Your browser is old and dusty. Try Google Chrome!

Details for sll1532

ORF sll1532
Accession NP_441765.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -167 -181 12.586 0.209
NP_441061.1_2 Forward -279 -265 8.06273 0.0937
NP_440795.1_7 Forward -279 -272 14.6904 0.0123
NP_440795.1_7 Reverse -272 -279 14.6904 0.0123
NP_441418.1_2 Reverse -292 -310 15.7521 0.0797
NP_441418.1_6 Forward -280 -261 -19.8634 0.0979
NP_441418.1_6 Reverse -271 -290 -19.9617 0.0997
NP_441418.1_6 Forward -80 -61 -23.2067 0.192
NP_442291.1_5 Forward -281 -265 5.86006 0.0727
NP_442291.1_5 Reverse -270 -286 5.46674 0.0762
NP_440897.1_6 Forward -50 -31 0.0970122 0.18
NP_441453.1_4 Reverse -271 -279 16.539 0.00633
NP_441453.1_4 Forward -280 -272 16.539 0.00633
NP_442151.1_6 Reverse -271 -285 10.1277 0.13
NP_442151.1_6 Forward -280 -266 8.06273 0.183
NP_441818.1_1 Forward -279 -268 15.8894 0.0244
NP_441818.1_1 Reverse -272 -283 15.4961 0.0264
NP_440226.1_1 Reverse -271 -290 16.3224 0.022
NP_440226.1_1 Forward -280 -261 10.4225 0.0622
NP_441098.1_3 Reverse -346 -365 -0.663914 0.25
NP_442173.1_1 Forward -279 -271 15.4574 0.00633
NP_442173.1_1 Reverse -272 -280 15.4574 0.00633
NP_442752.1_4 Forward -280 -273 13.8055 0.0199
NP_442752.1_4 Reverse -271 -278 13.8055 0.0199
NP_442752.1_4 Reverse -91 -98 5.25066 0.256
NP_443027.1_4 Reverse -269 -279 14.0414 0.0452
NP_443027.1_4 Forward -282 -272 11.0914 0.107
NP_443027.1_4 Reverse -89 -99 8.4365 0.202
NP_443027.1_4 Reverse -361 -371 8.23984 0.215
NP_441812.1_3 Forward -281 -267 9.2427 0.245
NP_442975.1_10 Reverse -267 -281 12.192 0.0477
NP_442975.1_10 Forward -104 -90 3.73557 0.252
NP_440784.1_7 Forward -279 -272 15.9687 0.0123
NP_440784.1_7 Reverse -272 -279 15.9687 0.0123
NP_440061.1_9 Reverse -269 -283 17.9935 0.0113
NP_440061.1_9 Forward -282 -268 10.3237 0.126
NP_441054.1_4 Forward -290 -272 11.8189 0.0619
NP_440878.1_9 Forward -290 -271 4.916 0.174
NP_442062.1_8 Forward -280 -270 17.3846 0.00193
NP_442062.1_8 Reverse -271 -281 17.3846 0.00193
NP_440304.1_4 Reverse -269 -279 10.8948 0.051
NP_440304.1_4 Forward -282 -272 1.84832 0.299
NP_442242.1_4 Forward -279 -272 14.3954 0.0124
NP_442242.1_4 Reverse -272 -279 14.3954 0.0124
NP_440044.1_8 Forward -279 -260 10.5209 0.0551
NP_440044.1_8 Forward -99 -80 4.62101 0.112
NP_441208.1_9 Forward -320 -306 8.94771 0.219
NP_441208.1_9 Reverse -119 -133 5.40779 0.267
NP_441083.1_5 Forward -280 -270 20.3345 0.00053
NP_441083.1_5 Reverse -271 -281 20.3345 0.00053
NP_441083.1_5 Forward -50 -40 3.12662 0.182
NP_441083.1_5 Forward -100 -90 -0.904945 0.283
NP_442827.1_8 Forward -288 -269 1.6703 0.173
NP_441434.1_7 Reverse -273 -287 11.6026 0.13
NP_441434.1_7 Forward -294 -280 1.57289 0.299
NP_441738.1_2 Forward -278 -271 15.28 0.0102
NP_441738.1_2 Reverse -273 -280 15.28 0.0102
NP_441738.1_2 Forward -128 -121 8.1019 0.204
NP_441738.1_2 Forward -98 -91 8.00357 0.235
NP_441558.1_5 Reverse -269 -288 17.404 0.021
NP_441558.1_5 Reverse -89 -108 5.70265 0.242
NP_441558.1_5 Reverse -361 -380 3.93269 0.294
NP_440209.1_1 Reverse -271 -279 18.1123 0.00295
NP_440209.1_1 Forward -280 -272 18.1123 0.00295
NP_442180.1_1 Forward -261 -242 8.94757 0.135
NP_442889.1_8 Forward -283 -269 11.602 0.0733
NP_442889.1_8 Reverse -268 -282 2.94893 0.295
NP_440447.1_6 Reverse -30 -48 0.609134 0.284
NP_440178.1_7 Forward -281 -262 -13.1769 0.129
NP_442706.1_9 Forward -105 -86 10.2259 0.23
NP_441716.1_1 Forward -280 -266 10.816 0.0936
NP_442111.1_4 Reverse -270 -284 4.03116 0.223
NP_442111.1_4 Forward -281 -267 1.67122 0.296
NP_440906.1_5 Forward -279 -272 15.8704 0.0124
NP_440906.1_5 Reverse -272 -279 15.8704 0.0124
NP_440906.1_5 Reverse -92 -99 8.79057 0.149
NP_440747.1_10 Forward -283 -271 16.7552 0.0019
NP_440747.1_10 Reverse -268 -280 7.4138 0.00422
NP_441130.1_10 Reverse -269 -283 8.45605 0.135
NP_441486.1_1 Reverse -268 -282 5.50613 0.0365
NP_441486.1_1 Forward -283 -269 3.8345 0.0534
NP_441486.1_1 Reverse -13 -27 -5.60527 0.248
NP_441486.1_1 Forward -28 -14 -5.70361 0.254
NP_442634.1_4 Reverse -39 -53 2.85119 0.126
NP_442634.1_4 Forward -282 -268 -1.96703 0.149
NP_441014.1_10 Forward -281 -262 17.2065 0.0425
NP_442848.1_1 Reverse -265 -279 -1.37704 0.263
