Your browser is old and dusty. Try Google Chrome!

Details for sll1535

ORF sll1535
Accession NP_441761.1
Symbol
Category Surface polysaccharides, lipopolysaccharides and antigens
Definition putative sugar transferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -107 -88 -29.4998 0.228
NP_441418.1_6 Forward -400 -381 -30.4831 0.28
NP_440815.1_5 Reverse -345 -364 3.04771 0.289
NP_442151.1_8 Reverse -135 -148 17.8172 0.27
NP_441630.1_3 Forward -62 -43 -0.197208 0.285
NP_442655.1_10 Forward -107 -88 -12.0953 0.261
NP_443002.1_5 Reverse -239 -257 16.0463 0.192
NP_441721.1_6 Forward -211 -192 10.8159 0.281
NP_441225.1_4 Forward -374 -355 -12.4886 0.284
NP_441934.1_5 Reverse -344 -363 12.9791 0.259
NP_442000.2_6 Forward -399 -380 19.8623 0.0799
NP_440061.1_9 Reverse -327 -341 10.422 0.124
NP_440061.1_9 Forward -389 -375 7.47213 0.205
NP_441054.1_4 Reverse -209 -227 -3.91409 0.288
NP_440304.1_4 Reverse -350 -360 6.56821 0.15
NP_440304.1_4 Reverse -389 -399 5.48657 0.206
NP_440916.1_1 Reverse -232 -246 9.34103 0.236
NP_441208.1_9 Forward -357 -343 11.3077 0.156
NP_442196.1_4 Reverse -89 -108 15.4374 0.263
NP_442196.1_9 Forward -300 -287 15.6539 0.297
NP_441546.1_2 Reverse -290 -309 19.2723 0.244
NP_442110.1_7 Forward -361 -347 0.491246 0.259
NP_441925.1_4 Reverse -329 -348 -13.6693 0.258
NP_440109.1_6 Reverse -296 -315 7.86593 0.268
NP_442889.1_1 Reverse -372 -391 -12.7836 0.239
NP_440056.1_1 Forward -399 -380 14.1591 0.146
NP_440056.1_1 Forward -393 -374 7.86593 0.297
NP_442570.1_3 Forward -363 -344 13.1758 0.078
NP_442570.1_3 Forward -357 -338 -6.39206 0.257
NP_442973.1_7 Forward -252 -233 15.9291 0.209
NP_441695.1_4 Forward -121 -103 10.2456 0.28
NP_441012.1_4 Reverse -348 -361 8.37742 0.272
NP_441634.1_8 Forward -100 -86 -3.93365 0.295
NP_441588.1_4 Reverse -215 -225 8.04317 0.161
NP_443065.1_6 Forward -365 -346 4.22769 0.221
NP_442687.1_7 Reverse -344 -354 6.37155 0.171
NP_442191.1_4 Forward -353 -339 13.0292 0.17
NP_441846.1_10 Forward -348 -329 -13.7669 0.211
NP_440781.1_1 Forward -254 -240 10.521 0.296
NP_442583.1_1 Reverse -297 -316 8.65258 0.298
NP_440642.1_5 Forward -387 -368 9.0459 0.191
NP_440642.1_10 Reverse -327 -341 2.45727 0.277
NP_441763.1_10 Reverse -341 -360 7.17681 0.248
NP_442658.1_1 Reverse -389 -399 8.14104 0.199
NP_442658.1_10 Reverse -368 -387 15.0441 0.239
NP_440184.1_7 Reverse -153 -172 15.4197 0.228
NP_441478.1_5 Forward -384 -365 15.7324 0.236
NP_442448.1_10 Reverse -335 -354 21.6323 0.0924
NP_439905.1_2 Reverse -367 -381 8.94771 0.237
NP_442690.1_1 Forward -241 -222 -17.2085 0.298
