2551 0.0315
NP_441208.1_9 Forward -136 -122 7.57108 0.221
NP_441082.1_10 Reverse -216 -229 8.77074 0.262
NP_441083.1_5 Reverse -124 -134 20.3345 0.00053
NP_441083.1_5 Forward -133 -123 11.2881 0.0159
NP_441149.1_9 Forward -237 -218 5.30853 0.221
NP_441738.1_2 Forward -131 -124 15.28 0.0102
NP_441738.1_2 Reverse -126 -133 15.28 0.0102
NP_440209.1_1 Reverse -124 -132 18.1123 0.00295
NP_440209.1_1 Forward -133 -125 18.1123 0.00295
NP_442889.1_8 Reverse -121 -135 19.1735 0.0084
NP_442889.1_8 Forward -103 -89 8.45543 0.12
NP_440178.1_7 Forward -134 -115 -10.522 0.0782
NP_442570.1_3 Forward -141 -122 3.73603 0.166
NP_441716.1_1 Reverse -124 -138 4.03116 0.259
NP_442111.1_4 Forward -134 -120 12.1926 0.0451
NP_442111.1_4 Reverse -123 -137 6.58777 0.12
NP_441533.1_2 Forward -129 -110 23.2056 0.0371
NP_440906.1_5 Forward -132 -125 15.8704 0.0124
NP_440906.1_5 Reverse -125 -132 15.8704 0.0124
NP_440438.2_8 Reverse -295 -314 3.24438 0.252
NP_440747.1_10 Forward -136 -124 14.887 0.00223
NP_440747.1_10 Reverse -121 -133 7.31547 0.00577
NP_442973.1_5 Forward -142 -123 13.7658 0.16
NP_441486.1_1 Forward -136 -122 -2.45868 0.175
NP_441486.1_1 Reverse -121 -135 -2.55701 0.175
NP_442634.1_4 Reverse -122 -136 -1.8687 0.149
NP_440470.1_5 Forward -291 -272 13.1297 0.16
NP_440842.1_10 Forward -398 -384 3.63784 0.255
NP_442848.1_1 Forward -139 -125 -2.65535 0.263
NP_443018.1_3 Forward -132 -125 14.8871 0.0123
NP_443018.1_3 Reverse -125 -132 14.8871 0.0123
NP_440376.1_1 Forward -133 -124 19.4693 0.000692
NP_440376.1_1 Reverse -124 -133 19.4693 0.000692
NP_441588.1_4 Reverse -126 -136 15.9097 0.0369
NP_442687.1_7 Reverse -123 -133 9.02648 0.0994
NP_442687.1_7 Forward -134 -124 8.92815 0.0994
NP_441077.1_2 Reverse -275 -294 4.82192 0.224
NP_441077.1_6 Reverse -299 -315 2.03061 0.29
NP_440066.1_5 Forward -116 -97 5.99684 0.287
NP_440642.1_10 Reverse -65 -79 1.96562 0.284
NP_440642.1_10 Forward -370 -356 1.5723 0.29
NP_441080.1_7 Reverse -246 -264 7.3932 0.238
NP_442296.1_9 Reverse -125 -144 -3.83545 0.259
NP_442658.1_1 Reverse -122 -132 14.2375 0.0237
NP_442658.1_1 Forward -135 -125 6.76441 0.214
NP_440353.1_3 Forward -292 -280 19.1152 0.123
NP_441553.1_4 Forward -222 -204 15.6627 0.283
NP_442205.1_9 Reverse -222 -238 14.3165 0.0397
NP_441414.1_9 Reverse -124 -143 9.24257 0.0242
NP_441414.1_9 Forward -133 -114 -10.9153 0.297
NP_441958.1_5 Reverse -123 -133 21.2195 0.000805
NP_441958.1_5 Forward -134 -124 12.2714 0.00183
NP_441137.1_2 Reverse -85 -99 17.2942 0.258
NP_442816.1_7 Forward -285 -266 8.35512 0.238
NP_439905.1_1 Forward -132 -119 6.4108 0.288
NP_440995.1_8 Forward -143 -124 6.68596 0.264
NP_440984.1_7 Reverse -119 -133 8.16106 0.154
NP_441097.1_2 Reverse -358 -375 9.28195 0.223
NP_439990.1_5 Reverse -119 -132 10.344 0.128
NP_442690.1_1 Forward -276 -257 -15.2418 0.28
NP_442911.1_1 Forward -312 -299 15.627 0.271
NP_442911.1_2 Forward -143 -124 5.89931 0.0311
NP_442911.1_2 Reverse -114 -133 -10.1286 0.27
NP_440153.1_5 Forward -132 -118 4.12949 0.199
NP_440934.1_4 Forward -306 -287 10.9142 0.187
NP_440062.1_6 Reverse -108 -127 4.62101 0.235
NP_440602.1_2 Forward -138 -119 1.47442 0.263
