Your browser is old and dusty. Try Google Chrome!

Details for sll1537

ORF sll1537
Accession NP_441755.1
Symbol
Category similar to mutator MutT protein
Definition DNA replication, restriction, modification, recombination, and repair
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -350 -336 12.8809 0.201
NP_441061.1_2 Forward -349 -335 13.5693 0.0392
NP_441061.1_2 Reverse -342 -356 11.7993 0.0505
NP_441061.1_2 Forward -289 -275 3.04785 0.168
NP_440557.1_1 Reverse -342 -361 16.8141 0.0482
NP_440557.1_1 Forward -349 -330 0.786102 0.265
NP_440795.1_7 Forward -349 -342 14.6904 0.0123
NP_440795.1_7 Reverse -342 -349 14.6904 0.0123
NP_440795.1_7 Reverse -241 -248 10.8555 0.132
NP_440795.1_7 Reverse -276 -283 10.2655 0.154
NP_441418.1_6 Reverse -269 -288 -19.3717 0.0876
NP_441418.1_6 Reverse -341 -360 -20.8467 0.129
NP_441418.1_6 Forward -350 -331 -22.125 0.169
NP_441418.1_6 Reverse -281 -300 -29.1065 0.216
NP_441453.1_4 Reverse -341 -349 16.539 0.00633
NP_441453.1_4 Forward -350 -342 16.539 0.00633
NP_441453.1_4 Reverse -281 -289 6.70593 0.121
NP_441453.1_4 Forward -249 -241 3.756 0.288
NP_442151.1_6 Forward -350 -336 15.9292 0.0192
NP_442151.1_6 Reverse -341 -355 8.25939 0.178
NP_442151.1_6 Forward -290 -276 7.47274 0.197
NP_442151.1_6 Reverse -275 -289 5.70279 0.266
NP_440226.1_1 Forward -350 -331 4.03102 0.206
NP_440120.1_4 Reverse -3 -17 17.4042 0.242
NP_441098.1_3 Reverse -312 -331 -5.162 0.28
NP_440348.1_6 Reverse -165 -184 14.4541 0.102
NP_440996.1_2 Reverse -6 -15 15.241 0.248
NP_440996.1_3 Reverse -268 -286 9.55725 0.279
NP_441816.1_6 Forward -237 -225 16.6569 0.218
NP_442287.1_5 Reverse -269 -279 16.2046 0.218
NP_442173.1_1 Forward -349 -341 15.4574 0.00633
NP_442173.1_1 Reverse -342 -350 15.4574 0.00633
NP_442173.1_1 Forward -289 -281 5.82095 0.2
NP_442752.1_4 Forward -350 -343 13.8055 0.0199
NP_442752.1_4 Reverse -341 -348 13.8055 0.0199
NP_442752.1_4 Reverse -281 -288 13.8055 0.0199
NP_442752.1_4 Forward -261 -254 5.25066 0.256
NP_443027.1_4 Reverse -339 -349 15.3197 0.0437
NP_443027.1_4 Reverse -279 -289 9.32148 0.166
NP_443027.1_4 Forward -352 -342 5.87989 0.294
NP_442975.1_10 Forward -354 -340 20.3534 0.00216
NP_442975.1_10 Reverse -337 -351 3.63724 0.252
NP_440784.1_7 Forward -349 -342 15.9687 0.0123
NP_440784.1_7 Reverse -342 -349 15.9687 0.0123
NP_440784.1_7 Forward -248 -241 9.67555 0.104
NP_440784.1_7 Forward -289 -282 6.23397 0.241
NP_440784.1_7 Reverse -282 -289 6.13563 0.241
NP_442861.1_1 Reverse -221 -240 17.699 0.19
NP_440061.1_9 Forward -352 -338 10.422 0.124
NP_440928.1_5 Forward -349 -331 5.23069 0.3
NP_441054.1_1 Reverse -334 -348 17.8958 0.129
NP_441054.1_4 Reverse -174 -192 2.57575 0.169
NP_441054.1_4 Reverse -271 -289 -0.374176 0.182
NP_441054.1_6 Reverse -279 -298 14.3558 0.257
NP_441476.1_5 Forward -355 -336 16.5191 0.075
NP_441476.1_5 Reverse -336 -355 1.76941 0.188
NP_439979.1_9 Reverse -270 -288 15.7521 0.22
NP_440878.1_4 Reverse -15 -33 11.2289 0.288
NP_442062.1_8 Reverse -341 -351 19.4496 0.000558
NP_442062.1_8 Forward -350 -340 10.3048 0.0493
NP_442062.1_8 Forward -249 -239 4.3066 0.221
NP_440761.1_4 Reverse -179 -198 -13.9635 0.257
NP_440761.1_8 Forward -229 -210 20.4514 0.0739
NP_441859.1_3 Reverse -340 -359 8.94676 0.131
NP_441859.1_3 Forward -351 -332 7.27514 0.162
NP_441859.1_5 Reverse -219 -238 2.3594 0.295
NP_440304.1_4 Reverse -339 -349 18.9579 0.00406
NP_440304.1_4 Reverse -182 -192 5.19158 0.223
NP_440304.1_4 Forward -352 -342 1.84832 0.299
NP_442242.1_4 Forward -349 -342 14.3954 0.0124
NP_442242.1_4 Reverse -342 -349 14.3954 0.0124
NP_442242.1_4 Reverse -282 -289 12.4288 0.0393
NP_440044.1_8 Forward -289 -270 12.2908 0.0427
NP_440044.1_8 Reverse -12 -31 5.89931 0.0967
NP_440916.1_1 Forward -16 -2 18.7808 0.0753
NP_441352.1_2 Reverse -334 -353 2.26107 0.222
NP_441619.1_8 Forward -356 -342 6.58715 0.295
NP_440307.1_2 Forward -244 -225 6.19431 0.209
NP_441208.1_9 Forward -353 -339 7.76774 0.219
NP_441208.1_9 Reverse -338 -352 7.76774 0.219
NP_441594.1_6 Reverse -332 -351 21.1406 0.015
NP_441594.1_6 Forward -359 -340 11.3075 0.116
NP_442742.1_9 Forward -192 -173 -5.50708 0.221
NP_442110.1_7 Forward -350 -336 19.6658 0.0138
NP_442110.1_7 Reverse -341 -355 2.35953 0.222
NP_442110.1_7 Forward -284 -270 0.982901 0.241
NP_442110.1_7 Forward -290 -276 -0.492064 0.291
NP_440856.1_4 Reverse -334 -353 4.62101 0.102
NP_440856.1_4 Reverse -25 -44 -3.44213 0.232
NP_441083.1_5 Reverse -341 -351 11.3864 0.0159
NP_441083.1_5 Forward -350 -340 11.2881 0.0159
NP_441083.1_5 Forward -290 -280 9.81313 0.0224
NP_441083.1_5 Reverse -281 -291 -0.0199663 0.251
NP_442827.1_8 Forward -358 -339 -0.0996487 0.218
NP_442827.1_8 Forward -215 -196 -0.39464 0.226
NP_441434.1_1 Forward -25 -11 7.65097 0.267
NP_441434.1_3 Reverse -362 -381 -0.983855 0.236
NP_441141.1_4 Reverse -331 -350 9.0459 0.292
NP_441738.1_2 Forward -348 -341 15.28 0.0102
NP_441738.1_2 Reverse -343 -350 15.28 0.0102
NP_441738.1_2 Forward -288 -281 15.28 0.0102
NP_441738.1_2 Forward -61 -54 6.23363 0.264
NP_441558.1_5 Reverse -339 -358 17.109 0.0231
NP_441558.1_5 Reverse -279 -298 11.0125 0.0879
NP_441558.1_5 Forward -359 -340 5.70265 0.242
NP_440209.1_1 Reverse -341 -349 18.1123 0.00295
NP_440209.1_1 Forward -350 -342 18.1123 0.00295
NP_440209.1_1 Reverse -281 -289 14.8674 0.012
NP_440209.1_1 Forward -290 -282 5.62429 0.0821
NP_442889.1_8 Forward -353 -339 3.34225 0.281
NP_440056.1_1 Reverse -336 -355 13.5691 0.146
NP_441713.1_1 Reverse -335 -354 -8.752 0.157
NP_440178.1_7 Forward -291 -272 -12.6852 0.123
NP_440178.1_7 Forward -351 -332 -21.6334 0.232
NP_442570.1_3 Forward -380 -361 -4.72043 0.235
NP_442570.1_3 Reverse -232 -251 -9.53865 0.299
NP_441327.1_5 Reverse -4 -13 16.6177 0.111
NP_442111.1_3 Reverse -4 -17 15.5315 0.196
NP_442111.1_4 Forward -351 -337 13.0776 0.0399
NP_442111.1_4 Reverse -340 -354 7.9644 0.0826
NP_440343.1_9 Reverse -271 -290 14.0608 0.152
NP_440906.1_5 Forward -349 -342 15.8704 0.0124
NP_440906.1_5 Reverse -342 -349 15.8704 0.0124
NP_440906.1_5 Forward -289 -282 12.0355 0.0724
NP_440906.1_5 Reverse -282 -289 12.0355 0.0724
NP_440747.1_10 Reverse -338 -350 7.80712 0.00223
NP_440747.1_10 Forward -353 -341 5.44718 0.0137
NP_440747.1_10 Reverse -278 -290 -12.0557 0.199
NP_441854.1_10 Forward -352 -333 1.96607 0.282
NP_442973.1_5 Forward -359 -340 12.2908 0.206
NP_441486.1_1 Forward -353 -339 5.21113 0.0384
NP_441486.1_1 Reverse -278 -292 -2.36035 0.175
NP_441486.1_1 Reverse -338 -352 -3.73699 0.181
NP_441880.2_10 Forward -289 -271 12.1139 0.135
NP_440944.1_2 Reverse -5 -24 -0.0988766 0.256
NP_442634.1_4 Forward -352 -338 6.48943 0.0498
NP_442634.1_4 Reverse -339 -353 -3.54032 0.161
NP_442634.1_4 Forward -251 -237 -3.63866 0.161
NP_442848.1_1 Reverse -275 -289 5.99778 0.0803