NP_441294.1_7 Reverse -85 -99 11.0744 0.157
NP_440411.1_10 Reverse -364 -383 9.38336 0.29
NP_441646.1_1 Forward -344 -325 -1.7705 0.294
NP_441292.1_2 Forward -349 -330 -5.40875 0.241
NP_441292.1_2 Reverse -355 -374 -6.1954 0.241
NP_441752.1_6 Reverse -135 -154 6.09597 0.211
NP_440147.1_4 Forward -224 -211 1.69091 0.222
NP_441041.1_4 Reverse -367 -386 -10.9153 0.238
NP_441041.1_4 Forward -343 -324 -12.5869 0.269
NP_440509.1_6 Reverse -374 -393 6.98095 0.108
NP_443063.1_7 Reverse -351 -367 4.97508 0.288
NP_441725.1_5 Forward -399 -389 7.15819 0.103
NP_440983.1_5 Reverse -83 -102 -7.76869 0.291
NP_440983.1_5 Reverse -92 -111 -8.85033 0.298
NP_442500.1_8 Forward -311 -297 13.4562 0.198
NP_442012.1_1 Forward -99 -80 0.982764 0.226
NP_442215.1_2 Forward -363 -347 -4.07137 0.227
NP_442029.1_1 Forward -350 -331 -20.4534 0.298
NP_442029.1_6 Forward -353 -334 11.7992 0.157
NP_442029.1_6 Reverse -373 -392 6.88262 0.232
NP_442554.1_8 Forward -221 -211 2.63497 0.265
NP_443009.1_4 Forward -300 -281 17.404 0.222
NP_441448.1_2 Reverse -94 -113 0.981987 0.216
NP_441198.1_8 Reverse -389 -399 10.9275 0.232
NP_440379.1_5 Reverse -363 -382 -10.1286 0.276
NP_440464.1_10 Reverse -310 -320 11.7668 0.282
NP_441015.1_10 Forward -353 -334 -9.53865 0.282
NP_441015.1_10 Forward -109 -90 -10.4236 0.284
NP_442253.1_5 Forward -341 -324 -0.157821 0.213
NP_442719.1_2 Forward -237 -219 4.04996 0.155
NP_441251.1_7 Reverse -297 -310 14.0806 0.266
NP_442227.1_2 Reverse -330 -349 1.57275 0.245
NP_440789.1_1 Reverse -57 -76 15.9282 0.191
NP_442808.1_1 Reverse -135 -145 11.1893 0.0481
NP_442808.1_1 Reverse -344 -354 3.32285 0.244
NP_442050.1_1 Reverse -345 -364 10.2259 0.243
NP_442050.1_5 Reverse -278 -288 6.96107 0.27
NP_441114.1_3 Forward -398 -389 7.57121 0.231
NP_441114.1_3 Reverse -330 -339 7.57121 0.231
NP_440558.1_2 Reverse -325 -344 5.30933 0.145
NP_440558.1_2 Forward -385 -366 4.81767 0.148
NP_440558.1_2 Forward -341 -322 -3.54046 0.236
NP_441518.1_3 Forward -305 -286 -8.06369 0.179
NP_441878.1_6 Reverse -390 -400 -7.49312 0.231
NP_442888.1_8 Forward -359 -340 8.94757 0.275
NP_442594.1_8 Forward -340 -321 6.19431 0.236
NP_440151.1_5 Forward -366 -347 8.16093 0.222
NP_441633.1_3 Forward -193 -180 -5.38892 0.236
NP_442764.1_3 Reverse -390 -400 15.418 0.295
NP_442590.1_10 Forward -388 -369 4.62101 0.273
NP_442590.1_10 Forward -361 -342 3.04771 0.297
NP_441728.2_4 Reverse -152 -171 12.2703 0.273
NP_440640.1_6 Forward -110 -91 1.17943 0.266
NP_440640.1_6 Forward -387 -368 0.294447 0.275
NP_441007.1_10 Forward -103 -90 1.59258 0.203