NP_442848.1_1 Forward -106 -92 -3.54032 0.268
NP_443018.1_3 Forward -279 -272 14.8871 0.0123
NP_443018.1_3 Reverse -272 -279 14.8871 0.0123
NP_441634.1_8 Forward -282 -268 -3.24533 0.295
NP_440376.1_1 Forward -280 -271 19.4693 0.000692
NP_440376.1_1 Reverse -271 -280 19.4693 0.000692
NP_441588.1_4 Reverse -273 -283 6.46988 0.193
NP_441588.1_4 Forward -278 -268 6.37155 0.2
NP_442687.1_7 Forward -281 -271 8.92815 0.0994
NP_442687.1_7 Reverse -270 -280 8.92815 0.0994
NP_442687.1_7 Forward -72 -62 4.69992 0.238
NP_442485.1_3 Forward -82 -63 -1.08219 0.255
NP_442485.1_3 Reverse -260 -279 -4.42544 0.28
NP_441846.1_10 Reverse -244 -263 -22.2233 0.257
NP_440642.1_10 Reverse -126 -140 8.94708 0.198
NP_440236.1_2 Reverse -321 -339 -4.99573 0.277
NP_442658.1_1 Forward -282 -272 7.94438 0.199
NP_442658.1_1 Reverse -269 -279 6.76441 0.214
NP_440656.1_8 Reverse -260 -279 -3.93378 0.198
NP_441414.1_9 Forward -280 -261 5.80098 0.0439
NP_441414.1_9 Reverse -271 -290 -1.57384 0.102
NP_440184.1_7 Forward -308 -289 13.5099 0.28
NP_441487.1_9 Forward -281 -262 -2.75381 0.293
NP_442937.1_5 Reverse -266 -285 6.78429 0.27
NP_442321.1_4 Forward -328 -309 -7.76869 0.284
NP_441317.1_4 Forward -316 -302 14.143 0.161
NP_441317.1_4 Forward -314 -300 14.0475 0.161
NP_441958.1_5 Forward -281 -271 12.2714 0.00183
NP_441958.1_5 Reverse -270 -280 12.2714 0.00183
NP_439905.1_1 Reverse -272 -285 18.4072 0.0274
NP_440984.1_7 Forward -285 -271 21.0424 0.00311
NP_441097.1_2 Forward -240 -223 11.7402 0.185
NP_439990.1_5 Forward -285 -272 10.1474 0.128
NP_439990.1_6 Reverse -363 -382 9.24257 0.197
NP_442690.1_1 Reverse -13 -32 2.16274 0.096
NP_442911.1_2 Reverse -261 -280 8.55425 0.0203
NP_442911.1_2 Forward -290 -271 -4.52377 0.136
NP_440153.1_5 Reverse -272 -286 3.24451 0.217
NP_443055.1_6 Reverse -263 -281 6.70489 0.165
NP_440388.1_7 Reverse -335 -354 0.491109 0.251
NP_441099.1_5 Forward -290 -271 -11.0136 0.27
NP_441099.1_5 Reverse -261 -280 -11.8986 0.291
NP_442002.1_9 Reverse -120 -127 10.5605 0.214
NP_441294.1_7 Forward -104 -90 11.1704 0.153
NP_442438.1_10 Reverse -38 -52 1.57289 0.191
NP_441473.1_3 Forward -380 -361 11.4058 0.107
NP_441000.1_6 Reverse -70 -84 2.2612 0.145
NP_440484.1_3 Forward -282 -268 12.1926 0.242
NP_440147.1_4 Reverse -269 -282 9.75405 0.0371
NP_440147.1_4 Forward -282 -269 8.67241 0.0475
NP_441550.1_8 Forward -282 -272 15.1225 0.0132
NP_441550.1_8 Reverse -269 -279 12.3692 0.0336
NP_441550.1_8 Reverse -188 -198 4.7978 0.283
NP_441916.1_7 Forward -280 -270 10.3048 0.0261
NP_441916.1_7 Reverse -271 -281 10.3048 0.0261
NP_441916.1_10 Reverse -263 -282 2.0644 0.253
NP_440206.1_9 Forward -41 -22 8.35759 0.272
NP_441041.1_4 Reverse -91 -110 -10.817 0.237
NP_441041.1_4 Forward -280 -261 -11.6036 0.25
NP_442396.1_5 Forward -284 -271 11.819 0.0913
NP_442396.1_5 Reverse -267 -280 9.65572 0.129
NP_441725.1_5 Forward -279 -269 11.2881 0.0247
NP_441725.1_5 Reverse -272 -282 2.04498 0.115
NP_441725.1_5 Reverse -122 -132 -0.216628 0.241
NP_439966.1_7 Reverse -269 -279 15.8108 0.0124
NP_439966.1_7 Forward -282 -272 15.3192 0.0152
NP_439966.1_9 Reverse -89 -98 6.5879 0.253
NP_442941.1_3 Forward -279 -269 19.9412 0.00262
NP_442941.1_3 Reverse -272 -282 19.2529 0.00262
NP_442941.1_3 Reverse -92 -102 -1.00328 0.282
NP_440289.1_2 Reverse -268 -281 3.75586 0.0741
NP_440289.1_2 Forward -283 -270 3.06754 0.0811
NP_440289.1_4 Forward -376 -357 10.9142 0.228
NP_440983.1_5 Forward -100 -81 -6.29373 0.276
NP_442281.1_1 Reverse -266 -280 9.24208 0.0726
NP_442281.1_1 Forward -285 -271 7.17714 0.106
NP_442281.1_1 Forward -105 -91 1.5723 0.296
NP_441079.1_7 Forward -392 -373 -7.6711 0.296
NP_440177.1_9 Reverse -263 -282 18.9773 0.165
NP_442256.1_2 Forward -282 -264 8.96727 0.0965
NP_441644.1_6 Forward -280 -270 17.3841 0.00127
NP_441644.1_6 Reverse -271 -281 17.3841 0.00127
NP_441644.1_6 Reverse -363 -373 4.99446 0.216
NP_442215.1_2 Forward -250 -234 -3.18639 0.211
NP_442215.1_2 Reverse -269 -285 -4.1697 0.228
NP_440253.1_2 Forward -280 -262 14.4738 0.0198
NP_440253.1_2 Reverse -271 -289 -0.0791831 0.201
NP_440929.1_8 Forward -280 -271 19.2726 0.000701
NP_440929.1_8 Reverse -271 -280 19.2726 0.000701