NP_442848.1_1 Reverse -335 -349 -2.75368 0.263
NP_442848.1_1 Forward -356 -342 -3.147 0.263
NP_442848.1_1 Forward -290 -276 -4.22864 0.282
NP_442848.1_3 Forward -199 -180 17.5998 0.0326
NP_442848.1_5 Reverse -334 -352 -3.12744 0.29
NP_442848.1_9 Forward -356 -337 6.68596 0.182
NP_443018.1_3 Forward -349 -342 14.8871 0.0123
NP_443018.1_3 Reverse -342 -349 14.8871 0.0123
NP_443018.1_3 Forward -289 -282 5.34899 0.212
NP_443018.1_3 Reverse -282 -289 5.34899 0.212
NP_443018.1_3 Reverse -276 -283 4.36568 0.254
NP_443018.1_3 Forward -283 -276 4.07068 0.299
NP_443018.1_3 Reverse -241 -248 4.07068 0.299
NP_441316.1_7 Forward -352 -337 6.6664 0.107
NP_441634.1_8 Reverse -339 -353 -4.13031 0.295
NP_440376.1_1 Forward -350 -341 19.4693 0.000692
NP_440376.1_1 Reverse -341 -350 19.4693 0.000692
NP_440376.1_1 Forward -378 -369 1.76968 0.242
NP_440376.1_1 Reverse -281 -290 -0.000272808 0.285
NP_440376.1_1 Forward -290 -281 -0.0986038 0.285
NP_441588.1_4 Reverse -343 -353 16.4996 0.0369
NP_441588.1_4 Reverse -242 -252 10.4031 0.14
NP_442687.1_7 Forward -351 -341 15.8113 0.0125
NP_442687.1_7 Reverse -340 -350 9.02648 0.0994
NP_442687.1_7 Reverse -183 -193 6.56821 0.159
NP_442687.1_7 Forward -291 -281 6.07655 0.179
NP_442687.1_7 Forward -250 -240 5.48657 0.2
NP_440042.1_2 Forward -300 -281 1.27776 0.213
NP_440042.1_2 Forward -235 -216 0.982764 0.213
NP_441682.1_2 Forward -242 -223 9.73422 0.181
NP_441422.1_7 Forward -352 -335 15.2801 0.0565
NP_442296.1_9 Forward -356 -337 -3.3438 0.249
NP_442658.1_1 Reverse -339 -349 15.9091 0.00966
NP_442658.1_1 Forward -352 -342 15.9091 0.00966
NP_442658.1_1 Forward -292 -282 9.321 0.161
NP_442782.1_2 Reverse -184 -198 4.91614 0.25
NP_442782.1_2 Reverse -224 -238 2.85119 0.271
NP_442782.1_2 Forward -350 -336 2.45787 0.275
NP_442205.1_9 Reverse -335 -351 1.04184 0.255
NP_441487.1_9 Forward -291 -272 4.916 0.14
NP_442937.1_5 Forward -355 -336 13.4708 0.0906
NP_442937.1_5 Reverse -276 -295 12.6841 0.103
NP_442937.1_5 Reverse -336 -355 8.65258 0.216
NP_442937.1_5 Reverse -330 -349 6.98095 0.265
NP_442321.1_9 Forward -284 -265 14.3558 0.265
NP_441958.1_5 Reverse -340 -350 21.2195 0.000805
NP_441958.1_5 Forward -351 -341 12.2714 0.00183
NP_441958.1_5 Forward -291 -281 0.963343 0.12
NP_441958.1_5 Forward -250 -240 0.275027 0.162
NP_441958.1_5 Reverse -280 -290 -6.41148 0.28
NP_441127.1_1 Reverse -335 -349 7.76774 0.3
NP_442486.1_4 Forward -243 -224 9.53756 0.255
NP_442486.1_6 Forward -296 -277 -5.99873 0.28
NP_442685.1_2 Forward -182 -172 14.828 0.231
NP_440203.1_5 Forward -347 -337 12.7626 0.138
NP_440203.1_5 Forward -287 -277 12.6642 0.141
NP_441097.1_2 Reverse -208 -225 5.54538 0.259
NP_439990.1_5 Reverse -336 -349 9.95071 0.128
NP_442690.1_1 Forward -29 -10 -15.8318 0.28
NP_442911.1_2 Reverse -331 -350 5.60432 0.0325
NP_442911.1_2 Forward -360 -341 4.62101 0.0375
NP_441580.1_6 Reverse -270 -289 -3.73712 0.235
NP_440153.1_5 Forward -349 -335 4.22782 0.199
NP_440153.1_8 Forward -284 -271 -2.63565 0.246
NP_442536.1_7 Forward -356 -337 7.27595 0.273
NP_443055.1_6 Forward -298 -280 1.19838 0.234
NP_443055.1_6 Reverse -216 -234 0.411736 0.243
NP_440993.1_2 Reverse -336 -352 5.86006 0.234
NP_440827.1_3 Forward -355 -336 11.4058 0.268
NP_440138.1_6 Forward -349 -330 1.96529 0.273
NP_441099.1_5 Reverse -271 -290 -8.752 0.203
NP_441099.1_5 Reverse -331 -350 -9.83364 0.234
NP_441099.1_5 Reverse -226 -245 -10.817 0.262
NP_442002.1_9 Forward -351 -344 10.7572 0.185
NP_441654.1_7 Forward -196 -177 12.3396 0.27
NP_441294.1_7 Forward -354 -340 15.4899 0.0239
NP_441294.1_7 Reverse -365 -379 8.48272 0.298
NP_441646.1_1 Forward -357 -338 8.16093 0.147
NP_442438.1_10 Reverse -336 -350 11.996 0.0412
NP_442438.1_10 Forward -355 -341 9.5377 0.0627
NP_442438.1_10 Reverse -276 -290 8.94771 0.0708
NP_442438.1_10 Reverse -235 -249 7.9644 0.0849
NP_440377.1_1 Reverse -8 -25 13.0131 0.249
NP_441000.1_6 Reverse -340 -354 -3.24533 0.221
NP_440605.1_4 Reverse -331 -350 12.9884 0.25
NP_442771.1_1 Forward -352 -334 -6.37237 0.168
NP_442771.1_1 Reverse -339 -357 -7.15901 0.169
NP_442771.1_1 Reverse -30 -48 -10.9939 0.294
NP_440147.1_4 Forward -352 -339 21.4554 0.00117
NP_440147.1_4 Forward -292 -279 3.46087 0.187
NP_440147.1_4 Reverse -339 -352 2.47756 0.208
NP_441550.1_8 Reverse -339 -349 17.4824 0.00754
NP_441550.1_8 Forward -251 -241 9.616 0.0898
NP_441550.1_8 Forward -352 -342 8.3377 0.124
NP_441550.1_8 Reverse -279 -289 7.45273 0.159
NP_441550.1_8 Forward -292 -282 4.89613 0.281
NP_441916.1_7 Forward -350 -340 18.9579 0.00144
NP_441916.1_7 Reverse -341 -351 18.4663 0.00144
NP_441916.1_7 Reverse -240 -250 7.15819 0.0745
NP_440206.1_4 Reverse -331 -350 -0.591301 0.29
NP_440465.1_10 Reverse -338 -357 5.211 0.212
NP_441041.1_4 Reverse -341 -360 -8.85033 0.208
NP_441041.1_4 Reverse -269 -288 -10.817 0.237
NP_441041.1_4 Forward -290 -271 -11.9969 0.256
NP_441041.1_7 Forward -353 -341 18.9817 0.00435
NP_441041.1_7 Reverse -338 -350 14.9975 0.0309
NP_441041.1_7 Forward -293 -281 5.37687 0.26
NP_442996.1_1 Forward -27 -8 8.16414 0.21
NP_442004.1_6 Forward -350 -336 13.8643 0.0811
NP_442004.1_6 Forward -290 -276 10.816 0.136
NP_442004.1_6 Reverse -212 -226 4.22782 0.222
NP_440703.1_9 Reverse -369 -382 12.605 0.192
NP_441725.1_4 Reverse -336 -350 12.2903 0.0693
NP_441725.1_4 Forward -226 -212 9.73373 0.148
NP_441725.1_5 Forward -349 -339 8.92815 0.0553
NP_441725.1_5 Forward -192 -182 7.15819 0.103
NP_441725.1_5 Reverse -342 -352 2.04498 0.115
NP_441725.1_5 Reverse -282 -292 -0.0199663 0.223
NP_441725.1_5 Forward -248 -238 -0.41329 0.251
NP_441725.1_5 Forward -289 -279 -0.708283 0.267
NP_439966.1_7 Reverse -339 -349 13.8442 0.0234
NP_439966.1_7 Forward -352 -342 9.91099 0.0968
NP_439966.1_7 Reverse -279 -289 4.99446 0.248
NP_439966.1_9 Reverse -339 -348 0.983037 0.253
NP_439966.1_9 Forward -352 -343 0.884706 0.253
NP_439966.1_9 Reverse -279 -288 0.884706 0.253
NP_442941.1_3 Forward -349 -339 10.9931 0.0116
NP_442941.1_3 Reverse -342 -352 2.63497 0.14
NP_442941.1_3 Forward -289 -279 1.25834 0.15
NP_442941.1_3 Reverse -241 -251 -1.19994 0.288
NP_440289.1_2 Forward -353 -340 5.82081 0.0605
NP_440289.1_2 Reverse -338 -351 -4.50394 0.288
NP_440983.1_5 Forward -290 -271 -3.83545 0.244
NP_440983.1_5 Forward -287 -268 -7.67036 0.291
NP_440983.1_9 Reverse -332 -351 9.14423 0.202
NP_440260.1_8 Forward -381 -363 -6.37237 0.29
NP_441514.1_4 Reverse -5 -24 13.765 0.26
NP_441678.1_9 Reverse -223 -242 -0.787193 0.235
NP_441678.1_9 Reverse -183 -202 -5.01543 0.297
NP_442281.1_1 Forward -355 -341 19.0751 0.00329
NP_442281.1_1 Reverse -336 -350 13.6669 0.0249
NP_442281.1_1 Reverse -343 -357 2.5556 0.263
NP_441334.1_7 Forward -352 -333 -9.93197 0.12
NP_441079.1_7 Forward -27 -8 5.2102 0.151