NP_441099.1_5 Reverse -114 -133 -8.26035 0.191
NP_441294.1_7 Forward -338 -324 10.7864 0.171
NP_441646.1_1 Forward -140 -121 8.65258 0.14
NP_441000.1_6 Forward -134 -120 -3.83532 0.225
NP_440605.1_4 Forward -143 -124 13.9592 0.243
NP_440484.1_3 Reverse -122 -136 12.1926 0.242
NP_440147.1_4 Forward -135 -122 18.4072 0.00407
NP_440147.1_4 Reverse -122 -135 10.344 0.0355
NP_441550.1_8 Reverse -122 -132 15.8108 0.0132
NP_441550.1_8 Forward -135 -125 14.6309 0.0132
NP_441916.1_7 Forward -133 -123 18.9579 0.00144
NP_441916.1_7 Reverse -124 -134 10.3048 0.0261
NP_441041.1_7 Reverse -121 -133 7.22324 0.171
NP_442396.1_5 Forward -137 -124 20.1771 0.00762
NP_441725.1_4 Reverse -119 -133 2.75226 0.279
NP_441725.1_5 Reverse -125 -135 2.04498 0.115
NP_441725.1_5 Forward -132 -122 1.94665 0.115
NP_439966.1_7 Reverse -122 -132 14.3359 0.0203
NP_439966.1_7 Forward -135 -125 7.25606 0.15
NP_442941.1_3 Forward -132 -122 19.2529 0.00262
NP_442941.1_3 Reverse -125 -135 11.0914 0.0116
NP_440289.1_2 Reverse -121 -134 3.16588 0.0811
NP_440260.1_8 Reverse -96 -114 -0.7675 0.221
NP_440260.1_8 Forward -142 -124 -7.15901 0.295
NP_441514.1_6 Reverse -364 -371 12.8221 0.252
NP_442281.1_1 Forward -138 -124 1.5723 0.296
NP_440177.1_9 Forward -141 -122 11.0125 0.292
NP_440647.1_9 Forward -135 -117 5.03403 0.23
NP_441644.1_6 Forward -133 -123 19.0557 0.000803
NP_441644.1_6 Reverse -124 -134 17.3841 0.00127
NP_440253.1_2 Forward -133 -115 10.2456 0.0413
NP_440929.1_8 Forward -133 -124 19.2726 0.000701
NP_440929.1_8 Reverse -124 -133 19.2726 0.000701
NP_442933.1_10 Forward -133 -124 17.601 0.00325
NP_442933.1_10 Reverse -124 -133 17.601 0.00325
NP_440576.1_2 Forward -299 -280 7.47261 0.269
NP_442671.1_2 Reverse -246 -265 3.92797 0.182
NP_440382.1_2 Forward -318 -299 5.70185 0.264
NP_441751.2_8 Reverse -125 -139 8.94771 0.0325
NP_441751.2_8 Forward -132 -118 -4.62196 0.176
NP_442554.1_8 Forward -132 -122 17.2863 0.00543
NP_442554.1_8 Reverse -125 -135 15.3197 0.00882
NP_442554.1_9 Reverse -73 -92 12.8831 0.279
NP_441762.1_7 Reverse -123 -135 0.530633 0.0747
NP_441762.1_7 Forward -134 -122 -6.84419 0.284
NP_442142.1_4 Forward -337 -324 3.95196 0.239
NP_442142.1_4 Reverse -121 -134 3.65697 0.248
NP_442142.1_4 Forward -136 -123 3.55864 0.251
NP_442292.1_1 Reverse -125 -134 18.486 0.00229
NP_442292.1_1 Forward -132 -123 17.5026 0.00435
NP_439989.1_9 Reverse -22 -41 12.1925 0.245
NP_443009.1_5 Forward -134 -123 14.5128 0.02
NP_443009.1_5 Reverse -123 -134 10.1862 0.0792
NP_440405.1_3 Forward -257 -238 10.8195 0.293
NP_440405.1_6 Forward -361 -343 1.88744 0.268
NP_441371.1_1 Reverse -274 -293 17.699 0.191
NP_441715.1_4 Forward -132 -122 16.7946 0.0106
NP_441715.1_4 Reverse -125 -135 7.94484 0.107
NP_440015.1_9 Reverse -124 -142 2.87075 0.202
NP_441198.1_5 Reverse -126 -139 14.965 0.206
NP_440379.1_5 Reverse -109 -128 -9.53865 0.264
NP_440464.1_10 Reverse -125 -135 13.0082 0.169
NP_441468.1_1 Forward -132 -125 15.8704 0.0124
NP_441468.1_1 Reverse -125 -132 15.8704 0.0124
NP_441020.2_6 Forward -386 -369 6.62702 0.26
NP_441673.1_1 Forward -133 -124 20.8459 0.000698
NP_441673.1_1 Reverse -124 -133 20.8459 0.000698