NP_442933.1_10 Forward -280 -271 17.601 0.00325
NP_442933.1_10 Reverse -271 -280 17.601 0.00325
NP_441751.2_8 Forward -279 -265 -1.5737 0.129
NP_441751.2_8 Reverse -272 -286 -4.52363 0.174
NP_442554.1_8 Reverse -272 -282 16.2046 0.0065
NP_442554.1_8 Forward -279 -269 15.9097 0.00747
NP_441762.1_7 Forward -81 -69 -5.76255 0.238
NP_441762.1_7 Reverse -270 -282 -6.74586 0.284
NP_441762.1_7 Forward -281 -269 -6.84419 0.284
NP_442142.1_4 Reverse -268 -281 6.21356 0.17
NP_442142.1_4 Forward -283 -270 4.24695 0.227
NP_442292.1_1 Forward -279 -270 18.486 0.00229
NP_442292.1_1 Reverse -272 -281 18.486 0.00229
NP_442292.1_1 Reverse -92 -101 -0.68859 0.268
NP_442476.1_6 Reverse -272 -286 18.4858 0.0295
NP_442476.1_6 Forward -99 -85 1.27789 0.223
NP_442381.1_8 Forward -283 -264 -8.26035 0.215
NP_443009.1_5 Reverse -270 -281 8.90795 0.0965
NP_443009.1_5 Forward -281 -270 8.90795 0.0965
NP_443009.1_5 Forward -131 -120 3.79477 0.278
NP_443009.1_5 Forward -101 -90 3.49977 0.292
NP_441741.1_6 Forward -324 -305 7.96426 0.249
NP_441715.1_4 Reverse -272 -282 17.3846 0.0106
NP_441715.1_4 Forward -279 -269 14.828 0.0268
NP_441448.1_1 Reverse -254 -273 5.30933 0.261
NP_440183.1_9 Reverse -130 -149 -14.5535 0.266
NP_441468.1_1 Forward -279 -272 15.8704 0.0124
NP_441468.1_1 Reverse -272 -279 15.8704 0.0124
NP_441673.1_1 Forward -280 -271 20.8459 0.000698
NP_441673.1_1 Reverse -271 -280 20.8459 0.000698
NP_441826.1_2 Forward -286 -272 -3.34366 0.284
NP_441826.1_2 Forward -136 -122 -3.73699 0.286
NP_442868.1_6 Forward -282 -272 19.2529 0.00563
NP_442868.1_6 Reverse -269 -279 9.91146 0.038
NP_442719.1_2 Forward -399 -381 -0.571569 0.162
NP_442719.1_2 Forward -400 -382 -10.0113 0.268
NP_441251.1_7 Reverse -377 -390 10.344 0.288
NP_441251.1_8 Reverse -99 -112 16.2954 0.254
NP_441056.1_1 Forward -280 -261 -7.37537 0.272
NP_441612.1_2 Reverse -271 -281 8.54929 0.21
NP_441612.1_2 Forward -280 -270 8.54929 0.21
NP_442559.1_5 Reverse -228 -247 7.27595 0.214
NP_442227.1_2 Forward -261 -242 -3.24547 0.29
NP_440789.1_2 Forward -89 -70 17.0107 0.137
NP_442427.1_8 Forward -289 -270 19.3707 0.029
NP_442427.1_8 Reverse -375 -394 7.86593 0.203
NP_442808.1_1 Reverse -70 -80 15.3192 0.0233
NP_442808.1_1 Reverse -270 -280 8.63269 0.0481
NP_442808.1_1 Forward -281 -271 8.63269 0.0481
NP_442808.1_1 Forward -263 -253 3.22451 0.247
NP_440918.1_2 Reverse -126 -145 11.7992 0.259
NP_441849.1_2 Forward -360 -341 1.76618 0.245
NP_440145.1_3 Forward -151 -132 -4.13045 0.221
NP_440145.1_3 Reverse -261 -280 -5.70374 0.275
NP_442718.1_2 Reverse -254 -273 -4.42544 0.292
NP_442718.1_2 Reverse -343 -362 -5.11376 0.292
NP_442542.1_2 Forward -282 -269 9.75405 0.131
NP_442050.1_5 Reverse -269 -279 16.4991 0.00812
NP_442050.1_5 Forward -282 -272 14.3359 0.0206
NP_440558.1_2 Forward -110 -91 0.0977854 0.194
NP_440558.1_2 Forward -150 -131 -1.86883 0.218
NP_440558.1_2 Reverse -262 -281 -1.96717 0.22
NP_440558.1_2 Reverse -88 -107 -6.68705 0.279
NP_442724.1_1 Forward -399 -389 15.9097 0.278
NP_441518.1_3 Reverse -261 -280 -4.91709 0.121
NP_441878.1_6 Forward -281 -271 10.4031 0.0176
NP_441878.1_6 Reverse -270 -280 10.4031 0.0176
NP_441036.1_8 Forward -281 -271 8.33817 0.174
NP_441036.1_8 Reverse -270 -280 8.33817 0.174
NP_441557.1_5 Forward -280 -271 19.9609 0.000699
NP_441557.1_5 Reverse -271 -280 19.9609 0.000699
NP_441445.1_1 Reverse -262 -281 8.35759 0.122
NP_441445.1_8 Reverse -129 -148 -12.6852 0.287
NP_442066.2_9 Forward -284 -271 20.0788 0.00699
NP_440084.1_8 Forward -328 -314 11.9481 0.241
NP_441458.1_10 Forward -289 -270 1.37609 0.29
NP_442919.1_3 Reverse -300 -319 32.3539 0.000000334
NP_442183.1_1 Forward -280 -266 17.1092 0.0122
NP_442183.1_1 Forward -80 -66 10.1277 0.0888
NP_441574.1_1 Reverse -259 -278 -4.42544 0.252
NP_441574.1_1 Reverse -50 -69 -6.49039 0.277
NP_442347.1_2 Forward -279 -270 12.4878 0.056
NP_442347.1_2 Reverse -272 -281 12.4878 0.056
NP_442347.1_2 Forward -99 -90 4.81794 0.257
NP_442645.1_2 Reverse -263 -282 -13.8652 0.165
NP_442645.1_2 Reverse -89 -108 -20.2567 0.288
NP_442645.1_2 Forward -288 -269 -22.2233 0.29
NP_442594.1_8 Reverse -34 -53 4.42435 0.264
NP_441633.1_3 Forward -282 -269 3.36254 0.0699