NP_441079.1_7 Forward -26 -7 1.47364 0.178
NP_441079.1_7 Reverse -8 -27 -6.98278 0.286
NP_442575.1_9 Reverse -339 -358 13.6675 0.244
NP_442172.1_1 Reverse -7 -26 11.1342 0.259
NP_442012.1_1 Reverse -335 -354 4.916 0.158
NP_442012.1_1 Reverse -275 -294 -0.4922 0.259
NP_442012.1_2 Reverse -279 -298 3.14605 0.239
NP_442012.1_2 Reverse -222 -241 2.85105 0.239
NP_442012.1_5 Forward -357 -338 0.58944 0.288
NP_441457.1_7 Reverse -339 -358 7.47261 0.167
NP_441556.1_10 Reverse -342 -356 9.73513 0.293
NP_441644.1_6 Forward -350 -340 19.0557 0.000803
NP_441644.1_6 Reverse -240 -250 11.7793 0.0432
NP_441644.1_6 Reverse -341 -351 10.1076 0.0628
NP_441644.1_6 Reverse -281 -291 7.64939 0.121
NP_441644.1_6 Forward -290 -280 5.87944 0.174
NP_441644.1_6 Reverse -348 -358 4.99446 0.216
NP_442215.1_2 Forward -352 -336 -0.531451 0.168
NP_442215.1_2 Reverse -339 -355 -1.90808 0.189
NP_442215.1_2 Forward -251 -235 -6.43131 0.271
NP_442177.1_5 Forward -359 -345 7.86607 0.291
NP_442029.1_6 Reverse -219 -238 12.6841 0.151
NP_440253.1_2 Forward -165 -147 3.46073 0.116
NP_440253.1_2 Reverse -341 -359 -3.32411 0.291
NP_440929.1_8 Forward -350 -341 19.2726 0.000701
NP_440929.1_8 Reverse -341 -350 19.2726 0.000701
NP_442933.1_3 Forward -334 -315 15.326 0.267
NP_442933.1_10 Forward -350 -341 17.601 0.00325
NP_442933.1_10 Reverse -341 -350 17.601 0.00325
NP_442933.1_10 Reverse -281 -290 5.40793 0.19
NP_442933.1_10 Reverse -240 -249 4.52295 0.24
NP_442933.1_10 Forward -249 -240 4.12963 0.28
NP_441751.2_8 Forward -349 -335 14.9459 0.0119
NP_441751.2_8 Reverse -342 -356 -2.85201 0.134
NP_441751.2_8 Forward -248 -234 -4.52363 0.174
NP_442926.1_3 Forward -214 -195 1.86774 0.298
NP_442554.1_8 Forward -349 -339 19.1546 0.00369
NP_442554.1_8 Reverse -342 -352 13.2547 0.0187
NP_442554.1_8 Forward -289 -279 8.33817 0.0754
NP_442554.1_8 Reverse -241 -251 5.5849 0.145
NP_442554.1_8 Forward -283 -273 5.19158 0.157
NP_442554.1_8 Forward -232 -222 3.61828 0.218
NP_441762.1_7 Forward -351 -339 11.7404 0.0142
NP_441762.1_7 Reverse -340 -352 10.2654 0.0142
NP_441762.1_7 Forward -291 -279 -5.95921 0.258
NP_441762.1_7 Reverse -280 -292 -7.43418 0.29
NP_442142.1_4 Reverse -338 -351 15.4566 0.0264
NP_442142.1_4 Forward -353 -340 13.195 0.0381
NP_442142.1_4 Forward -293 -280 5.62358 0.187
NP_442142.1_4 Reverse -237 -250 3.55864 0.251
NP_442292.1_1 Forward -349 -340 17.5026 0.00435
NP_442292.1_1 Reverse -342 -351 9.63616 0.0183
NP_442292.1_1 Forward -289 -280 8.75118 0.0306
NP_442292.1_1 Forward -283 -274 4.42462 0.178
NP_442143.1_10 Forward -356 -337 10.9142 0.293
NP_442476.1_6 Forward -289 -275 4.12949 0.149
NP_442381.1_8 Forward -301 -282 -14.1602 0.28
NP_441523.1_6 Reverse -337 -356 8.45592 0.19
NP_443009.1_5 Reverse -340 -351 19.626 0.00102
NP_443009.1_5 Forward -250 -239 10.3829 0.0792
NP_443009.1_5 Forward -351 -340 7.82632 0.118
NP_443009.1_5 Forward -194 -183 4.08976 0.263
NP_441865.1_3 Forward -26 -8 19.9803 0.0644
NP_441715.1_4 Reverse -342 -352 9.41981 0.097
NP_441715.1_4 Forward -349 -339 7.25653 0.108
NP_440357.1_3 Forward -352 -333 -0.983855 0.296
NP_440183.1_9 Reverse -226 -245 -11.2103 0.25
NP_441198.1_8 Reverse -339 -349 15.4199 0.0427
NP_440379.1_5 Reverse -332 -351 -9.73531 0.264
NP_441468.1_1 Forward -349 -342 15.8704 0.0124
NP_441468.1_1 Reverse -342 -349 15.8704 0.0124
NP_441468.1_1 Forward -289 -282 6.13563 0.209
NP_441468.1_1 Reverse -282 -289 6.0373 0.223
NP_441468.1_1 Reverse -276 -283 4.46401 0.224
NP_441468.1_1 Reverse -241 -248 4.07068 0.263
NP_441020.2_6 Reverse -339 -356 11.2486 0.124
NP_441020.2_6 Forward -352 -335 8.59364 0.195
NP_441015.1_10 Reverse -270 -289 5.30933 0.115
NP_441015.1_10 Reverse -336 -355 4.22769 0.127
NP_441015.1_10 Reverse -276 -295 -9.73531 0.282
NP_441015.1_10 Reverse -219 -238 -9.83364 0.282
NP_441673.1_1 Forward -350 -341 20.8459 0.000698
NP_441673.1_1 Reverse -341 -350 20.8459 0.000698
NP_441673.1_1 Forward -290 -281 1.27803 0.155
NP_441673.1_1 Reverse -281 -290 1.27803 0.155
NP_441956.1_9 Reverse -274 -293 4.42435 0.277
NP_441826.1_2 Reverse -335 -349 6.98109 0.0899
NP_441826.1_2 Forward -356 -342 5.01447 0.0978
NP_441826.1_2 Forward -290 -276 -0.197071 0.204
NP_441330.1_1 Reverse -336 -355 -2.75381 0.0791
NP_441330.1_2 Reverse -321 -340 4.12936 0.293
NP_442490.1_9 Forward -261 -242 2.0644 0.165
NP_441764.1_8 Reverse -4 -14 12.4592 0.284
NP_442868.1_6 Reverse -339 -349 8.63316 0.0555
NP_442868.1_6 Reverse -279 -289 7.64985 0.0726
NP_442868.1_6 Forward -352 -342 0.865012 0.205
NP_442868.1_6 Forward -286 -276 0.57002 0.217
NP_441251.1_8 Forward -328 -315 14.4811 0.254
NP_441056.1_1 Forward -290 -271 -4.03212 0.246
NP_441612.1_2 Forward -72 -62 8.83972 0.21
NP_442361.1_3 Forward -356 -343 7.49244 0.3
NP_442808.1_1 Forward -351 -341 18.4657 0.00201
NP_442808.1_1 Reverse -340 -350 8.73102 0.0481
NP_442808.1_1 Forward -291 -281 7.84605 0.0668
NP_442775.1_6 Reverse -336 -355 15.0441 0.236
NP_440145.1_3 Reverse -331 -350 2.16274 0.12
NP_440145.1_3 Reverse -271 -290 -0.688862 0.143
NP_442050.1_5 Reverse -339 -349 17.1874 0.00812
NP_442342.1_9 Forward -352 -336 8.02334 0.194
NP_442342.1_9 Reverse -339 -355 5.17175 0.241
NP_440346.1_6 Forward -185 -175 13.7586 0.291
NP_441114.1_3 Forward -191 -182 7.57121 0.231
NP_440558.1_2 Reverse -338 -357 -0.4922 0.203
NP_441878.1_6 Reverse -340 -350 10.5014 0.0176
NP_441878.1_6 Forward -351 -341 10.4031 0.0176
NP_441878.1_6 Reverse -239 -249 1.74999 0.0642
NP_441878.1_6 Forward -291 -281 0.668351 0.139
NP_441878.1_6 Reverse -183 -193 -7.59145 0.245
NP_441036.1_8 Forward -351 -341 17.7779 0.000554
NP_441036.1_8 Reverse -340 -350 15.713 0.00724
NP_442650.1_2 Forward -290 -276 10.226 0.13
NP_442650.1_2 Forward -350 -336 7.07942 0.13
NP_441557.1_5 Forward -350 -341 19.9609 0.000699
NP_441557.1_5 Reverse -341 -350 19.9609 0.000699
NP_441557.1_5 Reverse -281 -290 0.983037 0.0911
NP_441557.1_5 Forward -290 -281 0.688044 0.128
NP_441557.1_5 Forward -249 -240 -0.983583 0.272
NP_441445.1_1 Reverse -272 -291 5.60432 0.166
NP_441445.1_1 Reverse -332 -351 0.491109 0.275
NP_442066.2_4 Forward -350 -331 1.57275 0.151
NP_442419.1_2 Reverse -336 -355 -4.91709 0.295
NP_441308.1_8 Reverse -339 -349 12.4681 0.218
NP_440101.1_3 Reverse -336 -355 11.6025 0.0998
NP_440101.1_10 Forward -356 -337 15.8307 0.126
NP_441564.1_10 Reverse -321 -340 9.93088 0.146
NP_442183.1_1 Forward -350 -336 15.4376 0.021
NP_442183.1_1 Reverse -341 -355 10.1277 0.0888
NP_440676.1_3 Forward -347 -328 25.2705 0.00543
NP_441116.1_9 Reverse -17 -31 14.8476 0.229
NP_441574.1_1 Forward -261 -242 3.04771 0.151
NP_441574.1_1 Forward -350 -331 -2.45882 0.226
NP_441574.1_1 Reverse -269 -288 -4.52377 0.252
NP_442444.1_6 Reverse -51 -69 12.1468 0.289
NP_441638.1_4 Reverse -186 -205 17.109 0.101