NP_441876.1_9 Forward -235 -225 11.091 0.28
NP_441826.1_2 Forward -139 -125 3.34284 0.111
NP_441330.1_1 Reverse -119 -138 -2.95047 0.0791
NP_441764.1_8 Reverse -279 -289 11.3107 0.284
NP_442868.1_6 Reverse -122 -132 10.4031 0.038
NP_442868.1_6 Forward -135 -125 9.81313 0.038
NP_442719.1_2 Forward -383 -365 -8.04469 0.241
NP_442719.1_2 Forward -382 -364 -9.61797 0.267
NP_441056.1_1 Forward -133 -114 -9.047 0.288
NP_441612.1_2 Reverse -124 -134 8.54929 0.21
NP_442427.1_8 Reverse -115 -134 16.9124 0.0576
NP_442808.1_1 Reverse -123 -133 8.73102 0.0481
NP_442808.1_1 Forward -134 -124 8.63269 0.0481
NP_440031.1_8 Reverse -188 -207 15.8307 0.201
NP_440145.1_3 Reverse -114 -133 2.16274 0.12
NP_442820.1_3 Reverse -139 -149 15.4175 0.267
NP_442505.1_2 Forward -287 -268 12.0953 0.259
NP_442050.1_5 Reverse -122 -132 15.9091 0.0091
NP_442050.1_5 Forward -135 -125 7.64939 0.243
NP_441878.1_6 Reverse -123 -133 10.5014 0.0176
NP_441878.1_6 Forward -134 -124 10.4031 0.0176
NP_441036.1_8 Reverse -123 -133 15.713 0.00724
NP_441036.1_8 Forward -134 -124 8.33817 0.174
NP_441557.1_5 Forward -133 -124 19.9609 0.000699
NP_441557.1_5 Reverse -124 -133 19.9609 0.000699
NP_442066.2_9 Reverse -120 -133 12.409 0.154
NP_440084.1_8 Reverse -302 -316 9.94278 0.271
NP_441739.1_2 Forward -263 -247 3.20445 0.281
NP_440233.1_1 Forward -85 -66 11.7008 0.123
NP_441819.1_2 Reverse -251 -270 15.2305 0.288
NP_440861.1_2 Reverse -266 -285 10.294 0.27
NP_442347.1_2 Reverse -125 -134 12.4878 0.056
NP_442347.1_2 Forward -132 -123 3.34298 0.284
NP_442645.1_2 Reverse -116 -135 -2.75381 0.0487
NP_442645.1_2 Forward -141 -122 -14.9469 0.185
NP_441037.1_4 Forward -135 -125 7.9999 0.237
NP_441037.1_4 Reverse -122 -132 7.22024 0.237
NP_441633.1_3 Forward -135 -122 1.10092 0.109
NP_441633.1_3 Reverse -122 -135 -3.71729 0.177
NP_440136.1_2 Forward -132 -125 15.9687 0.0123
NP_440136.1_2 Reverse -125 -132 15.9687 0.0123
NP_441728.2_4 Forward -325 -306 13.2252 0.25
NP_442998.1_10 Forward -131 -124 15.5754 0.0102
NP_442998.1_10 Reverse -126 -133 15.5754 0.0102
NP_440299.1_1 Forward -137 -124 18.9965 0.00298
NP_441799.1_1 Forward -137 -123 15.8302 0.0163
NP_441799.1_1 Reverse -120 -134 12.487 0.043
NP_442201.1_10 Forward -144 -125 -13.8652 0.278
NP_440256.1_1 Forward -136 -117 -2.0655 0.112
NP_440256.1_1 Reverse -121 -140 -9.24366 0.275
NP_441559.1_8 Reverse -119 -133 2.16287 0.147
NP_440915.1_6 Forward -137 -123 9.73436 0.039
NP_440915.1_6 Reverse -120 -134 0.786239 0.153
NP_442158.1_4 Reverse -86 -96 12.7631 0.242
NP_442158.1_4 Forward -306 -296 11.6814 0.265
NP_442158.1_4 Reverse -89 -99 10.8948 0.283
NP_441296.1_9 Forward -374 -361 9.45847 0.277
NP_442785.1_7 Reverse -122 -136 10.7177 0.228
NP_440695.1_6 Reverse -254 -268 16.4227 0.135
NP_440695.1_6 Reverse -300 -314 9.82961 0.276
NP_442993.1_1 Forward -133 -117 -10.0696 0.206
NP_442386.1_9 Forward -134 -125 13.8639 0.0289
NP_442386.1_9 Reverse -123 -132 6.39082 0.219
NP_441340.1_5 Forward -132 -125 15.6737 0.0124
NP_441340.1_5 Reverse -125 -132 15.6737 0.0124
NP_442327.1_3 Forward -321 -302 4.24897 0.3
NP_441506.1_1 Reverse -256 -275 21.418 0.0229