NP_441633.1_3 Reverse -269 -282 -5.97891 0.236
NP_440136.1_2 Forward -279 -272 15.9687 0.0123
NP_440136.1_2 Reverse -272 -279 15.9687 0.0123
NP_442998.1_5 Reverse -106 -116 8.53483 0.261
NP_442998.1_5 Forward -386 -376 7.15819 0.299
NP_442998.1_10 Forward -278 -271 15.5754 0.0102
NP_442998.1_10 Reverse -273 -280 15.5754 0.0102
NP_440899.1_1 Reverse -260 -279 11.2376 0.164
NP_440899.1_8 Reverse -113 -132 -8.65367 0.258
NP_440899.1_8 Forward -359 -340 -10.3253 0.277
NP_440299.1_1 Reverse -267 -280 13.0967 0.0319
NP_440299.1_1 Forward -284 -271 10.9334 0.0529
NP_440299.1_1 Reverse -287 -300 2.87033 0.269
NP_441799.1_1 Forward -284 -270 13.5686 0.0311
NP_441799.1_1 Reverse -267 -281 10.0287 0.0797
NP_441799.1_1 Forward -75 -61 4.42388 0.25
NP_440977.1_1 Reverse -280 -299 37.3652 0.000000188
NP_440977.1_4 Reverse -345 -364 37.8569 0.000000502
NP_441007.1_10 Forward -285 -272 8.57408 0.112
NP_441007.1_10 Reverse -266 -279 -1.06236 0.3
NP_442201.1_10 Reverse -260 -279 -4.72043 0.152
NP_440256.1_1 Reverse -268 -287 1.86774 0.0702
NP_440256.1_1 Forward -283 -264 -2.75381 0.122
NP_440087.1_1 Forward -80 -61 -4.32711 0.246
NP_441559.1_8 Reverse -117 -131 -6.19526 0.275
NP_441559.1_8 Reverse -67 -81 -7.76856 0.299
NP_442860.1_7 Reverse -300 -318 8.22348 0.283
NP_440915.1_6 Forward -284 -270 0.687908 0.155
NP_442158.1_4 Reverse -125 -135 14.533 0.176
NP_441704.1_8 Forward -291 -272 9.34008 0.182
NP_442069.1_7 Forward -148 -129 11.6017 0.231
NP_442452.1_3 Reverse -243 -262 11.5042 0.163
NP_440748.1_5 Forward -104 -85 -2.16383 0.271
NP_440695.1_5 Reverse -259 -278 0.58944 0.284
NP_442386.1_9 Reverse -270 -279 13.8639 0.0289
NP_442386.1_9 Forward -281 -272 13.8639 0.0289
NP_441340.1_5 Forward -279 -272 15.6737 0.0124
NP_441340.1_5 Reverse -272 -279 15.6737 0.0124
NP_442484.1_2 Forward -291 -272 19.9606 0.0181
NP_440168.1_9 Forward -282 -263 -5.01543 0.296
NP_440327.1_6 Reverse -80 -99 10.3242 0.192
NP_442474.1_1 Reverse -308 -327 -4.22878 0.297
NP_440211.1_4 Reverse -6 -16 14.9263 0.258
NP_440586.1_8 Forward -279 -272 13.2151 0.026
NP_440586.1_8 Reverse -272 -279 13.2151 0.026
NP_440586.1_8 Forward -70 -63 7.51192 0.239
NP_440586.1_8 Reverse -364 -371 5.64364 0.297
NP_442251.1_6 Forward -279 -272 15.2804 0.0124
NP_442251.1_6 Reverse -272 -279 15.2804 0.0124
NP_440684.1_9 Reverse -265 -279 8.65272 0.225
NP_441262.1_3 Reverse -271 -278 14.7888 0.0223
NP_441262.1_3 Forward -280 -273 14.7888 0.0223
NP_441262.1_3 Reverse -91 -98 5.15232 0.265
NP_443051.1_1 Reverse -270 -279 10.4228 0.00754
NP_443051.1_1 Forward -281 -272 10.4228 0.00754
NP_440408.1_7 Reverse -271 -290 7.27595 0.29
NP_440439.1_1 Reverse -68 -81 -1.75067 0.281
NP_440372.1_2 Forward -279 -272 16.3621 0.0124
NP_440372.1_2 Reverse -272 -279 16.3621 0.0124
NP_440271.1_2 Reverse -245 -264 6.19431 0.23
NP_440574.1_7 Reverse -125 -144 8.45592 0.3
NP_439977.1_5 Forward -286 -267 -1.27885 0.245
NP_441572.1_7 Forward -56 -37 -1.96717 0.19
NP_442384.1_10 Reverse -271 -284 19.2922 0.00338
NP_442384.1_10 Reverse -62 -75 13.7856 0.0186
NP_442384.1_10 Forward -280 -267 8.77074 0.0608
NP_442035.1_8 Reverse -88 -102 15.9292 0.223
NP_440699.1_1 Reverse -295 -314 3.10306 0.288
NP_441018.1_7 Reverse -162 -181 6.19431 0.297
NP_442790.1_4 Forward -289 -270 -8.752 0.174
NP_442262.1_2 Reverse -308 -327 15.3417 0.247
NP_442262.1_10 Forward -279 -272 14.1988 0.0123
NP_442262.1_10 Reverse -272 -279 14.1988 0.0123
NP_441689.1_5 Reverse -269 -279 15.3192 0.0403
NP_441689.1_5 Forward -282 -272 5.78111 0.197
NP_440163.1_10 Reverse -268 -278 10.4031 0.201
NP_440344.1_10 Reverse -264 -281 -9.49926 0.147
NP_440344.1_10 Forward -107 -90 -12.0559 0.239
NP_440531.1_6 Forward -288 -269 -0.885524 0.225
NP_440189.1_2 Forward -249 -230 3.73603 0.268
NP_441965.1_10 Reverse -268 -284 11.6616 0.107
NP_440297.1_9 Forward -279 -269 9.32148 0.0917
NP_440297.1_9 Reverse -272 -282 -0.118297 0.282
NP_440999.1_9 Forward -284 -270 -0.787057 0.217
NP_440888.1_2 Reverse -271 -285 16.8135 0.00536
NP_440888.1_2 Forward -280 -266 15.8302 0.00862
NP_440600.1_4 Forward -288 -270 5.91901 0.104
NP_441543.1_2 Forward -279 -270 16.9127 0.00359
NP_441543.1_2 Reverse -272 -281 16.9127 0.00359