NP_442334.1_2 Forward -341 -324 -13.6292 0.297
NP_442333.2_5 Reverse -335 -354 1.96607 0.197
NP_442333.2_5 Reverse -341 -360 -9.44032 0.246
NP_440256.1_1 Forward -120 -101 -6.58872 0.215
NP_440256.1_1 Forward -358 -339 -8.06369 0.251
NP_441559.1_8 Forward -365 -351 -6.39192 0.277
NP_440915.1_6 Reverse -104 -118 -1.37704 0.233
NP_442866.1_1 Forward -366 -347 -3.3438 0.221
NP_442866.1_1 Reverse -361 -380 -7.67036 0.268
NP_440748.1_5 Reverse -348 -367 9.93088 0.14
NP_442453.1_6 Reverse -336 -350 16.755 0.176
NP_442957.1_8 Forward -356 -337 9.3409 0.287
NP_440570.1_5 Forward -364 -345 -0.590531 0.262
NP_441750.1_1 Forward -107 -88 3.24438 0.128
NP_441750.1_7 Forward -98 -88 14.7297 0.254
NP_442484.1_2 Forward -359 -340 4.12936 0.192
NP_442240.1_1 Reverse -284 -303 5.99684 0.26
NP_442240.1_1 Reverse -320 -339 2.9486 0.295
NP_440027.1_2 Reverse -131 -150 13.0766 0.224
NP_440027.1_3 Reverse -329 -347 5.91824 0.232
NP_440027.1_3 Forward -392 -374 3.55831 0.27
NP_439937.1_8 Forward -100 -81 -2.65548 0.261
NP_440991.1_9 Reverse -293 -312 16.4207 0.194
NP_440819.1_5 Forward -138 -130 7.98423 0.228
NP_440316.1_10 Forward -349 -339 8.04317 0.24
NP_441803.1_2 Reverse -340 -359 1.37609 0.232
NP_441877.1_5 Reverse -230 -249 2.45773 0.253
NP_441018.1_7 Forward -102 -83 11.5042 0.185
NP_440282.1_10 Forward -392 -373 -9.73531 0.288
NP_441060.1_1 Reverse -292 -311 17.2459 0.159
NP_440297.1_9 Forward -399 -389 7.05986 0.15
NP_442280.1_10 Forward -364 -346 5.35702 0.287
NP_440999.1_9 Forward -365 -351 6.88276 0.0932
NP_440888.1_2 Forward -361 -347 11.897 0.0562
NP_442512.1_3 Reverse -289 -308 9.73422 0.291
NP_442845.1_2 Forward -354 -340 5.40779 0.233
NP_441178.1_6 Reverse -336 -355 1.76863 0.279
NP_441469.1_8 Reverse -390 -399 9.4395 0.227
NP_442315.1_1 Forward -25 -7 2.96908 0.294
NP_440071.1_5 Forward -391 -372 6.98095 0.293
NP_440220.1_4 Forward -245 -226 -3.83621 0.297
NP_441601.1_4 Reverse -335 -354 -6.09707 0.296
NP_442204.1_6 Forward -107 -88 9.53756 0.22
NP_442204.1_6 Forward -354 -335 8.16093 0.228
NP_440504.1_7 Reverse -323 -342 3.6377 0.216
NP_440544.1_5 Forward -177 -170 13.8024 0.28
NP_440673.1_3 Forward -359 -352 6.72562 0.277
NP_442864.1_2 Reverse -84 -103 10.9142 0.255
NP_441004.1_1 Forward -354 -335 -11.8003 0.242
NP_441004.1_1 Reverse -346 -365 -14.5535 0.268
NP_441004.1_1 Forward -337 -318 -15.7335 0.277
NP_441004.1_1 Forward -110 -91 -17.3068 0.29
NP_442813.1_4 Forward -356 -337 0.491109 0.197
NP_442366.1_3 Forward -362 -344 -0.275845 0.188
NP_442694.1_4 Reverse -301 -310 12.9794 0.225