NP_442240.1_2 Forward -132 -113 -20.4534 0.295
NP_441160.1_9 Reverse -380 -399 8.16093 0.264
NP_440586.1_8 Forward -132 -125 13.2151 0.026
NP_440586.1_8 Reverse -125 -132 13.2151 0.026
NP_442251.1_6 Forward -132 -125 15.2804 0.0124
NP_442251.1_6 Reverse -125 -132 15.2804 0.0124
NP_442251.1_6 Reverse -246 -253 8.10225 0.245
NP_442959.1_5 Forward -309 -290 4.71934 0.3
NP_440684.1_9 Forward -139 -125 19.3708 0.0283
NP_441262.1_3 Reverse -124 -131 14.7888 0.0223
NP_441262.1_3 Forward -133 -126 14.7888 0.0223
NP_443051.1_1 Reverse -123 -132 19.5676 0.00335
NP_443051.1_1 Forward -134 -125 10.4228 0.00754
NP_439984.1_3 Forward -140 -126 15.0436 0.161
NP_440439.1_1 Reverse -121 -134 3.65753 0.11
NP_440372.1_2 Forward -132 -125 16.3621 0.0124
NP_440372.1_2 Reverse -125 -132 16.3621 0.0124
NP_440819.1_5 Reverse -193 -201 7.59091 0.272
NP_442493.1_1 Reverse -213 -232 17.2074 0.105
NP_442416.1_1 Forward -217 -198 9.7875 0.193
NP_442384.1_10 Reverse -124 -137 16.7355 0.00732
NP_442384.1_10 Forward -133 -120 10.2457 0.0465
NP_441877.1_9 Forward -294 -277 3.18543 0.284
NP_442790.1_4 Forward -142 -123 8.35759 0.0729
NP_442262.1_10 Forward -132 -125 14.1988 0.0123
NP_442262.1_10 Reverse -125 -132 14.1988 0.0123
NP_441689.1_5 Reverse -122 -132 8.3377 0.132
NP_441689.1_5 Forward -135 -125 5.78111 0.197
NP_442910.1_1 Forward -140 -121 0.58944 0.163
NP_441965.1_10 Reverse -121 -137 3.10679 0.274
NP_442693.1_7 Reverse -123 -142 7.37428 0.282
NP_440297.1_9 Reverse -125 -135 -0.118297 0.282
NP_440297.1_9 Forward -132 -122 -0.216628 0.282
NP_440888.1_2 Forward -133 -119 14.2569 0.0193
NP_440888.1_2 Reverse -124 -138 9.93039 0.11
NP_440600.1_4 Forward -141 -123 9.45892 0.0635
NP_440600.1_4 Reverse -116 -134 -6.56903 0.285
NP_441257.1_1 Forward -268 -251 15.0827 0.213
NP_441543.1_2 Reverse -125 -134 16.9127 0.00359
NP_441543.1_2 Forward -132 -123 15.9293 0.00518
NP_442845.1_2 Forward -139 -125 14.8476 0.0774
NP_441304.1_10 Reverse -363 -372 15.1427 0.164
NP_442426.1_1 Reverse -99 -115 14.7098 0.235
NP_441469.1_8 Reverse -123 -132 6.5879 0.227
NP_441469.1_8 Forward -134 -125 6.48957 0.227
NP_442315.1_2 Reverse -216 -228 9.08543 0.291
NP_443064.1_6 Reverse -124 -134 12.5669 0.0796
NP_443064.1_6 Forward -133 -123 10.8217 0.13
NP_442578.1_7 Forward -132 -125 14.5921 0.026
NP_442578.1_7 Reverse -125 -132 14.5921 0.026
NP_442578.1_7 Reverse -192 -199 6.72562 0.18
NP_440710.1_1 Reverse -116 -134 -1.84914 0.186
NP_440071.1_6 Reverse -218 -232 15.5501 0.235
NP_440148.1_1 Reverse -255 -274 -4.03212 0.219
NP_441462.1_2 Forward -133 -123 20.2362 0.000805
NP_441462.1_2 Reverse -124 -134 11.5831 0.00406
NP_443062.1_1 Forward -133 -115 7.18082 0.182
NP_443062.1_1 Reverse -124 -142 4.35311 0.264
NP_442204.1_1 Reverse -120 -131 1.92696 0.266
NP_442487.1_3 Reverse -158 -177 14.1591 0.297
NP_440516.1_8 Forward -133 -124 16.9127 0.00442
NP_440516.1_8 Reverse -124 -133 16.9127 0.00442
NP_442428.1_5 Forward -132 -125 15.8704 0.0124
NP_442428.1_5 Reverse -125 -132 15.8704 0.0124
NP_441068.1_2 Reverse -231 -250 7.96426 0.291
NP_441443.1_1 Forward -79 -60 -2.75381 0.271
NP_441867.1_2 Reverse -185 -204 -20.5517 0.292