NP_442347.1_2 Reverse -342 -351 11.1111 0.056
NP_442347.1_2 Forward -289 -280 3.93297 0.284
NP_442347.1_2 Forward -349 -340 3.34298 0.284
NP_442645.1_2 Reverse -333 -352 -14.1602 0.171
NP_442645.1_2 Reverse -273 -292 -20.3551 0.288
NP_442645.1_2 Reverse -339 -358 -21.24 0.29
NP_441037.1_4 Reverse -339 -349 16.5761 0.0168
NP_441037.1_4 Forward -352 -342 14.7245 0.028
NP_441037.1_4 Reverse -279 -289 8.48718 0.237
NP_441037.1_4 Reverse -346 -356 7.22024 0.237
NP_441037.1_4 Reverse -139 -149 5.95329 0.289
NP_441633.1_3 Forward -352 -339 13.0973 0.018
NP_441633.1_3 Reverse -339 -352 -5.78224 0.236
NP_441633.1_3 Forward -43 -30 -6.47056 0.253
NP_440136.1_2 Forward -349 -342 15.9687 0.0123
NP_440136.1_2 Reverse -342 -349 15.9687 0.0123
NP_440136.1_2 Forward -289 -282 6.23397 0.171
NP_440136.1_2 Reverse -282 -289 6.13563 0.193
NP_442590.1_10 Reverse -341 -360 6.78429 0.237
NP_442998.1_5 Forward -228 -218 12.8614 0.158
NP_442998.1_5 Reverse -4 -14 9.61647 0.238
NP_442998.1_10 Forward -348 -341 15.5754 0.0102
NP_442998.1_10 Reverse -343 -350 15.5754 0.0102
NP_442998.1_10 Forward -288 -281 15.5754 0.0102
NP_440299.1_1 Reverse -337 -350 12.7034 0.0356
NP_440299.1_1 Forward -354 -341 11.9167 0.0427
NP_440299.1_1 Reverse -277 -290 7.09854 0.121
NP_441799.1_1 Reverse -337 -351 9.34041 0.0942
NP_441799.1_1 Forward -354 -340 6.68548 0.165
NP_441799.1_1 Forward -294 -280 4.03056 0.269
NP_441007.1_10 Reverse -336 -349 13.0973 0.0499
NP_441007.1_10 Reverse -270 -283 10.5407 0.0656
NP_441007.1_10 Reverse -276 -289 8.57408 0.112
NP_441007.1_10 Forward -266 -253 0.215946 0.241
NP_442201.1_10 Forward -361 -342 -14.3569 0.281
NP_440256.1_1 Reverse -338 -357 0.884433 0.0791
NP_440087.1_1 Reverse -272 -291 -5.70374 0.249
NP_441512.1_4 Reverse -337 -356 11.4058 0.237
NP_441559.1_8 Reverse -336 -350 1.27789 0.156
NP_441559.1_8 Forward -238 -224 0.88457 0.16
NP_441559.1_8 Forward -383 -369 -5.80194 0.27
NP_441559.1_8 Forward -355 -341 -6.29359 0.276
NP_440915.1_6 Forward -354 -340 15.3392 0.0183
NP_440915.1_6 Reverse -337 -351 13.3726 0.0187
NP_440915.1_6 Reverse -277 -291 2.94952 0.11
NP_440915.1_6 Reverse -236 -250 -0.0987402 0.182
NP_442069.1_7 Forward -161 -142 9.53674 0.291
NP_442866.1_1 Forward -384 -365 -9.24366 0.292
NP_441838.1_1 Reverse -49 -68 13.1758 0.213
NP_440695.1_5 Reverse -269 -288 6.68596 0.15
NP_440695.1_5 Reverse -281 -300 -0.197208 0.284
NP_441939.1_3 Reverse -342 -361 13.1758 0.0913
NP_441939.1_3 Forward -349 -330 12.8808 0.0961
NP_441199.1_6 Forward -354 -335 17.3057 0.0257
NP_441199.1_6 Reverse -337 -356 6.19431 0.138
NP_441494.1_6 Reverse -336 -349 18.6038 0.059
NP_439985.1_7 Reverse -212 -231 4.32602 0.238
NP_442957.1_4 Reverse -255 -274 17.0107 0.139
NP_441417.1_8 Reverse -18 -37 10.3242 0.282
NP_442993.1_1 Reverse -341 -357 0.845183 0.0609
NP_442993.1_1 Forward -350 -334 -10.5612 0.222
NP_442386.1_9 Forward -351 -342 15.7322 0.0144
NP_442386.1_9 Reverse -223 -232 8.2591 0.205
NP_442386.1_9 Reverse -347 -356 7.07914 0.219
NP_442386.1_9 Reverse -340 -349 6.39082 0.219
NP_442386.1_9 Forward -285 -276 5.11253 0.266
NP_441340.1_5 Forward -349 -342 15.6737 0.0124
NP_441340.1_5 Reverse -342 -349 15.6737 0.0124
NP_441340.1_5 Reverse -282 -289 6.13563 0.175
NP_441340.1_5 Forward -289 -282 5.93897 0.198
NP_441340.1_5 Forward -283 -276 3.97235 0.274
NP_441340.1_9 Reverse -4 -14 8.25522 0.256
NP_441947.1_10 Forward -352 -334 3.26407 0.276
NP_442240.1_2 Reverse -185 -204 -0.39387 0.0609
NP_442240.1_2 Forward -349 -330 -12.9802 0.163
NP_440161.1_3 Forward -195 -176 10.0292 0.235
NP_440586.1_1 Reverse -271 -290 -0.197208 0.237
NP_440586.1_8 Forward -349 -342 13.2151 0.026
NP_440586.1_8 Reverse -342 -349 13.2151 0.026
NP_440586.1_8 Reverse -282 -289 11.4451 0.0645
NP_440586.1_8 Reverse -241 -248 7.41359 0.251
NP_442251.1_6 Forward -349 -342 15.2804 0.0124
NP_442251.1_6 Reverse -342 -349 15.2804 0.0124
NP_442251.1_6 Forward -289 -282 12.0355 0.0627
NP_442959.1_4 Reverse -219 -238 11.5042 0.216
NP_442959.1_5 Reverse -7 -26 13.3725 0.222
NP_442959.1_5 Reverse -6 -25 7.27595 0.238
NP_440684.1_9 Forward -356 -342 18.2892 0.0378
NP_441262.1_3 Reverse -341 -348 14.7888 0.0223
NP_441262.1_3 Reverse -281 -288 14.7888 0.0223
NP_441262.1_3 Forward -350 -343 14.7888 0.0223
NP_440027.1_3 Forward -290 -272 11.2281 0.159
NP_440027.1_8 Forward -353 -334 8.55343 0.246
NP_443051.1_1 Reverse -340 -349 19.5676 0.00335
NP_443051.1_1 Forward -351 -342 10.4228 0.00754
NP_443051.1_1 Reverse -280 -289 0.786375 0.125
NP_443051.1_1 Forward -250 -241 -0.0986038 0.256
NP_443051.1_1 Forward -291 -282 -1.08191 0.281
NP_439937.1_8 Forward -352 -333 2.3594 0.216
NP_439937.1_9 Forward -291 -274 0.136476 0.105
NP_439937.1_9 Forward -351 -334 -8.41828 0.176
NP_440836.1_6 Forward -381 -367 12.4876 0.214
NP_440408.1_10 Reverse -335 -354 8.35759 0.176
NP_440408.1_10 Forward -356 -337 6.19431 0.238
NP_440439.1_1 Reverse -338 -351 17.5222 0.0105
NP_440439.1_1 Forward -353 -340 1.10092 0.162
NP_440372.1_2 Forward -349 -342 16.3621 0.0124
NP_440372.1_2 Reverse -342 -349 16.3621 0.0124
NP_440372.1_2 Reverse -282 -289 6.72562 0.0929
NP_440372.1_2 Forward -289 -282 6.62729 0.151
NP_442285.1_1 Reverse -195 -214 3.04771 0.287
NP_440378.1_7 Forward -227 -208 14.3558 0.166
NP_440819.1_5 Reverse -4 -12 7.68924 0.266
NP_441803.1_2 Reverse -336 -355 24.7789 0.00231
NP_441803.1_2 Forward -355 -336 -1.18052 0.294
NP_439977.1_5 Forward -356 -337 5.89931 0.141
NP_439977.1_5 Reverse -335 -354 -1.47551 0.253
NP_441572.1_7 Reverse -335 -354 -1.7705 0.19
NP_442384.1_10 Forward -350 -337 9.36073 0.054
NP_442384.1_10 Reverse -240 -253 9.36073 0.054
NP_442384.1_10 Reverse -341 -354 8.37742 0.0656
NP_442384.1_10 Forward -290 -277 0.510939 0.289
NP_440948.1_6 Reverse -220 -239 16.6174 0.287
NP_442114.1_4 Forward -290 -279 8.02348 0.227
NP_441877.1_7 Forward -355 -336 1.17865 0.242
NP_441018.1_7 Forward -253 -234 7.37428 0.272
NP_442790.1_4 Forward -359 -340 -6.68705 0.144
NP_442790.1_4 Reverse -332 -351 -9.63698 0.19
NP_442262.1_10 Forward -349 -342 14.1988 0.0123
NP_442262.1_10 Reverse -342 -349 14.1988 0.0123
NP_441689.1_5 Reverse -339 -349 8.43603 0.132
NP_441689.1_5 Forward -223 -213 5.48612 0.251
NP_440344.1_10 Forward -357 -340 11.5436 0.006
NP_440344.1_10 Reverse -334 -351 0.235503 0.0365
NP_440344.1_10 Forward -297 -280 -11.8592 0.231
NP_440531.1_6 Forward -241 -222 -3.3438 0.265
NP_440531.1_6 Reverse -333 -352 -4.52377 0.282
NP_441965.1_3 Reverse -271 -290 8.45592 0.121
NP_441965.1_7 Forward -158 -139 15.1416 0.239
NP_441640.1_8 Reverse -276 -295 -5.9004 0.292
NP_442529.1_4 Forward -359 -340 13.7658 0.175
NP_440297.1_9 Forward -192 -182 7.05986 0.15
NP_440297.1_9 Forward -248 -238 0.963343 0.282
NP_440297.1_9 Reverse -342 -352 -0.118297 0.282