NP_442845.1_2 Reverse -265 -279 4.52282 0.258
NP_441469.1_8 Forward -281 -272 6.48957 0.227
NP_441469.1_8 Reverse -270 -279 6.48957 0.227
NP_442315.1_1 Forward -117 -99 3.65739 0.287
NP_442637.1_1 Reverse -314 -333 -3.54046 0.16
NP_442637.1_7 Forward -364 -345 3.73603 0.166
NP_443064.1_6 Forward -280 -270 12.5669 0.0796
NP_443064.1_6 Reverse -271 -281 12.5669 0.0796
NP_442337.1_8 Reverse -127 -146 3.93269 0.21
NP_442578.1_7 Forward -279 -272 14.5921 0.026
NP_442578.1_7 Reverse -272 -279 14.5921 0.026
NP_440710.1_1 Forward -288 -270 -1.35749 0.179
NP_440710.1_1 Reverse -263 -281 -3.81576 0.208
NP_440148.1_1 Forward -33 -14 -4.32711 0.219
NP_441462.1_2 Forward -280 -270 11.5831 0.00406
NP_441462.1_2 Reverse -271 -281 11.5831 0.00406
NP_443062.1_1 Forward -280 -262 14.0063 0.0538
NP_441560.1_3 Forward -145 -127 7.39397 0.28
NP_442487.1_3 Reverse -93 -112 15.1424 0.229
NP_440255.1_8 Reverse -264 -283 13.7525 0.28
NP_440516.1_8 Forward -280 -271 16.9127 0.00442
NP_440516.1_8 Reverse -271 -280 16.9127 0.00442
NP_440516.1_8 Forward -80 -71 -0.68859 0.297
NP_441033.1_2 Reverse -261 -280 -7.96535 0.293
NP_442428.1_5 Forward -279 -272 15.8704 0.0124
NP_442428.1_5 Reverse -272 -279 15.8704 0.0124
NP_442428.1_8 Reverse -76 -95 0.392778 0.241
NP_440673.1_2 Reverse -261 -280 10.5847 0.203
NP_440673.1_3 Forward -278 -271 12.4288 0.0426
NP_440673.1_3 Reverse -273 -280 12.4288 0.0426
NP_440673.1_3 Forward -370 -363 10.9539 0.106
NP_441052.1_2 Forward -280 -270 19.9412 0.00106
NP_441052.1_2 Reverse -271 -281 19.9412 0.00106
NP_442219.1_8 Reverse -87 -106 7.97384 0.257
NP_442219.1_9 Forward -279 -270 17.7976 0.00718
NP_442219.1_9 Reverse -272 -281 17.7976 0.00718
NP_440436.1_4 Forward -279 -270 17.2072 0.00233
NP_440436.1_4 Reverse -272 -281 17.2072 0.00233
NP_440436.1_4 Reverse -92 -101 4.22755 0.277
NP_441884.1_9 Reverse -268 -287 -23.895 0.284
NP_442864.1_2 Reverse -92 -111 13.0775 0.227
NP_440314.1_9 Forward -279 -260 10.2259 0.0289
NP_440314.1_9 Reverse -63 -82 -8.45701 0.248
NP_441719.1_4 Forward -279 -272 16.3621 0.0124
NP_441719.1_4 Reverse -272 -279 16.3621 0.0124
NP_442366.1_3 Reverse -120 -138 -5.29072 0.286
NP_439949.1_7 Reverse -6 -20 16.4209 0.176
NP_441115.1_4 Reverse -362 -380 7.58986 0.279
NP_442694.1_4 Forward -319 -310 14.8477 0.164
NP_442586.1_6 Reverse -165 -184 11.1109 0.227
NP_441851.1_10 Forward -281 -271 15.8113 0.00552
NP_441851.1_10 Reverse -270 -280 15.8113 0.00552
NP_441851.1_10 Forward -101 -91 4.0116 0.291
NP_442001.1_1 Forward -365 -346 -5.31116 0.276
NP_442622.1_8 Reverse -71 -89 -19.0571 0.296
NP_441354.1_1 Reverse -314 -333 4.22769 0.213
NP_441542.1_4 Forward -397 -383 9.73436 0.25
NP_441668.1_4 Reverse -261 -280 3.04771 0.188
NP_442515.1_1 Reverse -270 -284 20.3541 0.0162
NP_442515.1_1 Forward -281 -267 18.7808 0.0192
NP_442515.1_1 Forward -101 -87 0.982901 0.174
NP_441046.1_2 Forward -36 -17 5.30933 0.227
NP_442689.1_8 Reverse -17 -34 -6.15601 0.28
NP_441349.1_10 Reverse -261 -280 -5.21209 0.194
NP_440874.1_2 Forward -362 -343 20.5519 0.0141
NP_442314.1_1 Forward -148 -130 -5.09406 0.272
NP_440432.1_9 Forward -279 -264 8.33803 0.0427
NP_440432.1_9 Reverse -272 -287 4.50312 0.0691
NP_442843.1_1 Reverse -63 -82 -5.50708 0.244
NP_440474.1_8 Forward -279 -265 4.62054 0.271
NP_441124.1_5 Reverse -106 -116 14.0586 0.215
NP_442450.1_5 Reverse -269 -279 9.32148 0.115
NP_439950.1_1 Reverse -7 -16 17.306 0.145
NP_439950.1_3 Reverse -320 -339 3.14605 0.293
NP_442006.1_2 Forward -146 -129 -16.7758 0.264
NP_443047.1_7 Forward -279 -260 5.01433 0.246
NP_442243.1_1 Forward -286 -268 1.5917 0.21
NP_441570.1_1 Forward -280 -262 -0.669169 0.0498
NP_441570.1_1 Reverse -271 -289 -15.0255 0.227
NP_441078.1_4 Forward -280 -271 19.6659 0.0007
NP_441078.1_4 Reverse -271 -280 19.6659 0.0007
NP_442729.1_8 Forward -284 -271 10.639 0.125
NP_442729.1_8 Reverse -267 -280 10.1474 0.125
NP_442348.1_2 Forward -319 -310 6.68623 0.299
NP_440707.1_7 Reverse -64 -83 3.6377 0.284
NP_440526.1_3 Forward -99 -88 5.95804 0.223
NP_440526.1_3 Reverse -272 -283 1.04151 0.267
NP_440526.1_3 Forward -279 -268 0.943182 0.267
NP_441432.1_8 Reverse -270 -279 16.8143 0.00595
NP_441432.1_8 Forward -281 -272 16.8143 0.00595