NP_440673.1_3 Forward -131 -124 12.4288 0.0426
NP_440673.1_3 Reverse -126 -133 12.4288 0.0426
NP_440718.1_2 Reverse -231 -250 13.9625 0.197
NP_441052.1_2 Reverse -124 -134 19.9412 0.00106
NP_441052.1_2 Forward -133 -123 10.4031 0.0285
NP_442219.1_9 Reverse -125 -134 17.7976 0.00718
NP_442219.1_9 Forward -132 -123 8.25953 0.0681
NP_440436.1_4 Reverse -125 -134 17.2072 0.00233
NP_440436.1_4 Forward -132 -123 9.24241 0.0871
NP_440314.1_9 Forward -132 -113 10.3242 0.0289
NP_440314.1_9 Reverse -125 -144 -10.3253 0.295
NP_440648.1_1 Forward -133 -114 4.03102 0.232
NP_441719.1_4 Forward -132 -125 16.3621 0.0124
NP_441719.1_4 Reverse -125 -132 16.3621 0.0124
NP_441004.1_6 Reverse -371 -390 15.7324 0.268
NP_442366.1_5 Forward -136 -126 15.4175 0.0374
NP_442695.1_3 Reverse -290 -304 13.7653 0.268
NP_443054.1_2 Reverse -122 -136 -0.393733 0.294
NP_441851.1_10 Forward -134 -124 15.8113 0.00552
NP_441851.1_10 Reverse -123 -133 8.53483 0.114
NP_442700.1_10 Reverse -344 -362 19.0945 0.274
NP_442011.1_1 Reverse -123 -142 -2.0655 0.272
NP_441668.1_4 Forward -143 -124 4.81767 0.173
NP_442515.1_1 Forward -134 -120 12.291 0.0339
NP_442515.1_1 Reverse -123 -137 -4.32697 0.298
NP_441982.1_10 Reverse -75 -94 13.8633 0.143
NP_440165.1_5 Reverse -130 -149 -7.86702 0.281
NP_440165.1_5 Reverse -123 -142 -8.35868 0.298
NP_442689.1_8 Forward -271 -254 -4.38605 0.267
NP_442689.1_8 Forward -272 -255 -4.48438 0.267
NP_441349.1_10 Forward -143 -124 4.62101 0.0521
NP_441409.1_6 Forward -340 -321 -15.5368 0.297
NP_440432.1_9 Forward -132 -117 12.3696 0.0256
NP_442843.1_1 Forward -132 -113 -10.3253 0.277
NP_440431.1_3 Reverse -123 -142 -11.6036 0.288
NP_440431.1_7 Reverse -301 -320 1.17943 0.215
NP_442450.1_5 Forward -135 -125 7.55152 0.13
NP_441031.1_1 Reverse -300 -319 4.12335 0.292
NP_443047.1_7 Forward -374 -355 9.83255 0.188
NP_441570.1_1 Reverse -124 -142 -14.6322 0.226
NP_441078.1_4 Forward -133 -124 19.6659 0.0007
NP_441078.1_4 Reverse -124 -133 19.6659 0.0007
NP_442348.1_2 Reverse -96 -105 7.57121 0.28
NP_440526.1_3 Reverse -125 -136 1.04151 0.267
NP_440526.1_7 Forward -287 -268 12.8632 0.255
NP_441432.1_8 Reverse -123 -132 16.8143 0.00595
NP_441432.1_8 Forward -134 -125 16.8143 0.00595
NP_441432.1_9 Forward -210 -197 8.21054 0.292
NP_442320.1_8 Forward -139 -125 -4.7203 0.185
NP_441732.1_2 Reverse -120 -136 -15.5761 0.151
NP_440760.1_1 Forward -133 -114 -10.4236 0.084
NP_440760.1_1 Reverse -124 -143 -12.9802 0.0969
NP_442353.1_4 Reverse -118 -137 -0.984623 0.296
NP_442400.1_10 Reverse -257 -270 14.4811 0.173
NP_442489.1_7 Forward -133 -124 20.1576 0.000695
NP_442489.1_7 Reverse -124 -133 20.1576 0.000695
NP_440559.1_1 Reverse -125 -134 17.4043 0.00658
NP_440559.1_1 Forward -132 -123 8.65285 0.0586
NP_440559.1_1 Forward -333 -324 7.86621 0.0856
NP_441659.2_8 Forward -133 -123 20.9245 0.000805
NP_441659.2_8 Reverse -124 -134 18.1713 0.00133
NP_441022.1_1 Forward -221 -212 12.5054 0.232
NP_441092.1_3 Forward -131 -112 1.57275 0.2
NP_440363.1_4 Reverse -347 -366 15.8307 0.173
NP_442913.1_10 Reverse -115 -134 -0.39387 0.159
NP_442346.1_5 Forward -134 -124 16.6963 0.00248