NP_440297.1_9 Forward -349 -339 -0.314959 0.282
NP_442187.1_3 Reverse -280 -290 16.893 0.0619
NP_442280.1_10 Forward -237 -219 7.79204 0.268
NP_441896.1_3 Forward -359 -340 -0.590531 0.241
NP_440894.1_10 Forward -295 -276 14.0608 0.102
NP_440894.1_10 Forward -355 -336 11.0125 0.151
NP_440894.1_10 Reverse -336 -355 3.34271 0.274
NP_441679.1_1 Reverse -266 -285 -5.01543 0.243
NP_442067.1_4 Reverse -330 -349 2.94938 0.289
NP_440999.1_9 Forward -354 -340 11.5043 0.0447
NP_440999.1_9 Reverse -337 -351 3.93283 0.12
NP_440888.1_2 Forward -350 -336 15.9285 0.00837
NP_440888.1_2 Reverse -341 -355 10.3237 0.0974
NP_440888.1_2 Forward -290 -276 8.3571 0.163
NP_440600.1_1 Forward -30 -11 14.4666 0.207
NP_440491.1_1 Reverse -338 -357 9.64582 0.206
NP_440052.1_5 Reverse -270 -289 -2.65548 0.214
NP_442277.1_4 Forward -359 -340 6.68515 0.157
NP_442033.1_10 Forward -352 -333 -7.08038 0.186
NP_442033.1_10 Forward -292 -273 -8.65367 0.205
NP_442512.1_4 Reverse -179 -197 7.4923 0.278
NP_441543.1_2 Reverse -342 -351 18.486 0.00236
NP_441543.1_2 Forward -349 -340 15.9293 0.00518
NP_441543.1_2 Forward -289 -280 7.17789 0.131
NP_442845.1_2 Reverse -335 -349 15.7325 0.0694
NP_442845.1_2 Forward -356 -342 6.98109 0.199
NP_442845.1_2 Reverse -275 -289 6.78443 0.202
NP_442845.1_2 Forward -249 -235 3.34284 0.294
NP_441469.1_8 Forward -351 -342 16.126 0.00797
NP_441469.1_8 Reverse -340 -349 6.5879 0.227
NP_442637.1_3 Forward -269 -250 3.24438 0.202
NP_443064.1_6 Forward -350 -340 10.8217 0.13
NP_443064.1_6 Forward -290 -280 8.39772 0.292
NP_442337.1_8 Forward -389 -370 5.70265 0.21
NP_442337.1_8 Reverse -207 -226 1.0811 0.241
NP_442578.1_7 Forward -349 -342 14.5921 0.026
NP_442578.1_7 Reverse -342 -349 14.5921 0.026
NP_442578.1_7 Reverse -282 -289 5.93897 0.183
NP_440710.1_1 Forward -201 -183 -1.25915 0.179
NP_441462.1_2 Forward -350 -340 20.2362 0.000805
NP_441462.1_2 Reverse -341 -351 11.5831 0.00406
NP_441462.1_2 Reverse -281 -291 8.4365 0.0363
NP_441462.1_2 Forward -249 -239 -0.511621 0.236
NP_441621.1_7 Forward -352 -338 13.9626 0.0266
NP_441621.1_7 Reverse -339 -353 -3.24533 0.188
NP_443062.1_1 Forward -350 -332 7.86337 0.166
NP_443062.1_1 Reverse -341 -359 5.5232 0.227
NP_443062.1_6 Forward -358 -339 1.57275 0.272
NP_442204.1_1 Reverse -337 -348 11.9567 0.0565
NP_442204.1_1 Forward -270 -259 3.30359 0.266
NP_442204.1_1 Reverse -277 -288 0.648657 0.281
NP_442204.1_2 Forward -360 -341 5.89931 0.292
NP_442204.1_5 Forward -360 -341 4.03102 0.179
NP_441560.1_8 Reverse -336 -355 12.6814 0.248
NP_441351.1_8 Reverse -339 -358 5.80098 0.202
NP_442487.1_3 Reverse -276 -295 17.0107 0.19
NP_440516.1_8 Reverse -281 -290 17.6993 0.00442
NP_440516.1_8 Forward -350 -341 16.9127 0.00442
NP_440516.1_8 Reverse -341 -350 16.9127 0.00442
NP_442428.1_5 Forward -349 -342 15.8704 0.0124
NP_442428.1_5 Reverse -342 -349 15.8704 0.0124
NP_442428.1_5 Forward -289 -282 6.13563 0.209
NP_442428.1_5 Reverse -282 -289 6.0373 0.212
NP_442428.1_5 Reverse -276 -283 4.759 0.223
NP_442428.1_5 Reverse -241 -248 4.56234 0.249
NP_440783.1_8 Reverse -207 -226 8.16011 0.229
NP_442859.1_2 Forward -349 -330 6.39097 0.199
NP_442859.1_2 Reverse -185 -204 2.65439 0.272
NP_442120.1_10 Forward -356 -337 5.99764 0.141
NP_442823.1_8 Reverse -336 -355 13.1758 0.259
NP_440673.1_2 Reverse -271 -290 13.9015 0.103
NP_440673.1_2 Reverse -16 -35 8.5361 0.266
NP_440673.1_3 Forward -348 -341 12.4288 0.0426
NP_440673.1_3 Forward -288 -281 12.4288 0.0426
NP_440673.1_3 Reverse -343 -350 12.4288 0.0426
NP_440673.1_3 Forward -247 -240 10.9539 0.106
NP_440673.1_3 Forward -191 -184 8.98723 0.203
NP_441714.1_3 Reverse -334 -352 15.358 0.15
NP_440865.1_7 Forward -358 -339 15.9291 0.286
NP_440865.1_9 Reverse -335 -354 0.491109 0.138
NP_440865.1_9 Forward -356 -337 -5.01543 0.209
NP_441052.1_2 Forward -290 -280 10.7964 0.0285
NP_441052.1_2 Reverse -341 -351 10.5014 0.0285
NP_441052.1_2 Forward -350 -340 10.4031 0.0285
NP_441052.1_2 Forward -243 -233 2.7333 0.193
NP_440992.1_2 Reverse -336 -355 9.3409 0.273
NP_442219.1_8 Forward -160 -141 9.03681 0.234
NP_442219.1_9 Reverse -342 -351 8.35786 0.0681
NP_442219.1_9 Forward -349 -340 8.25953 0.0681
NP_442219.1_9 Forward -289 -280 8.06287 0.0696
NP_440436.1_4 Reverse -342 -351 18.1905 0.00233
NP_440436.1_4 Forward -289 -280 13.9623 0.0193
NP_440436.1_4 Forward -349 -340 9.24241 0.0871
NP_440436.1_4 Forward -192 -183 6.48915 0.157
NP_441884.1_8 Forward -351 -332 -0.983855 0.138
NP_441884.1_9 Forward -353 -334 -22.715 0.284
NP_442086.1_6 Reverse -329 -348 10.4225 0.255
NP_442864.1_2 Forward -289 -270 14.2574 0.226
NP_440314.1_9 Forward -289 -270 8.16093 0.0406
NP_442907.1_2 Forward -289 -271 12.3105 0.181
NP_442907.1_9 Reverse -235 -254 -5.21209 0.282
NP_442907.1_9 Reverse -336 -355 -7.17871 0.294
NP_442577.1_9 Reverse -365 -379 10.3237 0.282
NP_441719.1_4 Forward -349 -342 16.3621 0.0124
NP_441719.1_4 Reverse -342 -349 16.3621 0.0124
NP_441719.1_4 Reverse -282 -289 6.72562 0.093
NP_441719.1_4 Forward -289 -282 6.62729 0.151
NP_441733.1_10 Reverse -338 -351 15.6539 0.0564
NP_441004.1_1 Reverse -335 -354 -8.16202 0.2
NP_441004.1_1 Forward -356 -337 -11.9969 0.243
NP_441004.1_1 Reverse -323 -342 -18.2901 0.299
NP_441004.1_2 Reverse -173 -192 -1.18052 0.259
NP_441004.1_4 Reverse -181 -191 10.1081 0.254
NP_442813.1_5 Forward -382 -363 1.0811 0.296
NP_442366.1_3 Reverse -340 -358 9.0656 0.0584
NP_442366.1_3 Forward -351 -333 6.60732 0.0776
NP_442366.1_5 Forward -353 -343 12.7626 0.108
NP_441034.1_4 Reverse -336 -355 17.6426 0.1
NP_440129.1_10 Forward -285 -271 5.99778 0.185
NP_440296.1_10 Reverse -237 -256 -14.7502 0.273
NP_441115.1_4 Forward -351 -333 13.0964 0.0883
NP_441115.1_4 Reverse -340 -358 13.0964 0.0883
NP_442694.1_6 Forward -357 -338 19.5296 0.285
NP_440328.1_4 Forward -356 -337 10.7175 0.0825
NP_443054.1_2 Reverse -339 -353 11.3077 0.0761
NP_442430.1_10 Reverse -331 -350 10.3234 0.262
NP_442430.1_10 Forward -360 -341 9.93006 0.277
NP_442308.1_4 Reverse -335 -354 1.47442 0.267
NP_441851.1_10 Forward -351 -341 16.008 0.00552
NP_441851.1_10 Reverse -340 -350 8.53483 0.114
NP_442011.1_1 Forward -351 -332 -1.96717 0.271
NP_442515.1_1 Reverse -31 -45 2.16287 0.141
NP_442515.1_1 Reverse -280 -294 -2.85201 0.281
NP_440593.1_3 Forward -355 -336 5.30933 0.124
NP_440593.1_3 Reverse -336 -355 -1.27885 0.211
NP_440165.1_5 Forward -351 -332 -1.18052 0.185
NP_441046.1_2 Reverse -270 -289 -1.27885 0.288
NP_442689.1_8 Forward -334 -317 -4.68105 0.267
NP_441349.1_10 Reverse -331 -350 -8.16202 0.269
NP_441349.1_10 Reverse -230 -249 -8.752 0.278
NP_441409.1_6 Forward -296 -277 -15.4385 0.295
NP_440474.1_8 Reverse -342 -356 4.03056 0.294
NP_440431.1_3 Forward -194 -175 11.0125 0.0495
NP_440431.1_3 Reverse -340 -359 -10.4236 0.275