NP_441432.1_9 Forward -346 -333 11.604 0.221
NP_441333.1_1 Forward -313 -303 12.9245 0.217
NP_442320.1_8 Reverse -265 -279 11.6026 0.0179
NP_442320.1_8 Forward -286 -272 -4.52363 0.171
NP_442320.1_8 Reverse -85 -99 -5.70361 0.245
NP_441732.1_2 Reverse -267 -283 -16.5594 0.174
NP_440760.1_1 Reverse -271 -290 -5.60541 0.0503
NP_440760.1_1 Forward -280 -261 -20.65 0.224
NP_440199.1_10 Reverse -268 -278 7.64985 0.231
NP_442968.1_5 Reverse -65 -84 21.3373 0.063
NP_442489.1_7 Forward -280 -271 20.1576 0.000695
NP_442489.1_7 Reverse -271 -280 20.1576 0.000695
NP_440565.1_2 Reverse -131 -145 14.4488 0.292
NP_440386.1_3 Reverse -344 -363 -4.72043 0.221
NP_442079.1_7 Forward -279 -260 9.73422 0.111
NP_440559.1_1 Forward -279 -270 17.4043 0.00658
NP_440559.1_1 Reverse -272 -281 17.4043 0.00658
NP_441659.2_8 Forward -280 -270 18.1713 0.00133
NP_441659.2_8 Reverse -271 -281 18.1713 0.00133
NP_442913.1_10 Reverse -262 -281 -0.000545616 0.156
NP_441040.1_5 Forward -57 -38 2.65439 0.28
NP_442346.1_5 Forward -281 -271 16.6963 0.00248
NP_442346.1_5 Reverse -270 -280 16.6963 0.00248
NP_442346.1_5 Forward -72 -62 11.5831 0.0634
NP_442346.1_5 Reverse -238 -248 7.64985 0.162
NP_442346.1_5 Reverse -362 -372 7.35486 0.172
NP_441856.1_6 Reverse -96 -110 17.6008 0.144
NP_440025.1_3 Forward -275 -261 9.44903 0.296
NP_441126.1_4 Forward -89 -70 16.1249 0.29
NP_440459.1_2 Reverse -269 -286 8.10198 0.27
NP_441653.1_2 Forward -91 -72 5.84883 0.235
NP_441653.1_2 Forward -291 -272 5.07576 0.248
NP_440010.1_4 Forward -162 -143 -2.16459 0.275
NP_442603.1_7 Reverse -271 -285 17.8952 0.0187
NP_442603.1_7 Forward -280 -266 8.84875 0.162
NP_441833.1_4 Forward -279 -272 15.9687 0.0124
NP_441833.1_4 Reverse -272 -279 15.9687 0.0124
NP_441329.1_6 Reverse -294 -313 5.1084 0.191
NP_441329.1_6 Reverse -296 -315 -3.00842 0.294
NP_440912.1_3 Forward -316 -297 10.52 0.254
NP_442162.1_9 Forward -279 -272 16.2637 0.0124
NP_442162.1_9 Reverse -272 -279 16.2637 0.0124
NP_442140.1_3 Reverse -272 -282 10.3048 0.0902
NP_442140.1_3 Forward -279 -269 4.40493 0.243
NP_441692.1_2 Reverse -325 -344 34.317 0.000000227
NP_441671.1_9 Reverse -66 -85 8.84924 0.26
NP_441813.1_5 Forward -282 -272 18.1713 0.00743
NP_441813.1_5 Reverse -269 -279 15.9097 0.01
NP_440594.1_5 Forward -129 -110 4.91521 0.293
NP_440590.1_4 Reverse -272 -285 9.75405 0.0335
NP_440590.1_4 Reverse -92 -105 8.86907 0.0408
NP_440590.1_4 Forward -279 -266 -6.07724 0.299
NP_440567.1_1 Forward -279 -265 3.53951 0.141
NP_442497.1_10 Forward -279 -270 10.4228 0.0087
NP_442497.1_10 Reverse -272 -281 10.4228 0.0087
NP_440821.1_4 Reverse -269 -279 18.2696 0.00448
NP_440821.1_4 Forward -282 -272 9.41981 0.0286
NP_440821.1_4 Reverse -89 -99 4.40493 0.131
NP_441239.1_9 Forward -282 -270 5.25052 0.223
NP_441239.1_9 Reverse -269 -281 4.36554 0.253
NP_441239.1_9 Reverse -69 -81 4.26721 0.256
NP_441239.1_9 Forward -52 -40 3.2839 0.289
NP_440796.1_3 Reverse -264 -282 10.4414 0.204
NP_442270.1_9 Forward -111 -92 -9.24366 0.228
NP_441017.1_6 Reverse -267 -281 13.1753 0.203
NP_441017.1_8 Reverse -118 -133 9.12468 0.231
NP_442216.1_4 Forward -16 -8 17.6202 0.23
NP_440354.1_7 Forward -286 -268 5.91901 0.296
NP_442138.1_10 Forward -280 -261 -7.17871 0.286
NP_440546.1_4 Forward -280 -270 10.046 0.109
NP_440546.1_4 Reverse -271 -281 10.046 0.109
NP_440462.1_6 Forward -282 -272 9.61647 0.0429
NP_440462.1_6 Reverse -269 -279 7.74818 0.0699
NP_440462.1_6 Reverse -69 -79 2.53664 0.282
NP_440462.1_7 Forward -36 -19 17.0501 0.223
NP_440868.1_4 Forward -284 -272 9.97041 0.0405
NP_440868.1_4 Reverse -267 -279 5.84051 0.0879
NP_442479.1_9 Forward -118 -99 3.83436 0.179
NP_440341.1_5 Forward -88 -69 14.8474 0.229
NP_442402.1_10 Forward -15 -5 10.5993 0.287
NP_441848.1_7 Forward -353 -334 0.195343 0.228
NP_441084.1_6 Forward -73 -59 9.92586 0.257
NP_442358.1_1 Reverse -263 -281 21.7503 0.0326
NP_442039.1_4 Forward -279 -272 15.1821 0.0124
NP_442039.1_4 Reverse -272 -279 15.1821 0.0124
NP_442039.1_7 Reverse -3 -13 7.45319 0.276
NP_441811.1_8 Forward -106 -92 5.80112 0.289
NP_441926.1_3 Forward -280 -264 5.6634 0.17
NP_440825.1_6 Reverse -119 -138 8.25926 0.285
NP_442837.1_3 Forward -279 -272 15.7721 0.0124