NP_442346.1_5 Reverse -123 -133 16.303 0.00248
NP_440545.1_3 Forward -137 -120 -4.38605 0.224
NP_440025.1_3 Forward -379 -365 12.547 0.264
NP_441833.1_4 Forward -132 -125 15.9687 0.0124
NP_441833.1_4 Reverse -125 -132 15.9687 0.0124
NP_441329.1_6 Reverse -268 -287 2.7211 0.221
NP_441329.1_6 Forward -349 -330 -0.430137 0.275
NP_442162.1_9 Forward -132 -125 16.2637 0.0124
NP_442162.1_9 Reverse -125 -132 16.2637 0.0124
NP_441044.1_4 Forward -109 -91 3.26407 0.237
NP_440772.1_8 Reverse -282 -301 8.35759 0.259
NP_442140.1_3 Reverse -125 -135 12.2714 0.0632
NP_442140.1_3 Forward -132 -122 4.69992 0.238
NP_441609.1_1 Reverse -203 -222 -0.000545616 0.225
NP_440875.1_9 Forward -131 -121 7.69067 0.255
NP_441813.1_5 Reverse -122 -132 18.1713 0.00743
NP_441813.1_5 Forward -135 -125 8.63316 0.0367
NP_440594.1_8 Forward -132 -119 12.1134 0.152
NP_440590.1_4 Forward -132 -119 3.26421 0.0749
NP_440590.1_4 Reverse -125 -138 0.707601 0.144
NP_440590.1_7 Forward -142 -128 17.6008 0.23
NP_440567.1_1 Reverse -125 -139 12.0943 0.0254
NP_442497.1_10 Forward -132 -123 17.601 0.00813
NP_442497.1_10 Reverse -125 -134 10.4228 0.0087
NP_440821.1_4 Forward -135 -125 9.41981 0.0286
NP_440821.1_4 Reverse -122 -132 2.24165 0.131
NP_441239.1_9 Reverse -122 -134 13.0187 0.0389
NP_441239.1_9 Forward -135 -123 3.38223 0.285
NP_441951.1_1 Reverse -135 -154 18.1907 0.251
NP_441727.1_5 Forward -276 -257 18.6004 0.226
NP_441892.1_1 Forward -142 -125 -4.28772 0.258
NP_440604.1_6 Reverse -228 -247 -1.96717 0.211
NP_441874.1_1 Reverse -218 -232 13.6676 0.211
NP_441541.1_1 Reverse -304 -322 -2.95826 0.264
NP_441541.1_1 Reverse -267 -285 -4.10417 0.271
NP_440833.1_6 Forward -377 -363 12.9786 0.175
NP_442216.1_4 Forward -373 -365 8.08217 0.255
NP_441617.1_6 Forward -263 -244 -7.17871 0.292
NP_440546.1_4 Forward -133 -123 13.5365 0.0459
NP_440546.1_4 Reverse -124 -134 10.046 0.109
NP_440462.1_6 Reverse -122 -132 18.7612 0.00454
NP_440462.1_6 Forward -135 -125 1.35667 0.294
NP_440868.1_4 Reverse -120 -132 7.70879 0.0648
NP_440868.1_4 Forward -137 -125 6.1355 0.0878
NP_441848.1_7 Reverse -376 -395 -3.44288 0.284
NP_441084.1_6 Reverse -122 -136 17.1007 0.0523
NP_439942.1_2 Reverse -241 -260 15.8998 0.228
NP_442039.1_4 Forward -132 -125 15.1821 0.0124
NP_442039.1_4 Reverse -125 -132 15.1821 0.0124
NP_442679.1_1 Forward -71 -52 2.16274 0.167
NP_442679.1_3 Reverse -275 -293 13.9821 0.0116
NP_442829.1_2 Forward -346 -330 13.8425 0.287
NP_441926.1_3 Forward -133 -117 14.3165 0.0474
NP_440825.1_7 Reverse -125 -135 12.9096 0.152
NP_442837.1_3 Forward -132 -125 15.7721 0.0124
NP_442837.1_3 Reverse -125 -132 15.7721 0.0124
NP_442053.1_1 Forward -133 -124 18.3876 0.0007
NP_442053.1_1 Reverse -124 -133 18.3876 0.0007
NP_440505.1_3 Reverse -122 -132 17.188 0.00332
NP_440505.1_3 Forward -135 -125 9.22315 0.122
NP_442532.1_1 Reverse -275 -289 9.14183 0.284
NP_442532.1_4 Forward -262 -244 7.86797 0.289
NP_440914.1_1 Reverse -124 -134 17.5935 0.000537
NP_440914.1_1 Forward -133 -123 16.3248 0.00196
NP_441011.1_8 Forward -132 -123 16.6177 0.00602
NP_441011.1_8 Reverse -125 -134 8.25953 0.144
NP_442533.1_6 Forward -133 -124 17.2076 0.00137
