Your browser is old and dusty. Try Google Chrome!

Details for sll1543

ORF sll1543
Accession NP_442977.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440226.1_1 Forward -101 -82 1.76941 0.29
NP_443002.1_5 Reverse -370 -388 8.27817 0.297
NP_439997.1_4 Forward -318 -299 6.39097 0.266
NP_440631.1_9 Forward -118 -99 9.54094 0.3
NP_442972.1_1 Reverse -274 -292 7.48186 0.291
NP_441083.1_5 Forward -191 -181 2.63497 0.193
NP_441434.1_1 Reverse -286 -300 9.6563 0.24
NP_442889.1_10 Reverse -339 -358 11.6785 0.239
NP_441387.1_5 Forward -380 -361 19.7422 0.164
NP_442848.1_1 Reverse -176 -190 -0.393733 0.263
NP_442687.1_1 Reverse -278 -291 15.0633 0.243
NP_441077.1_6 Reverse -275 -291 8.00784 0.216
NP_441077.1_6 Reverse -108 -124 1.8378 0.294
NP_441317.1_4 Forward -364 -350 10.0369 0.29
NP_439975.1_2 Forward -106 -88 7.19731 0.226
NP_441110.1_1 Forward -42 -23 6.4893 0.253
NP_442247.1_5 Reverse -84 -98 14.582 0.234
NP_442933.1_2 Reverse -350 -368 12.4159 0.227
NP_442933.1_10 Forward -394 -385 9.63616 0.0616
NP_440382.1_2 Reverse -251 -270 4.81688 0.27
NP_440382.1_2 Reverse -110 -129 3.83357 0.274
NP_442142.1_4 Reverse -382 -395 7.39353 0.141
NP_441911.1_10 Reverse -343 -362 10.0051 0.226
NP_442977.1_5 Forward -28 -9 24.9755 0.0019
NP_441036.1_3 Reverse -292 -311 -1.96717 0.217
NP_441036.1_8 Reverse -384 -394 9.51814 0.174
NP_441445.1_1 Forward -110 -91 8.94757 0.112
NP_440084.1_8 Forward -291 -277 10.2293 0.271
NP_440709.1_1 Reverse -76 -95 0.490334 0.259
NP_440969.1_3 Reverse -86 -104 6.80322 0.294
NP_442114.1_8 Forward -247 -233 3.8339 0.281
NP_442750.1_3 Forward -340 -321 -11.1119 0.236
NP_440350.1_5 Forward -366 -347 -5.40875 0.289
NP_441918.1_7 Forward -102 -83 -2.0655 0.297
NP_442315.1_1 Forward -202 -184 4.14905 0.28
NP_442315.1_2 Forward -343 -331 9.18376 0.291
NP_443064.1_6 Reverse -92 -102 9.94905 0.187
NP_440255.1_7 Reverse -14 -31 6.82368 0.299
NP_440454.1_1 Forward -364 -345 11.1342 0.246
NP_442080.1_7 Forward -74 -55 -3.63879 0.29
NP_440222.1_6 Reverse -143 -156 19.1938 0.125
NP_441086.1_3 Reverse -238 -257 6.9054 0.276
NP_441733.1_10 Reverse -179 -192 9.65572 0.112
NP_441004.1_1 Forward -383 -364 -12.8819 0.251
NP_442694.1_9 Forward -40 -21 8.55425 0.277
NP_442939.1_7 Forward -388 -369 8.75091 0.295
NP_442515.1_1 Reverse -91 -105 -3.73699 0.297
NP_441982.1_6 Forward -150 -141 12.7718 0.274
NP_440431.1_4 Reverse -345 -364 -7.59203 0.262
NP_440431.1_4 Reverse -350 -369 -8.64244 0.275
NP_441333.1_1 Forward -363 -353 11.6853 0.241
NP_440757.1_8 Forward -254 -242 18.9964 0.0961
NP_440757.1_8 Reverse -242 -254 18.4221 0.0961
NP_443040.1_1 Reverse -275 -289 10.3772 0.291
NP_441329.1_6 Reverse -344 -363 3.10306 0.217
NP_441329.1_6 Reverse -342 -361 2.53011 0.227
NP_442699.1_8 Forward -202 -183 -12.7836 0.257
NP_440671.1_1 Forward -97 -78 9.67211 0.191
NP_440671.1_1 Forward -263 -244 8.42796 0.204
NP_441490.1_1 Reverse -183 -202 14.3558 0.186
NP_441490.1_1 Forward -196 -177 14.0608 0.186
NP_442886.1_1 Reverse -142 -156 20.9441 0.136
NP_442669.1_1 Forward -107 -88 18.584 0.002
NP_440354.1_7 Forward -400 -382 6.31233 0.284
NP_440374.1_9 Reverse -201 -220 11.7992 0.215
NP_441848.1_4 Reverse -269 -285 7.45517 0.288
NP_439948.1_2 Reverse -349 -367 14.9942 0.259
NP_441084.1_6 Forward -78 -64 10.7985 0.228
NP_442039.1_10 Reverse -139 -157 13.588 0.227
NP_442679.1_1 Reverse -343 -362 1.86774 0.17
NP_442679.1_1 Reverse -340 -359 -4.22878 0.274
NP_442532.1_1 Reverse -344 -358 10.1136 0.25
NP_439944.1_9 Reverse -135 -145 4.99491 0.284
NP_442203.1_1 Reverse -352 -366 17.3912 0.15
NP_441697.1_5 Reverse -276 -295 -7.40105 0.243
NP_441527.1_4 Reverse -345 -364 5.20389 0.106
NP_441527.1_4 Reverse -344 -363 4.43995 0.111
NP_441527.1_4 Reverse -343 -362 3.867 0.111
NP_441527.1_4 Reverse -342 -361 -2.14899 0.154
NP_441527.1_4 Reverse -347 -366 -7.30556 0.232
NP_441527.1_4 Reverse -346 -365 -11.0297 0.278
NP_441527.1_4 Reverse -349 -368 -11.3162 0.281
NP_441527.1_4 Reverse -340 -359 -11.7937 0.284
NP_441527.1_4 Reverse -350 -369 -12.4621 0.288
NP_441106.1_1 Reverse -384 -393 2.35967 0.287
NP_441479.1_9 Forward -391 -373 12.5072 0.293
NP_442842.1_10 Forward -359 -340 1.0479 0.254
NP_441993.1_1 Forward -337 -318 1.36194 0.28
NP_440766.1_4 Reverse -178 -192 4.62115 0.124
NP_442246.1_6 Reverse -278 -297 2.75272 0.291
NP_442680.1_5 Reverse -270 -289 9.5482 0.145
NP_442680.1_5 Reverse -48 -67 0.951443 0.255
NP_441489.1_3 Forward -317 -303 8.98786 0.232
NP_441159.1_8 Forward -364 -345 -2.16459 0.242
NP_442703.1_9 Forward -259 -241 22.2419 0.0381
NP_441350.1_10 Reverse -195 -214 21.7314 0.0685
NP_442116.1_2 Reverse -377 -396 10.6184 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGATGTATCGCTCGTCGGTCTTGGGAAATGAATGTTGTTTTTTTCTTTACTTCTTTATTGTAGGGAAATGACAATTTGTGCGTATTGGCACTAATACTGGACTTTCACTAAATTTGAATTTTTTACTGCTCCGTAGAAATACGATTTTTTGTAACAAAAACCACACAAATCGAGAAATGTATTGTCCCTAATCACTCAATGGTTGTGACCCAGATCACAACTGTTGTGTATCTAGATCAAGATAGGGTTTTCCTGAAAAAGAAAGCTGTTTACGTCAATTCTGAATAGTTTCTTGAGAGGGTGATTGTGAAGTTGTGTTAATCAAGCTCTGGTTACTGTCCTTATTCCTCTTCGGGATGTTGACGCTTAGAATATTGACCAACGTTTAAAAGTCCATACC