NP_442450.1_5 Forward -292 -282 8.33817 0.13
NP_442450.1_5 Forward -352 -342 7.55152 0.13
NP_442450.1_5 Reverse -196 -206 5.5849 0.237
NP_440588.1_2 Reverse -332 -351 -0.983855 0.155
NP_440588.1_3 Forward -373 -354 11.3075 0.248
NP_442243.1_1 Reverse -275 -293 -1.55487 0.279
NP_441570.1_1 Forward -350 -332 -8.63398 0.117
NP_440078.1_4 Forward -361 -342 13.3725 0.19
NP_441078.1_4 Forward -350 -341 19.6659 0.0007
NP_441078.1_4 Reverse -341 -350 19.6659 0.0007
NP_441078.1_4 Reverse -281 -290 0.0980582 0.205
NP_441078.1_4 Forward -290 -281 0.0980582 0.205
NP_441078.1_4 Reverse -240 -249 -1.86856 0.272
NP_442729.1_5 Reverse -280 -290 8.1415 0.248
NP_442443.1_1 Reverse -333 -352 3.44104 0.171
NP_440526.1_3 Forward -349 -338 9.3996 0.0876
NP_440526.1_3 Forward -289 -278 7.82632 0.131
NP_440526.1_3 Reverse -342 -353 2.02482 0.267
NP_441432.1_8 Reverse -340 -349 16.8143 0.00595
NP_441432.1_8 Forward -351 -342 8.25953 0.0755
NP_441432.1_8 Reverse -280 -289 7.17789 0.102
NP_441432.1_8 Forward -357 -348 2.75299 0.287
NP_441432.1_9 Reverse -13 -26 17.7123 0.0625
NP_442320.1_8 Forward -356 -342 7.57108 0.019
NP_442320.1_8 Reverse -275 -289 6.6861 0.0257
NP_442320.1_8 Reverse -335 -349 -0.885388 0.0817
NP_442344.1_7 Reverse -342 -361 -6.88371 0.172
NP_441732.1_2 Reverse -337 -353 -6.43131 0.0495
NP_441732.1_2 Forward -354 -338 -6.52964 0.0495
NP_441732.1_2 Forward -294 -278 -16.6577 0.186
NP_440760.1_1 Reverse -341 -360 -11.4069 0.0851
NP_440760.1_1 Forward -350 -331 -12.0953 0.091
NP_442797.1_6 Forward -303 -284 14.6242 0.171
NP_442797.1_7 Forward -291 -273 2.47742 0.239
NP_441805.1_2 Reverse -264 -283 7.07928 0.0669
NP_440713.1_4 Reverse -331 -350 10.6192 0.123
NP_440713.1_4 Reverse -230 -249 2.45773 0.262
NP_442489.1_7 Forward -350 -341 20.1576 0.000695
NP_442489.1_7 Reverse -341 -350 20.1576 0.000695
NP_442489.1_7 Forward -290 -281 0.786375 0.152
NP_442489.1_7 Reverse -281 -290 0.589713 0.17
NP_442489.1_7 Reverse -240 -249 -1.57357 0.213
NP_440559.1_1 Forward -289 -280 14.1594 0.0317
NP_440559.1_1 Reverse -342 -351 8.75118 0.0586
NP_440559.1_1 Forward -349 -340 8.65285 0.0586
NP_441659.2_8 Forward -350 -340 20.9245 0.000805
NP_441659.2_8 Reverse -341 -351 11.9764 0.0147
NP_441659.2_8 Reverse -281 -291 6.46988 0.0744
NP_441659.2_8 Forward -284 -274 3.02829 0.177
NP_440786.1_9 Reverse -316 -335 22.6156 0.0382
NP_442749.1_5 Reverse -9 -26 14.2973 0.159
NP_442913.1_9 Forward -356 -337 12.3892 0.185
NP_442008.1_2 Reverse -338 -357 3.73603 0.249
NP_442346.1_5 Reverse -340 -350 16.303 0.00248
NP_442346.1_5 Reverse -183 -193 12.5664 0.0394
NP_442346.1_5 Reverse -239 -249 11.6814 0.0606
NP_442346.1_5 Forward -250 -240 10.2065 0.103
NP_442346.1_5 Forward -351 -341 9.02648 0.118
NP_442346.1_5 Reverse -31 -41 7.55152 0.165
NP_442346.1_5 Reverse -280 -290 6.8632 0.188
NP_442346.1_5 Forward -285 -275 6.56821 0.198
NP_442346.1_5 Reverse -223 -233 4.89658 0.269
NP_442346.1_5 Forward -291 -281 4.40493 0.29
NP_440545.1_3 Reverse -337 -354 8.39697 0.0444
NP_440545.1_3 Forward -354 -337 7.80699 0.0482
NP_440545.1_3 Forward -288 -271 2.10379 0.106
NP_440545.1_3 Reverse -271 -288 -5.95935 0.265
NP_440545.1_4 Forward -297 -278 18.879 0.184
NP_440486.1_9 Forward -237 -223 16.5192 0.179
NP_441653.1_2 Forward -361 -342 3.72288 0.264
NP_440010.1_4 Reverse -331 -350 5.60352 0.199
NP_442603.1_7 Reverse -206 -220 6.58715 0.236
NP_441233.1_2 Reverse -270 -289 14.9458 0.162
NP_441888.1_7 Forward -355 -341 2.5562 0.225
NP_441050.1_5 Reverse -180 -198 9.36059 0.143
NP_440449.1_6 Forward -358 -340 17.1068 0.0724
NP_440449.1_6 Reverse -333 -351 5.82426 0.268
NP_441502.1_3 Reverse -339 -358 5.01433 0.299
NP_441833.1_4 Forward -349 -342 15.9687 0.0124
NP_441833.1_4 Reverse -342 -349 15.9687 0.0124
NP_441833.1_4 Forward -289 -282 14.1004 0.0258
NP_441833.1_4 Reverse -282 -289 6.13563 0.198
NP_442162.1_9 Forward -349 -342 16.2637 0.0124
NP_442162.1_9 Reverse -342 -349 16.2637 0.0124
NP_442162.1_9 Forward -289 -282 6.62729 0.142
NP_442162.1_9 Reverse -282 -289 6.52896 0.178
NP_440671.1_4 Reverse -335 -349 11.701 0.127
NP_440671.1_4 Forward -356 -342 11.406 0.133
NP_440671.1_4 Reverse -234 -248 6.3911 0.248
NP_442821.1_7 Reverse -212 -231 17.699 0.274
NP_442943.1_1 Forward -110 -95 5.97674 0.21
NP_442943.1_1 Reverse -319 -334 5.2111 0.211
NP_442199.1_5 Reverse -333 -352 0.0977854 0.174
NP_442199.1_5 Forward -358 -339 -1.96717 0.184
NP_442199.1_5 Reverse -216 -235 -5.9004 0.255
NP_442140.1_3 Reverse -342 -352 16.2046 0.0255
NP_442140.1_3 Reverse -282 -292 13.8447 0.0542
NP_442140.1_3 Forward -349 -339 7.94484 0.124
NP_442140.1_3 Forward -289 -279 4.10993 0.261
NP_442021.1_3 Forward -356 -337 13.0775 0.0395
NP_442021.1_3 Forward -267 -248 0.687771 0.206
NP_440875.1_9 Forward -348 -338 17.5217 0.0116
NP_440875.1_9 Reverse -343 -353 8.46937 0.233
NP_442547.1_7 Forward -360 -341 12.8504 0.21
NP_441813.1_5 Forward -352 -342 9.91146 0.021
NP_441813.1_5 Reverse -339 -349 8.73149 0.0367
NP_441813.1_5 Forward -292 -282 -0.708283 0.272
NP_439901.1_1 Forward -234 -215 1.67108 0.289
NP_442089.1_6 Forward -350 -331 10.9142 0.126
NP_440590.1_4 Reverse -342 -355 19.8821 0.0064
NP_440590.1_4 Forward -289 -276 18.5055 0.00811
NP_440590.1_4 Forward -349 -336 4.44418 0.0601
NP_440590.1_4 Forward -356 -343 -1.45568 0.22
NP_440590.1_4 Reverse -229 -242 -4.30728 0.26
NP_440567.1_1 Forward -349 -335 16.3225 0.0166
NP_440567.1_1 Reverse -342 -356 14.1593 0.019
NP_440567.1_1 Forward -289 -275 10.7177 0.033
NP_442497.1_10 Forward -349 -340 17.601 0.00813
NP_442497.1_10 Reverse -342 -351 10.4228 0.0087
NP_442497.1_10 Reverse -282 -291 0.983037 0.123
NP_442497.1_10 Forward -289 -280 0.688044 0.141
NP_440821.1_1 Forward -370 -351 19.1731 0.0601
NP_440821.1_4 Reverse -339 -349 10.7964 0.0146
NP_440821.1_4 Forward -352 -342 10.2065 0.0163
NP_440821.1_4 Reverse -279 -289 8.1415 0.055
NP_440927.1_4 Forward -341 -322 14.6508 0.247
NP_441239.1_9 Reverse -339 -351 17.4436 0.0146
NP_441239.1_9 Forward -352 -340 12.3303 0.0477
NP_441239.1_9 Forward -235 -223 3.67722 0.279
NP_441239.1_9 Forward -347 -335 3.18557 0.292
NP_441727.1_3 Forward -357 -338 4.81767 0.262
NP_441892.1_1 Reverse -332 -349 22.065 0.0156
NP_441892.1_1 Forward -359 -342 6.82368 0.0931
NP_441892.1_1 Reverse -231 -248 -1.73112 0.212
NP_440604.1_6 Forward -249 -230 -1.37718 0.202
NP_440604.1_6 Forward -350 -331 -5.99873 0.289
NP_442193.1_1 Reverse -183 -201 11.1305 0.228
NP_442193.1_1 Reverse -17 -35 10.7372 0.228
NP_442193.1_8 Forward -246 -227 13.8633 0.211
NP_442193.1_8 Reverse -215 -234 12.1917 0.234
NP_441508.1_4 Reverse -289 -303 14.0489 0.287
NP_442643.1_1 Forward -356 -337 -10.817 0.231
NP_442643.1_5 Reverse -186 -205 -4.91709 0.293
NP_440612.1_1 Forward -194 -175 10.4225 0.29