NP_442533.1_6 Reverse -124 -133 17.2076 0.00137
NP_440263.1_5 Forward -260 -246 9.73436 0.294
NP_440263.1_5 Forward -271 -257 8.94771 0.294
NP_442232.1_3 Forward -141 -122 -13.3736 0.282
NP_443016.1_1 Forward -139 -120 -6.49039 0.259
NP_441482.1_7 Reverse -118 -132 4.81781 0.0442
NP_439944.1_9 Reverse -125 -135 10.5014 0.0887
NP_439944.1_9 Forward -132 -122 9.12481 0.1
NP_441697.1_5 Forward -317 -298 -7.40105 0.243
NP_441028.1_6 Reverse -383 -393 10.1076 0.21
NP_441028.1_6 Reverse -72 -82 3.51951 0.292
NP_441527.1_4 Reverse -269 -288 -6.92359 0.227
NP_441527.1_4 Reverse -268 -287 -10.8388 0.275
NP_441527.1_7 Reverse -54 -73 7.27514 0.29
NP_440115.1_6 Reverse -121 -131 4.79825 0.282
NP_441106.1_1 Reverse -123 -132 18.486 0.0028
NP_441106.1_1 Forward -134 -125 9.63616 0.0311
NP_441106.1_9 Reverse -211 -221 17.188 0.209
NP_439903.1_6 Reverse -121 -140 5.2102 0.186
NP_439903.1_6 Reverse -377 -396 -0.886293 0.287
NP_001035870.1_3 Forward -144 -125 22.1239 0.0103
NP_442306.1_10 Reverse -119 -138 -19.0768 0.197
NP_441286.1_1 Forward -134 -122 5.93884 0.0258
NP_441286.1_1 Reverse -123 -135 3.48056 0.0467
NP_441286.1_1 Reverse -324 -336 0.727295 0.108
NP_440670.1_8 Forward -133 -124 18.3876 0.000699
NP_440670.1_8 Reverse -124 -133 18.3876 0.000699
NP_441930.1_3 Reverse -269 -288 4.79098 0.266
NP_440886.1_7 Reverse -123 -133 8.04271 0.0805
NP_440886.1_7 Forward -134 -124 7.94438 0.0805
NP_442614.1_2 Forward -47 -33 5.70279 0.298
NP_442382.1_7 Reverse -111 -130 6.98095 0.229
NP_440404.1_9 Reverse -254 -273 9.21455 0.238
NP_440404.1_10 Forward -34 -21 20.0967 0.169
NP_442072.1_9 Forward -134 -116 -22.7936 0.259
NP_440907.2_8 Forward -132 -122 9.616 0.103
NP_440907.2_8 Reverse -125 -135 7.64939 0.117
NP_442893.1_4 Reverse -299 -318 -0.0996487 0.251
NP_441626.1_2 Forward -132 -125 15.7721 0.0124
NP_441626.1_2 Reverse -125 -132 15.7721 0.0124
NP_442365.1_7 Reverse -120 -139 -6.49039 0.295
NP_442794.1_1 Forward -137 -125 9.38042 0.0795
NP_442615.1_1 Forward -142 -124 0.609134 0.0999
NP_440387.1_1 Reverse -124 -140 15.9882 0.00482
NP_440387.1_1 Forward -133 -117 -1.3181 0.142
NP_440387.1_3 Reverse -234 -248 16.4209 0.228
NP_441431.1_2 Reverse -121 -135 7.17714 0.247
NP_441993.1_1 Forward -139 -120 4.48058 0.22
NP_442805.1_5 Forward -240 -221 -5.50783 0.277
NP_440114.1_10 Forward -133 -119 13.7659 0.0502
NP_440766.1_4 Forward -144 -130 1.67122 0.22
NP_441421.1_6 Reverse -278 -295 9.88781 0.28
NP_441237.1_9 Reverse -125 -135 14.828 0.0242
NP_439910.1_2 Reverse -116 -133 -13.6292 0.162
NP_440457.1_1 Forward -137 -125 0.825626 0.25
NP_440457.1_1 Reverse -120 -132 -0.551008 0.268
NP_442680.1_5 Forward -61 -42 5.15213 0.227
NP_442680.1_5 Reverse -274 -293 0.462991 0.266
NP_440054.1_4 Reverse -237 -256 9.93088 0.284
NP_442509.1_9 Reverse -124 -134 8.14104 0.192
NP_442509.1_9 Forward -133 -123 8.04271 0.192
NP_443037.1_8 Forward -147 -128 5.80098 0.262
NP_440554.1_4 Forward -132 -122 17.9746 0.0131
NP_441885.1_5 Reverse -124 -134 20.9245 0.000538
NP_441885.1_5 Forward -133 -123 11.3864 0.00668
NP_442341.1_9 Reverse -122 -136 12.6836 0.0984
NP_443000.1_7 Reverse -122 -132 20.3345 0.00223