NP_442837.1_3 Reverse -272 -279 15.7721 0.0124
NP_442837.1_3 Reverse -133 -140 6.13563 0.25
NP_442053.1_1 Forward -280 -271 18.3876 0.0007
NP_442053.1_1 Reverse -271 -280 18.3876 0.0007
NP_440505.1_3 Forward -282 -272 18.3679 0.00213
NP_440505.1_3 Reverse -269 -279 16.303 0.00696
NP_440505.1_3 Reverse -89 -99 4.69992 0.272
NP_441959.1_8 Forward -360 -347 10.4446 0.286
NP_441203.1_1 Forward -279 -260 -14.9469 0.208
NP_442532.1_1 Reverse -299 -313 11.8628 0.215
NP_440914.1_1 Forward -280 -270 17.5935 0.000537
NP_440914.1_1 Reverse -271 -281 17.5935 0.000537
NP_440914.1_1 Forward -100 -90 13.2019 0.0378
NP_441011.1_8 Forward -279 -270 8.25953 0.144
NP_441011.1_8 Reverse -272 -281 8.25953 0.144
NP_441011.1_8 Forward -79 -70 5.50626 0.256
NP_442101.1_10 Reverse -263 -282 -10.4236 0.255
NP_442533.1_1 Reverse -242 -261 -16.2252 0.263
NP_442533.1_6 Forward -280 -271 17.2076 0.00137
NP_442533.1_6 Reverse -271 -280 17.2076 0.00137
NP_442533.1_6 Forward -71 -62 3.04799 0.228
NP_442232.1_3 Reverse -35 -54 -13.6686 0.282
NP_443016.1_1 Reverse -265 -284 -4.72043 0.235
NP_441482.1_7 Forward -286 -272 -2.85201 0.1
NP_441482.1_7 Reverse -265 -279 -3.44199 0.124
NP_439944.1_9 Forward -279 -269 19.0562 0.00329
NP_439944.1_9 Reverse -272 -282 10.5014 0.0887
NP_441028.1_6 Forward -267 -257 7.94438 0.217
NP_441527.1_4 Reverse -333 -352 0.715766 0.134
NP_441527.1_4 Reverse -248 -267 -5.49121 0.202
NP_440115.1_6 Forward -283 -273 6.76487 0.167
NP_440007.1_9 Forward -104 -90 1.67122 0.285
NP_442673.1_7 Forward -314 -295 16.6629 0.13
NP_441972.1_5 Reverse -272 -291 -8.85033 0.272
NP_441106.1_1 Forward -281 -272 9.63616 0.0311
NP_441106.1_1 Reverse -270 -279 9.63616 0.0311
NP_441106.1_1 Forward -53 -44 2.26134 0.293
NP_441825.1_4 Forward -320 -310 13.8447 0.249
NP_442306.1_10 Forward -285 -266 -19.8634 0.201
NP_441286.1_1 Forward -281 -269 21.3768 0.00196
NP_441286.1_1 Reverse -270 -282 12.9203 0.00815
NP_441286.1_1 Reverse -90 -102 -0.649339 0.135
NP_441286.1_1 Forward -101 -89 -7.04085 0.3
NP_442674.1_3 Reverse -231 -250 4.62021 0.288
NP_440670.1_8 Forward -280 -271 18.3876 0.000699
NP_440670.1_8 Reverse -271 -280 18.3876 0.000699
NP_440670.1_8 Forward -100 -91 4.81794 0.18
NP_440886.1_7 Forward -281 -271 7.94438 0.0805
NP_440886.1_7 Reverse -270 -280 7.94438 0.0805
NP_440886.1_7 Forward -81 -71 3.61784 0.272
NP_440828.1_4 Forward -63 -44 -8.16275 0.296
NP_442614.1_2 Reverse -271 -285 8.94771 0.242
NP_442072.1_9 Reverse -270 -288 -21.712 0.212
NP_440907.2_9 Forward -120 -101 8.65176 0.115
NP_441021.1_1 Forward -279 -260 -12.9802 0.3
NP_440326.1_9 Forward -362 -343 11.5033 0.274
NP_441463.1_3 Reverse -261 -280 1.37609 0.127
NP_441463.1_6 Reverse -269 -283 8.0587 0.25
NP_442842.1_10 Forward -353 -334 5.22221 0.207
NP_441626.1_2 Forward -279 -272 15.7721 0.0124
NP_441626.1_2 Reverse -272 -279 15.7721 0.0124
NP_439958.1_2 Reverse -340 -354 17.5025 0.115
NP_442365.1_7 Forward -284 -265 9.63589 0.0723
NP_442365.1_7 Forward -278 -259 -2.65548 0.202
NP_442238.1_7 Forward -391 -372 10.7167 0.201
NP_442794.1_1 Forward -284 -272 7.31547 0.142
NP_442794.1_1 Reverse -267 -279 7.11881 0.148
NP_442615.1_1 Forward -289 -271 -4.70074 0.192
NP_440387.1_1 Forward -280 -264 14.6115 0.00635
NP_440387.1_1 Reverse -271 -287 -4.75968 0.198
NP_441488.1_8 Forward -105 -91 9.53707 0.15
NP_441836.1_2 Reverse -56 -75 -5.9004 0.288
NP_441836.1_2 Reverse -265 -284 -6.39206 0.297
NP_440114.1_10 Forward -280 -266 6.3911 0.273
NP_440114.1_10 Reverse -271 -285 6.09611 0.285
NP_442698.1_10 Reverse -297 -316 7.86593 0.233
NP_442087.1_2 Reverse -271 -290 16.3099 0.133
NP_442087.1_7 Forward -330 -311 -3.73788 0.285
NP_440766.1_4 Reverse -39 -53 1.47456 0.23
NP_441237.1_9 Reverse -92 -102 10.1081 0.248
NP_439910.1_2 Reverse -263 -280 -21.594 0.183
NP_442867.1_8 Reverse -129 -148 6.4893 0.26
NP_440457.1_1 Reverse -267 -279 0.0389777 0.25
NP_440457.1_1 Forward -284 -272 -0.74767 0.273
NP_440987.1_4 Forward -34 -15 7.47261 0.18
NP_442680.1_5 Reverse -327 -346 4.07754 0.227
NP_442297.1_10 Reverse -329 -348 17.404 0.11
NP_441332.1_6 Forward -263 -253 12.6149 0.221
NP_442509.1_9 Forward -280 -270 8.14104 0.192