NP_441874.1_1 Reverse -22 -36 10.521 0.261
NP_440212.1_5 Forward -295 -276 15.6341 0.218
NP_440354.1_5 Forward -353 -334 4.22769 0.217
NP_440354.1_7 Reverse -335 -353 6.41066 0.283
NP_440354.1_7 Reverse -275 -293 5.72234 0.297
NP_441782.1_10 Reverse -333 -347 15.3688 0.23
NP_440546.1_4 Forward -350 -340 13.5365 0.0459
NP_440546.1_4 Reverse -281 -291 11.9852 0.0679
NP_440546.1_4 Reverse -341 -351 11.8882 0.0679
NP_440546.1_4 Forward -261 -251 6.65249 0.288
NP_441230.1_5 Reverse -336 -355 6.78429 0.17
NP_441230.1_5 Forward -355 -336 5.60432 0.182
NP_440462.1_6 Reverse -339 -349 19.4496 0.00371
NP_440462.1_6 Forward -352 -342 9.02648 0.0498
NP_440868.1_4 Reverse -337 -349 7.4138 0.0691
NP_440868.1_4 Forward -354 -342 1.7106 0.174
NP_440868.1_4 Reverse -277 -289 0.333971 0.217
NP_442499.1_3 Forward -351 -333 5.42735 0.282
NP_442787.1_9 Reverse -177 -196 16.9124 0.208
NP_442479.1_9 Reverse -216 -235 -10.227 0.266
NP_441848.1_4 Reverse -10 -26 10.3199 0.257
NP_441084.1_6 Reverse -339 -353 13.0285 0.146
NP_440653.1_10 Forward -232 -213 5.80098 0.22
NP_440843.1_8 Forward -356 -337 12.2908 0.297
NP_442039.1_4 Forward -349 -342 15.1821 0.0124
NP_442039.1_4 Reverse -342 -349 15.1821 0.0124
NP_442039.1_7 Reverse -50 -60 7.35486 0.277
NP_441811.1_3 Reverse -282 -296 17.7975 0.299
NP_441811.1_8 Forward -296 -282 9.34103 0.227
NP_441926.1_3 Forward -378 -362 4.48343 0.186
NP_440825.1_6 Reverse -184 -203 7.07928 0.287
NP_440825.1_7 Reverse -342 -352 12.4217 0.155
NP_442696.1_4 Forward -25 -11 16.8182 0.283
NP_442696.1_6 Reverse -365 -384 -12.3902 0.252
NP_442837.1_3 Forward -349 -342 15.7721 0.0124
NP_442837.1_3 Reverse -342 -349 15.7721 0.0124
NP_442837.1_3 Forward -289 -282 6.13563 0.25
NP_442837.1_3 Reverse -282 -289 5.93897 0.265
NP_440160.1_2 Reverse -223 -242 -8.06369 0.286
NP_442053.1_1 Forward -350 -341 18.3876 0.0007
NP_442053.1_1 Reverse -341 -350 18.3876 0.0007
NP_442053.1_1 Reverse -281 -290 7.76787 0.0895
NP_442053.1_1 Forward -290 -281 7.17789 0.104
NP_440505.1_3 Reverse -339 -349 15.418 0.0114
NP_440505.1_3 Reverse -279 -289 15.3197 0.0131
NP_440505.1_3 Forward -352 -342 6.76487 0.169
NP_440505.1_3 Reverse -129 -139 4.69992 0.272
NP_440013.1_2 Forward -357 -343 16.2242 0.176
NP_442532.1_4 Reverse -8 -26 21.7329 0.0215
NP_442532.1_7 Forward -350 -336 6.98109 0.171
NP_441576.1_10 Forward -27 -8 11.8975 0.291
NP_441408.2_7 Reverse -339 -358 -2.75381 0.272
NP_440914.1_1 Forward -350 -340 16.3248 0.00196
NP_440914.1_1 Forward -290 -280 13.4947 0.0297
NP_440914.1_1 Reverse -240 -250 12.0308 0.0684
NP_440914.1_1 Reverse -348 -358 10.3717 0.142
NP_440914.1_1 Reverse -341 -351 8.6151 0.186
NP_441011.1_8 Reverse -342 -351 16.9127 0.00602
NP_441011.1_8 Forward -349 -340 16.6177 0.00602
NP_442533.1_6 Forward -350 -341 17.2076 0.00137
NP_442533.1_6 Reverse -341 -350 17.2076 0.00137
NP_442533.1_6 Forward -249 -240 5.60459 0.137
NP_442533.1_6 Reverse -224 -233 5.21127 0.15
NP_442533.1_6 Reverse -240 -249 3.93297 0.197
NP_442533.1_6 Reverse -348 -357 3.24465 0.219
NP_442541.1_7 Forward -250 -231 19.469 0.164
NP_442232.1_3 Reverse -333 -352 5.40766 0.0823
NP_442232.1_3 Reverse -232 -251 0.58944 0.142
NP_442322.1_4 Forward -201 -184 -9.7949 0.297
NP_442229.1_1 Reverse -339 -353 18.4851 0.0734
NP_441482.1_7 Reverse -335 -349 8.65272 0.0162
NP_441482.1_7 Forward -356 -342 -8.35854 0.193
NP_441108.1_3 Forward -266 -247 15.3391 0.175
NP_439944.1_9 Forward -349 -339 17.7779 0.00341
NP_439944.1_9 Forward -289 -279 9.41981 0.1
NP_441697.1_5 Forward -26 -7 -1.38506 0.206
NP_440116.1_5 Forward -353 -336 5.15205 0.176
NP_441527.1_4 Reverse -373 -392 -12.6531 0.292
NP_440115.1_6 Reverse -278 -288 17.9746 0.0163
NP_440115.1_6 Reverse -338 -348 16.9913 0.0288
NP_440115.1_6 Reverse -29 -39 6.56821 0.178
NP_440007.1_9 Reverse -344 -358 2.16287 0.281
NP_441680.1_6 Forward -292 -273 16.6165 0.162
NP_441347.1_5 Reverse -335 -349 8.25877 0.294
NP_441602.1_3 Forward -355 -336 6.68596 0.128
NP_441602.1_3 Reverse -336 -355 -0.590531 0.224
NP_441972.1_5 Forward -289 -270 -0.590531 0.166
NP_441972.1_5 Reverse -330 -349 -9.83364 0.293
NP_441972.1_5 Forward -244 -225 -9.83364 0.293
NP_441106.1_1 Reverse -340 -349 18.486 0.0028
NP_441106.1_1 Forward -351 -342 18.191 0.0028
NP_441869.1_9 Reverse -352 -371 14.0608 0.249
NP_439903.1_6 Reverse -338 -357 14.2566 0.0705
NP_439903.1_6 Forward -353 -334 -1.27961 0.295
NP_442306.1_10 Reverse -193 -212 -20.945 0.237
NP_441286.1_1 Reverse -280 -292 11.937 0.0108
NP_441286.1_1 Forward -351 -339 5.15219 0.0259
NP_441286.1_1 Reverse -340 -352 -3.40261 0.145
NP_441286.1_1 Forward -291 -279 -6.74586 0.278
NP_442674.1_3 Reverse -333 -352 9.43841 0.174
NP_440670.1_6 Forward -245 -226 14.8474 0.292
NP_440670.1_8 Forward -350 -341 18.3876 0.000699
NP_440670.1_8 Reverse -341 -350 18.3876 0.000699
NP_440670.1_8 Forward -290 -281 6.8829 0.0907
NP_442881.1_3 Forward -355 -336 17.5998 0.128
NP_440886.1_7 Forward -351 -341 17.7774 0.0011
NP_440886.1_7 Reverse -340 -350 8.04271 0.0805
NP_442614.1_2 Reverse -281 -295 7.9644 0.257
NP_442614.1_3 Forward -383 -373 17.7779 0.232
NP_442072.1_9 Reverse -340 -358 -4.40575 0.0442
NP_442072.1_9 Forward -351 -333 -12.9605 0.095
NP_442098.1_5 Reverse -371 -390 18.3873 0.0638
NP_441808.1_8 Forward -227 -208 7.86593 0.273
NP_440907.2_8 Forward -349 -339 19.1541 0.00362
NP_440907.2_8 Reverse -342 -352 14.2375 0.0312
NP_439967.1_3 Reverse -372 -390 20.4715 0.0684
NP_441021.1_1 Forward -289 -270 0.196116 0.0924
NP_441021.1_1 Forward -244 -225 -9.63698 0.218
NP_441021.1_1 Reverse -342 -361 -11.0136 0.254
NP_440841.1_4 Forward -217 -198 -6.78538 0.215
NP_442459.1_8 Reverse -235 -254 14.8474 0.089
NP_441626.1_2 Forward -349 -342 15.7721 0.0124
NP_441626.1_2 Reverse -342 -349 15.7721 0.0124
NP_441626.1_2 Forward -289 -282 6.0373 0.212
NP_441626.1_2 Reverse -282 -289 6.0373 0.212
NP_442365.1_7 Forward -288 -269 -5.70374 0.277
NP_440107.1_5 Forward -291 -272 -1.96717 0.178
NP_442794.1_1 Reverse -337 -349 3.57889 0.286
NP_442794.1_1 Forward -354 -342 2.89058 0.286
NP_442615.1_1 Forward -359 -341 8.37728 0.0284
NP_442615.1_1 Forward -258 -240 4.14905 0.0489
NP_442615.1_1 Forward -299 -281 3.85406 0.0512
NP_442615.1_1 Reverse -332 -350 1.00246 0.0926
NP_442615.1_1 Reverse -215 -233 -3.91409 0.171
NP_441962.1_4 Reverse -336 -355 -0.295539 0.117
NP_441962.1_4 Forward -355 -336 -10.1286 0.224
NP_441962.1_4 Forward -164 -145 -11.2103 0.238
NP_441962.1_4 Forward -349 -330 -12.3902 0.256
NP_441962.1_4 Reverse -276 -295 -13.0786 0.268
NP_440387.1_1 Forward -350 -334 16.1848 0.0047
NP_440387.1_1 Reverse -341 -357 7.53169 0.0282
NP_440387.1_1 Forward -290 -274 -5.05468 0.212
NP_440855.1_5 Forward -352 -333 1.76863 0.295
NP_441431.1_2 Reverse -338 -352 17.3052 0.0296