NP_442694.1_4 Reverse -292 -301 11.4061 0.277
NP_442206.1_10 Reverse -108 -123 0.766545 0.245
NP_441851.1_10 Reverse -390 -400 4.20827 0.282
NP_441982.1_6 Forward -140 -131 11.6259 0.288
NP_440474.1_8 Forward -97 -83 4.32555 0.284
NP_440474.1_8 Reverse -287 -301 4.22722 0.287
NP_441477.1_5 Reverse -331 -350 6.68596 0.278
NP_442168.1_5 Reverse -362 -381 -2.65548 0.264
NP_440023.1_5 Reverse -54 -73 7.57094 0.228
NP_441003.1_9 Reverse -336 -355 5.99764 0.255
NP_441570.1_1 Reverse -346 -364 -17.5821 0.283
NP_442729.1_5 Forward -349 -339 12.3697 0.235
NP_442348.1_2 Reverse -300 -309 7.37455 0.28
NP_440526.1_3 Reverse -90 -101 0.844851 0.267
NP_441432.1_8 Reverse -351 -360 11.9961 0.0519
NP_441432.1_8 Forward -400 -391 2.65466 0.292
NP_440759.1_6 Reverse -345 -364 1.76941 0.28
NP_441945.1_10 Forward -355 -336 15.6341 0.155
NP_440913.1_3 Reverse -339 -352 17.0305 0.184
NP_441659.2_8 Reverse -89 -99 0.471689 0.264
NP_440786.1_9 Forward -313 -294 19.764 0.135
NP_440860.1_6 Forward -399 -380 14.4541 0.285
NP_442913.1_10 Reverse -381 -400 -6.29373 0.3
NP_441040.1_2 Forward -356 -337 2.75272 0.119
NP_442776.1_1 Reverse -340 -359 4.81767 0.268
NP_442346.1_5 Reverse -351 -361 8.92815 0.121
NP_440545.1_3 Reverse -362 -379 7.02034 0.0522
NP_440459.1_2 Reverse -337 -354 14.8868 0.119
NP_441943.1_8 Reverse -381 -400 -13.3736 0.265
NP_441888.1_7 Forward -366 -352 11.3077 0.0879
NP_442799.1_2 Reverse -327 -346 -0.688862 0.289
NP_441329.1_6 Reverse -159 -178 3.38954 0.216
NP_440671.1_4 Forward -381 -367 4.91614 0.3
NP_441609.1_1 Forward -238 -219 -0.295539 0.236
NP_441671.1_6 Forward -399 -380 10.1275 0.179
NP_440875.1_9 Forward -120 -110 8.46937 0.233
NP_441813.1_3 Forward -265 -246 12.9769 0.296
NP_441239.1_9 Reverse -337 -349 3.18557 0.292
NP_441239.1_9 Forward -119 -107 3.18557 0.292
NP_441239.1_9 Reverse -87 -99 3.08724 0.296
NP_441239.1_9 Forward -384 -372 2.98891 0.3
NP_440989.1_3 Reverse -112 -131 17.7974 0.117
NP_441874.1_1 Forward -352 -338 8.45605 0.298
NP_442138.1_1 Forward -363 -344 -0.0996487 0.298
NP_442138.1_10 Reverse -286 -305 -3.73712 0.242
NP_440412.1_1 Forward -349 -330 13.4708 0.112
NP_442809.1_6 Reverse -83 -102 0.392778 0.295
NP_441184.1_3 Forward -390 -371 8.25926 0.231
NP_442340.1_3 Forward -398 -379 -5.21209 0.223
NP_442340.1_3 Forward -199 -180 -10.9153 0.295
NP_442479.1_5 Reverse -55 -74 7.67331 0.222
NP_442479.1_9 Forward -240 -221 -8.65367 0.266
NP_441474.1_1 Forward -127 -108 3.44025 0.236
NP_441848.1_4 Reverse -222 -238 11.9433 0.213
NP_440653.1_10 Reverse -340 -359 2.0644 0.29