NP_442509.1_9 Reverse -271 -281 8.14104 0.192
NP_441489.1_3 Reverse -337 -351 8.79688 0.232
NP_442582.1_3 Forward -400 -386 12.6166 0.284
NP_441765.1_1 Forward -73 -54 34.612 0.00000813
NP_441765.1_2 Forward -172 -153 25.7622 0.00184
NP_441765.1_3 Forward -151 -132 18.289 0.072
NP_441765.1_4 Forward -125 -106 26.7455 0.00153
NP_441765.1_5 Forward -52 -33 21.3373 0.093
NP_441765.1_6 Forward -208 -189 24.9755 0.00796
NP_441765.1_7 Forward -100 -81 28.8104 0.000528
NP_441765.1_8 Forward -369 -350 18.9765 0.0776
NP_440185.1_9 Reverse -31 -48 20.0984 0.0855
NP_440554.1_4 Reverse -272 -282 8.92815 0.0646
NP_440554.1_4 Forward -279 -269 7.05986 0.106
NP_442862.1_3 Forward -390 -373 6.13536 0.267
NP_441885.1_5 Forward -280 -270 20.9245 0.000538
NP_441885.1_5 Reverse -271 -281 20.9245 0.000538
NP_441885.1_5 Forward -100 -90 -0.216628 0.189
NP_441275.1_3 Reverse -381 -395 21.5341 0.0286
NP_440628.1_1 Reverse -301 -311 13.6803 0.279
NP_442341.1_7 Forward -281 -267 7.66941 0.0994
NP_442341.1_7 Reverse -270 -284 6.78443 0.118
NP_440423.1_6 Reverse -263 -282 -15.5368 0.229
NP_443000.1_7 Forward -282 -272 19.9412 0.00223
NP_443000.1_7 Reverse -269 -279 17.0896 0.00865
NP_440507.2_3 Reverse -262 -281 9.63507 0.218
NP_440275.1_3 Forward -282 -272 15.123 0.0182
NP_440275.1_3 Reverse -269 -279 8.1415 0.0602
NP_440560.1_1 Forward -33 -14 15.0183 0.155
NP_440091.1_1 Reverse -267 -279 7.11881 0.0874
NP_442451.1_2 Forward -138 -119 -3.3438 0.195
NP_442451.1_2 Forward -288 -269 -7.17871 0.232
NP_441635.1_2 Reverse -319 -338 10.074 0.283
NP_441207.1_7 Reverse -344 -358 8.67452 0.282
NP_440175.1_7 Forward -346 -328 8.97275 0.282
NP_440641.1_7 Reverse -95 -114 14.9458 0.169
NP_440149.1_8 Reverse -271 -290 13.9625 0.0273
NP_440149.1_8 Forward -280 -261 -2.85214 0.176
NP_440216.1_1 Reverse -271 -285 8.94771 0.00589
NP_440216.1_1 Forward -280 -266 -2.85201 0.0608
NP_440216.1_9 Forward -135 -126 15.536 0.128
NP_440172.1_1 Forward -280 -270 15.0247 0.00945
NP_440172.1_1 Reverse -271 -281 15.0247 0.00945
NP_442371.1_1 Reverse -5 -15 13.4509 0.206
NP_442015.1_10 Forward -284 -271 2.67422 0.187
NP_442015.1_10 Reverse -267 -280 0.510939 0.224
NP_441226.1_7 Forward -279 -272 14.4934 0.0123
NP_441226.1_7 Reverse -272 -279 14.4934 0.0123
NP_441757.1_3 Reverse -270 -289 0.491109 0.188
NP_441111.1_7 Forward -279 -271 18.7023 0.00294
NP_441111.1_7 Reverse -272 -280 18.7023 0.00294
NP_442379.1_10 Reverse -264 -281 -3.20608 0.252
NP_441766.1_2 Forward -280 -271 17.5026 0.00297
NP_441766.1_2 Reverse -271 -280 17.5026 0.00297
NP_443052.1_8 Reverse -261 -280 7.96426 0.026
NP_442116.1_6 Forward -33 -16 10.9382 0.215
NP_442116.1_6 Reverse -344 -361 5.87715 0.289
NP_442403.1_9 Forward -83 -64 5.40766 0.211
NP_440261.1_5 Reverse -272 -285 6.90245 0.0316
NP_440261.1_5 Reverse -63 -76 -4.60227 0.158
NP_440988.1_10 Reverse -269 -283 7.51277 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGTTTTGACAATATGTCCAAAATTTGATATCATCGCTTCAATTATTCTAATATTTCTGCCCTTTATTCTATCATTTTAAAGGGCTTTTTTTCTCTTTATAACTATCGTTCAACACTTCTGGCGATCGCCATATTGTCCCCCTTACCCTGTTTACCATGACCAAGCGTAGTAATTTGGATTCTAACCACATTATTTATCGTTCCGAAGAGCTCCTAGGAGCCGCATCAAACCGCTACAACATTACTGTCAGGGTAGCCAAGCGAGCCAAGGAAAATCGCTCCGAAGATTTTGACAGCATTGACGATCCCAACATGAAGCCGGCTATCCGGGCCATCATTGAAATGTCCGACGAGCTCACCCGCCCAGAAATTATTAGCGATAATTAATTCCCCCAGTTCC

CDS

ATGTTTAAGCCCCTTTTTCCCCTGACGTTACTATTGGGTTGTCTGAGCTTTTTGCTCACCATGCTACTCCATAGTCCCGGACAGTGGGGGGCTGTTTCCCAGGCTCAGCCGGCCCCGCCCGCTCAGGGAGTGCCCGCCGGAGGATATACGGTGGTGGTGGAAATAATTGCTCAGCAGGTTTACGCTCGTTTTCCCGATTTGCCCAAGGGTAACGATTACCGCCGCCAAAGCGATGGTAGCCCAGATCCGGAGAATACCCTGATCAGTCGGATGATCCGATATCACCGCGATATACAAAAAAGGCCAACCCGCTATCGTTTTGATTGGCGTTTAACCCTAGCGGATTACCTTGGTGCCAATGATCAAATGGTGCCGGAGCGTTATCCCGGTTTTTCCACTCTCCAAACAAGTCCCCTCGATGGCGATCGCCAACTTATTGCCGGGCTAAATCGGAAACAACGGCAGGAATTAGTAGATTTTCTCGCCGAACTTTATCGCCCCCAGGCCGCATCCAATGGAACAGATTCTGGTTCGGGGGAACAAGGTGATCAGAATCCAACGGCGCCCCCAGCCGTTACAGCTCCCAATCAACCTGGACTTTCCCAGCCGGGGGATGCCCAATTGTTGATGCCCTAG

Protein

MFKPLFPLTLLLGCLSFLLTMLLHSPGQWGAVSQAQPAPPAQGVPAGGYTVVVEIIAQQVYARFPDLPKGNDYRRQSDGSPDPENTLISRMIRYHRDIQKRPTRYRFDWRLTLADYLGANDQMVPERYPGFSTLQTSPLDGDRQLIAGLNRKQRQELVDFLAELYRPQAASNGTDSGSGEQGDQNPTAPPAVTAPNQPGLSQPGDAQLLMP