CDS

GTGAAACTTTATCTAGACACCAGCGTGTTGAATCGGGTTTTTGACGATCAAACCCAGGCAAGGATTGCCTTAAAGACCCAAGCTCTGAGGATGATTTTGCAACTGGTGGAAACAGAAGAGGTCGAATTTCTCAACTCGGCAGTCTTAGAGTTTGAAGCTCAGAAAAATCCCTATCCGCCAAGACAACGTTGGGTACAGCAGTGTTTAGCCCTAGCCAAAGCCTATGTGCCCATGGATGAAGAGATTGTGGCTAGGGGGCAATCCTTAGAGCAAATGGGAGTGAAATCCATTGATGCCTTGCACATGGCCAGCGCAGAAAAGGGTGGATGTGATTATTTTTTAGCCTGTGATGATCGATTGCTCCGTCGTTATCATGGAAAAGTCAAAGCCCTAAATCCAGTAAGCTTCATTTTATTATTAACAGAGGGAGAGCGATGA

Protein

MKLYLDTSVLNRVFDDQTQARIALKTQALRMILQLVETEEVEFLNSAVLEFEAQKNPYPPRQRWVQQCLALAKAYVPMDEEIVARGQSLEQMGVKSIDALHMASAEKGGCDYFLACDDRLLRRYHGKVKALNPVSFILLLTEGER