NP_443000.1_7 Forward -135 -125 10.3048 0.0345
NP_440275.1_3 Reverse -122 -132 16.1063 0.0155
NP_440275.1_3 Forward -135 -125 8.04317 0.0602
NP_440091.1_1 Forward -137 -125 1.41561 0.197
NP_441902.1_3 Reverse -226 -236 16.1885 0.159
NP_441207.1_7 Reverse -282 -296 11.0948 0.249
NP_441207.1_7 Forward -221 -207 9.83628 0.273
NP_442495.1_4 Forward -305 -295 14.7297 0.16
NP_441105.1_3 Forward -144 -125 8.55425 0.0482
NP_440216.1_1 Forward -133 -119 14.9459 0.00425
NP_440216.1_1 Reverse -124 -138 -1.47537 0.0328
NP_440172.1_1 Forward -133 -123 17.5813 0.00421
NP_440172.1_1 Reverse -124 -134 15.0247 0.00945
NP_442015.1_10 Forward -137 -124 1.49425 0.204
NP_441226.1_7 Forward -132 -125 14.4934 0.0123
NP_441226.1_7 Reverse -125 -132 14.4934 0.0123
NP_441111.1_7 Forward -132 -124 18.7023 0.00294
NP_441111.1_7 Reverse -125 -133 18.7023 0.00294
NP_442379.1_10 Forward -140 -123 -1.0428 0.223
NP_441766.1_2 Forward -133 -124 17.5026 0.00297
NP_441766.1_2 Reverse -124 -133 17.5026 0.00297
NP_440416.1_9 Forward -140 -121 -16.9135 0.226
NP_442403.1_8 Reverse -93 -112 3.44104 0.226
NP_440591.1_9 Forward -140 -122 4.6407 0.273
NP_440261.1_5 Forward -132 -119 -4.60227 0.158
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGTGGTTCTAGGGAAAAGAGCTTGACCCAATTCCCCTTTCTGGATCATATGGATAGATAATAGAAGCACAATCGACAGTTATGAATAATCTTAAAATTTCCTGGGGTTTCTAGATTTTCTTTAAATCTTATTTTCCTTAAATTTTCCGTAATCTCTTCTTAAAGTTGCTCCCCTACTCCCAAAAACTTGATTCAAGTCCTTTTTACCGCCGCCTAGTATGGAATTTGACTTCATTACTGCTGCTCACTTGAGGGCACAACTGAGTTTGGCGATCGCCTGATATTCTGCCGCCCAGAAAACTCCCCTAACAAAAAAATCATGGTGAGCAAAGAGACATGAGGTAGGAAAATAATGGAGAAAGGTCAGAATTATCTACAACATCATTTTTTAAGCGCAACCC

CDS

ATGCCCAAAATTTTGATAATTGAAGACCAACTAGAGGTTAGGCAGAATATAGAGGACATTCTCTCCCTGGAAGACTACGAAGTTATTTCTGCCCCCGATGGTGAAACTGGTCTGGCTTTGGCGAAGCAACATCTGCCGGACTTAATTCTCTGTGATGTGATGATGCCCAGGGTGACGGGATTTGAAGTATTGATGTCCCTACGCCAGGACCCCAACTTGGCGGTTATTCCTTTTATTCTTTTAACAGCAAAGGCAGACCACCACGCATTCCGCCAGGGCATGGAATTGGGGGCAGATGATTATTTAACCAAACCCTTCACCATCGATGAACTGCTCCATGCCATCACCACCCGTTTGGACCGCCATTATCAGCGCCAGGCCATGGTGGAAAGCCGCCTGGATAATCTGCGCCAACAAGTTACCCGTTCCCTGCCCCATGAATTATTGACCCCCCTAAACGGGATTTTGGGGACGTCCCAGTTGCTGATTAATTTCTATGATTCCCTCTCCCACAATGAAGTGATGGAATCGTTGCATGACATCAAAACCTCTGGGGAGAGACTCCATCGTTTGGTGGAGAATTTTTTGTTGATGGCAGATTTGGACCTACTCTTGGCCAGCCCCACCCGCCTGGAGGTGTGGCAATCCCGGTTGAGTCAATACACCGAACTGCCATTGAGCTTGGCTCTGGTGTTGGAGAATTTGGGACAGAATCAACCCCGCCGTCAGGATGTGGAAATGATGATTGTGCCCCAGCGGGTCCAGGTGGCGGAGCCAGATTTTCAGAAAATTGTTCAAGAATTGCTGGACAATGCTTTTAAGTTTTCACTACCTGGTACCCTGGTGCAACTGGAAGCCGTGGCTAAAAATGGCACCTGTCACTTGACCATCCGAGACCATGGTAGGGGCATGGCCAAAGAAGAATTAAATTCCATCGGTGCCCATGTACAGTTCCGGCGTCACGAATTTGAGCAACAGGGTTCTGGGCTGGGGTTGACCTTAGCTCAACGACTGACGGAACTCTACGGTGGAAAATTGGCGATCGCCAGTGTCCCCGGGGAAGGCACCACCATTACTATCCAGGGCTGGGAATCAGACTCCATTTAA

Protein

MPKILIIEDQLEVRQNIEDILSLEDYEVISAPDGETGLALAKQHLPDLILCDVMMPRVTGFEVLMSLRQDPNLAVIPFILLTAKADHHAFRQGMELGADDYLTKPFTIDELLHAITTRLDRHYQRQAMVESRLDNLRQQVTRSLPHELLTPLNGILGTSQLLINFYDSLSHNEVMESLHDIKTSGERLHRLVENFLLMADLDLLLASPTRLEVWQSRLSQYTELPLSLALVLENLGQNQPRRQDVEMMIVPQRVQVAEPDFQKIVQELLDNAFKFSLPGTLVQLEAVAKNGTCHLTIRDHGRGMAKEELNSIGAHVQFRRHEFEQQGSGLGLTLAQRLTELYGGKLAIASVPGEGTTITIQGWESDSI