NP_440696.1_3 Reverse -362 -380 -4.11075 0.296
NP_441811.1_1 Reverse -329 -348 13.7658 0.247
NP_442829.1_2 Forward -310 -294 9.0108 0.287
NP_442829.1_2 Reverse -162 -178 8.23773 0.287
NP_440825.1_6 Reverse -292 -311 9.14423 0.285
NP_440160.1_2 Forward -387 -368 -2.65548 0.247
NP_440160.1_2 Reverse -333 -352 -7.96535 0.286
NP_440505.1_3 Forward -94 -84 6.46988 0.18
NP_441701.1_3 Reverse -286 -303 9.38028 0.245
NP_441701.1_3 Forward -347 -330 7.80699 0.257
NP_441252.1_6 Forward -254 -247 11.6422 0.288
NP_441777.1_1 Reverse -161 -179 17.859 0.167
NP_440914.1_1 Reverse -346 -356 7.15123 0.249
NP_442533.1_6 Forward -381 -372 8.1612 0.0807
NP_442533.1_6 Reverse -352 -361 3.04799 0.228
NP_442533.1_6 Reverse -373 -382 2.458 0.255
NP_442541.1_10 Reverse -328 -342 10.717 0.186
NP_442541.1_10 Forward -376 -362 3.63724 0.254
NP_440263.1_3 Forward -294 -275 5.89931 0.243
NP_440854.1_1 Forward -318 -299 8.73709 0.152
NP_441527.1_4 Reverse -159 -178 -5.20473 0.197
NP_440007.1_9 Reverse -342 -356 1.17956 0.29
NP_443045.1_5 Forward -342 -329 18.4355 0.119
NP_441825.1_4 Forward -289 -279 10.8948 0.265
NP_439903.1_6 Forward -364 -345 1.27698 0.249
NP_441930.1_2 Reverse -390 -400 13.0581 0.248
NP_440886.1_7 Reverse -88 -98 6.37109 0.13
NP_440886.1_7 Reverse -338 -348 5.48612 0.181
NP_440828.1_1 Reverse -88 -107 8.84842 0.197
NP_440828.1_1 Reverse -135 -154 3.14526 0.231
NP_440513.1_3 Forward -149 -132 20.6685 0.111
NP_441808.1_8 Forward -110 -91 6.4893 0.288
NP_442022.1_4 Forward -107 -88 11.3075 0.217
NP_441021.1_1 Forward -399 -380 -5.31042 0.177
NP_441021.1_2 Reverse -333 -352 4.03102 0.291
NP_441901.1_1 Forward -357 -338 1.27776 0.245
NP_442238.1_1 Forward -294 -275 3.24438 0.215
NP_440107.1_5 Reverse -82 -101 1.86774 0.178
NP_441962.1_4 Forward -342 -323 -8.06369 0.195
NP_441431.1_2 Reverse -336 -350 11.9953 0.128
NP_441431.1_2 Reverse -335 -349 7.57046 0.238
NP_442020.1_1 Forward -309 -290 -0.00131823 0.262
NP_441193.1_6 Forward -60 -41 0.58944 0.293
NP_441993.1_1 Forward -354 -335 16.7602 0.0548
NP_442084.1_6 Forward -256 -238 13.0972 0.161
NP_440737.1_1 Reverse -346 -365 8.06259 0.251
NP_441206.1_4 Forward -127 -108 -1.96717 0.193
NP_441510.2_6 Forward -371 -352 15.3382 0.159
NP_441510.2_7 Reverse -339 -353 11.4053 0.28
NP_440457.1_1 Forward -347 -335 0.333971 0.25
NP_440457.1_1 Forward -342 -330 -0.157684 0.254
NP_441984.1_3 Forward -386 -368 10.0489 0.194
NP_440054.1_9 Forward -353 -334 17.2065 0.103
NP_441489.1_3 Reverse -68 -82 7.74647 0.249
NP_441761.1_1 Forward -399 -380 34.2186 0.00000278