NP_441431.1_2 Forward -353 -339 11.602 0.136
NP_441431.1_2 Forward -236 -222 8.65209 0.209
NP_441488.1_7 Reverse -335 -354 8.06259 0.121
NP_441488.1_7 Reverse -230 -249 0.687771 0.296
NP_441836.1_2 Reverse -222 -241 1.17943 0.197
NP_440634.1_6 Reverse -368 -382 15.4376 0.276
NP_441993.1_1 Forward -356 -337 12.4721 0.0994
NP_441993.1_1 Forward -350 -331 12.2772 0.101
NP_441993.1_1 Reverse -335 -354 7.59921 0.16
NP_441993.1_1 Reverse -218 -237 4.57804 0.217
NP_441174.1_2 Reverse -338 -352 17.6008 0.0437
NP_440814.1_4 Forward -359 -340 -12.4886 0.23
NP_440467.1_3 Forward -349 -330 15.8463 0.114
NP_440467.1_3 Forward -361 -342 11.1586 0.284
NP_440114.1_10 Reverse -341 -355 8.84938 0.192
NP_442437.1_8 Reverse -330 -349 3.83436 0.281
NP_442698.1_10 Reverse -277 -296 -0.983855 0.297
NP_442323.1_7 Forward -198 -179 10.4217 0.147
NP_440492.1_4 Reverse -11 -30 13.2118 0.277
NP_440287.1_6 Forward -359 -340 16.4207 0.065
NP_440293.1_3 Reverse -216 -235 -6.88371 0.294
NP_440766.1_4 Reverse -337 -351 16.4209 0.0256
NP_440766.1_4 Reverse -277 -291 9.34103 0.0871
NP_439988.1_7 Reverse -242 -256 16.7152 0.292
NP_441237.1_9 Reverse -282 -292 12.7631 0.105
NP_441237.1_9 Forward -289 -279 10.5998 0.224
NP_442743.1_5 Reverse -336 -355 9.93088 0.148
NP_442930.1_1 Forward -15 -5 9.41933 0.287
NP_441133.1_4 Reverse -287 -306 16.5191 0.124
NP_439910.1_2 Forward -358 -341 -21.299 0.183
NP_442867.1_8 Forward -240 -221 4.22769 0.287
NP_440457.1_1 Reverse -337 -349 6.72548 0.113
NP_440457.1_1 Reverse -277 -289 0.137309 0.25
NP_440457.1_1 Reverse -271 -283 -0.354346 0.262
NP_440457.1_1 Reverse -236 -248 -1.14099 0.294
NP_441984.1_3 Forward -203 -185 8.27895 0.232
NP_441984.1_6 Reverse -218 -230 14.7886 0.229
NP_440054.1_9 Reverse -349 -368 14.4533 0.16
NP_441436.1_8 Reverse -183 -202 12.9791 0.215
NP_442509.1_9 Reverse -341 -351 16.2041 0.00739
NP_442509.1_9 Forward -350 -340 8.04271 0.192
NP_442509.1_9 Reverse -281 -291 6.27276 0.279
NP_442514.1_5 Forward -245 -226 -2.26292 0.216
NP_442514.1_6 Reverse -331 -350 4.71934 0.24
NP_440554.1_4 Forward -349 -339 15.418 0.0199
NP_440554.1_4 Reverse -342 -352 7.35486 0.103
NP_440554.1_4 Forward -283 -273 4.20827 0.198
NP_442862.1_3 Reverse -219 -236 7.90532 0.252
NP_442737.1_5 Reverse -16 -35 18.0177 0.109
NP_441885.1_5 Reverse -341 -351 11.4848 0.00668
NP_441885.1_5 Forward -350 -340 11.3864 0.00668
NP_441885.1_5 Forward -290 -280 1.35667 0.11
NP_442228.1_3 Forward -283 -264 -0.000545616 0.139
NP_441428.1_8 Forward -358 -339 9.3409 0.206
NP_442341.1_7 Reverse -340 -354 11.3077 0.0565
NP_442341.1_7 Forward -351 -337 10.816 0.0596
NP_442341.1_9 Forward -352 -338 6.98048 0.208
NP_442341.1_9 Forward -359 -345 5.30886 0.274
NP_441756.1_5 Reverse -337 -356 -3.73712 0.29
NP_442395.2_4 Forward -351 -332 22.2214 0.0128
NP_443000.1_7 Reverse -339 -349 10.7964 0.0345
NP_443000.1_7 Forward -352 -342 1.94665 0.226
NP_443000.1_7 Reverse -279 -289 0.57002 0.294
NP_440507.2_3 Reverse -332 -351 9.53674 0.218
NP_441842.1_1 Forward -288 -275 16.2433 0.0484
NP_441842.1_10 Forward -357 -343 10.6193 0.157
NP_441842.1_10 Reverse -274 -288 9.34103 0.192
NP_440275.1_3 Reverse -339 -349 18.6629 0.0082
NP_440275.1_3 Forward -352 -342 8.33817 0.0602
NP_440275.1_3 Reverse -279 -289 8.04317 0.0602
NP_440091.1_1 Forward -354 -342 3.18557 0.166
NP_442275.1_1 Reverse -225 -244 7.37428 0.253
NP_442275.1_1 Forward -237 -218 3.73603 0.276
NP_442451.1_2 Forward -358 -339 -9.93197 0.26
NP_442638.1_3 Reverse -315 -334 10.8379 0.298
NP_440149.1_8 Reverse -218 -237 -0.983855 0.154
NP_440149.1_8 Forward -26 -7 -7.86702 0.294
NP_441105.1_3 Reverse -330 -349 27.4338 0.000455
NP_441105.1_3 Forward -361 -342 24.9755 0.00186
NP_441105.1_3 Reverse -229 -248 -1.27885 0.147
NP_441105.1_3 Reverse -264 -283 -4.91709 0.209
NP_442373.1_3 Reverse -210 -229 7.37428 0.287
NP_440216.1_1 Reverse -341 -355 -1.47537 0.0328
NP_440216.1_1 Forward -350 -336 -2.55701 0.0521
NP_440172.1_1 Forward -350 -340 17.5813 0.00421
NP_440172.1_1 Reverse -341 -351 8.73149 0.0586
NP_440172.1_1 Reverse -281 -291 7.45319 0.0789
NP_440172.1_1 Reverse -184 -194 4.0116 0.208
NP_440172.1_1 Reverse -240 -250 2.24165 0.279
NP_442371.1_1 Reverse -3 -13 14.0409 0.191
NP_441008.1_4 Forward -290 -271 15.5439 0.295
NP_442015.1_10 Forward -354 -341 11.6223 0.0372
NP_442015.1_10 Reverse -337 -350 4.54251 0.167
NP_442015.1_10 Reverse -277 -290 0.0192843 0.245
NP_441045.1_4 Forward -117 -98 11.9958 0.274
NP_441226.1_7 Forward -349 -342 14.4934 0.0123
NP_441226.1_7 Reverse -342 -349 14.4934 0.0123
NP_441757.1_2 Reverse -326 -344 22.0453 0.0144
NP_441757.1_3 Reverse -280 -299 25.2705 0.00356
NP_441757.1_4 Reverse -125 -144 25.3688 0.00444
NP_441757.1_5 Reverse -150 -169 24.9755 0.00564
NP_441757.1_6 Reverse -225 -244 22.8122 0.00861
NP_441111.1_7 Forward -349 -341 18.7023 0.00294
NP_441111.1_7 Reverse -342 -350 18.7023 0.00294
NP_441111.1_7 Forward -289 -281 8.96754 0.0463
NP_442379.1_10 Reverse -274 -291 4.26707 0.153
NP_442379.1_10 Reverse -334 -351 0.235503 0.223
NP_441766.1_2 Forward -350 -341 17.5026 0.00297
NP_441766.1_2 Reverse -341 -350 17.5026 0.00297
NP_441766.1_2 Forward -290 -281 8.65285 0.0495
NP_440416.1_9 Forward -357 -338 -6.09707 0.0854
NP_440416.1_9 Forward -244 -225 -12.4886 0.158
NP_440416.1_9 Reverse -217 -236 -12.5869 0.159
NP_440416.1_9 Reverse -334 -353 -13.0786 0.163
NP_440416.1_9 Forward -256 -237 -19.0768 0.269
NP_442116.1_6 Reverse -10 -27 8.45543 0.25
NP_440591.1_9 Forward -357 -339 12.0155 0.0935
NP_440591.1_9 Reverse -334 -352 6.41066 0.218
NP_441430.1_6 Forward -355 -336 12.9791 0.2
NP_440261.1_5 Forward -349 -336 -1.16069 0.0662
NP_440261.1_5 Forward -289 -276 -12.3704 0.284
NP_440988.1_10 Forward -286 -272 10.6108 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCAGGGCCACTTTTACTTGCTGGGTTTTGCCTGTTCCTAAAATGGCATCGGCGATCGCCTCGGCCAGTTTTTCAATCATTTTAAACTTGGACTCACGGATGAGCTTTTGCACGATCGCCACCGCATCCGCATAGTTGAGGGTATCGTTTAGGTCATCGCTCTGCCCAGCCTTGGCCAAATCGATCCAGATGGTGAGATCAACCTCAAACCATTGCCCTAAAAACTGTTCTGCATCGAAGTAGCCAGTGTAACCATAGGCTCGAATTCCCTTAACGTTTAACGTATCCATAAATTGATTAAGTACTAGCTGACTACCAGATATTGAACTAAGAACAACAAGTTCCCCAGCTAACCATGGTATGATCACCCCGTCAAAAATTGCCATAATTTTTCCCTGCC

CDS

ATGCCTCCCCAATTTCCCTTAGCTACGGTTGGTGCGCTGGTTACTGCCCCCGACGGCCGAGTTTTAATTGTCAAAACCACCAAATGGCGGGGCACCTGGGGGGTGCCTGGGGGAAAGGTGGAATGGGGAGAAACATTAGAAGCGGCCCTAAAACGGGAATTCCAAGAAGAAGTGGGGTTAGATCTACGGGAAATAAAGTTTGCTTTGGTACAGGAAGCGGTGAATGATGAACAGTTCCATTGCCCAGCCCATTTTGTTTTATTAAACTACTACGCCCGTTGTGAGTCCACTCAGGTGATTCCCAATGAGGAAATTGTTGAATGGGAATGGGTCACTCCCCTAGAAGCATTGGATTTTCCCCTTAATAGTTTTACCAAGCTACTTTTGGAAGATTATCAGCAACGTTTTATGTCCATTTAA

Protein

MPPQFPLATVGALVTAPDGRVLIVKTTKWRGTWGVPGGKVEWGETLEAALKREFQEEVGLDLREIKFALVQEAVNDEQFHCPAHFVLLNYYARCESTQVIPNEEIVEWEWVTPLEALDFPLNSFTKLLLEDYQQRFMSI