NP_441761.1_2 Forward -375 -356 29.7937 0.000267
NP_441761.1_3 Forward -342 -323 26.6471 0.00469
NP_441761.1_4 Forward -20 -1 23.8939 0.00291
NP_441761.1_5 Forward -167 -148 30.3828 0.00034
NP_441761.1_6 Forward -252 -233 26.1555 0.00332
NP_441761.1_7 Forward -296 -277 17.5998 0.242
NP_441761.1_9 Forward -50 -32 24.6019 0.0118
NP_441761.1_10 Forward -141 -122 18.584 0.174
NP_442703.1_9 Reverse -160 -178 4.73903 0.244
NP_442341.1_5 Reverse -331 -350 10.8159 0.297
NP_442341.1_7 Reverse -344 -358 1.17956 0.297
NP_441173.1_9 Forward -77 -69 9.85212 0.275
NP_440560.1_7 Forward -183 -164 9.63507 0.237
NP_442275.1_1 Reverse -335 -354 -0.295539 0.295
NP_439962.1_4 Reverse -334 -353 -8.752 0.298
NP_442495.1_3 Forward -353 -335 9.65558 0.282
NP_440149.1_8 Reverse -346 -365 -5.50708 0.228
NP_440216.1_9 Forward -336 -327 9.83282 0.286
NP_440172.1_1 Reverse -352 -362 2.14332 0.283
NP_442290.1_1 Reverse -297 -316 11.8975 0.148
NP_443052.1_9 Reverse -335 -354 -3.14714 0.245
NP_443052.1_9 Reverse -91 -110 -5.99873 0.276
NP_441940.1_4 Forward -378 -359 6.98095 0.286
NP_442154.1_1 Forward -106 -88 -13.4522 0.217
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGCATTGCCCTAGTGGAAGCCCAGGCCTGTGGCACCCCAGTCATTGCCTTTGGCCGTGGGGGGGCATTGGAAACCGTAGTTGACTATCAAAAAAATCCCAAAACTGCCACCGGGATTTGGTTTGATCAACAAACAGTAGAGTCTTTGGTGCAAGCAGTGGAAACTTTTTCCAACATTAGCCATCAGATCAGTTCAGAGAACTGTTTCCTGCAAGCAAACCGTTTTTCTTCTAAAATATTTCAAACGTCGTATCTGGCGTTGCTGGAAAAATACTGTCATCAAGCCCCTCGTCGGACTTAGTGGCGGTGGGAGTCCTCAGTTATTTAGCAAAGAATCGTAACAATTGTCGATTCAGGCTTTATGATTAGGACCATATGGTGTGATGTGTGATGGAGTACG

CDS

ATGACTGCCAATAGCTCACCGATCTCTGTAAAAGCCCTCCGTGCTTTGATGAGACGCGGATTTTATCCAACGGTCTCTCCGAGAAGGTATCAAGGTTCCCGCTCCAGTTCCCTCACCGGAACCGTGGCTAAAAGGGTATTCGATATCTGTTTCTCCCTGTCGGTACTGGTTCTCTGTTCCCCCCTCTACCTGGCGATCGCCCTAATGATTGCGGTCAGCTCTCCGGGGCCTATTTTCTATGTGCAAGAAAGGGTGGGGCGCAAATTTAAACGTTTCAAATGTATTAAGTTCCGCACCATGGTCACCAATGCCGATGAGGTGTTGGAAAAGCTGATGGCGGGCTGTCCTCAAACCAGAGAAGAATTTGAAAAGAACTTCAAACTCCGTAATGATCCCCGCATTACCTGGATTGGCAAATTTTTGCGCCTGACTAGCCTGGATGAATTTCCTCAATTCTGGAATGTGCTCAAGGGGGATATGAGCTTGGTGGGGCCCCGTCCCTTGGTGCCGGAGGAGTTGCACAAGTATGGACGTCAAATTAACCAAGTTCTGAGCATTAAGCCAGGGCTAACCGGCTTATGGCAGGTTTCTGGCCGCAACGATATTCCCTATCCTGAGCGGGTGCAAATTGATGTTTATTACGTCTATTACCGCACCATGACGTTGGATTTACTGATCATCGCTAAAACCCTGGGTGTGATGCTGTTTCCCAACAATAATGGGGCTTATTAA

Protein

MTANSSPISVKALRALMRRGFYPTVSPRRYQGSRSSSLTGTVAKRVFDICFSLSVLVLCSPLYLAIALMIAVSSPGPIFYVQERVGRKFKRFKCIKFRTMVTNADEVLEKLMAGCPQTREEFEKNFKLRNDPRITWIGKFLRLTSLDEFPQFWNVLKGDMSLVGPRPLVPEELHKYGRQINQVLSIKPGLTGLWQVSGRNDIPYPERVQIDVYYVYYRTMTLDLLIIAKTLGVMLFPNNNGAY